The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
78
|
structure length |
76
|
Chain Sequence |
YLEQKMFAAMVADNQMAMVMLNKNLKASNGEEELAGQTWYWKVAPVATTQPLKAFDVSVAAEKQASPIITVRSYVA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Protein transport/immune system
|
molecule keywords |
Type II secretory pathway, pseudopilin EpsI
|
publication title |
Nanobody-aided structure determination of the EpsI:EpsJ pseudopilin heterodimer from Vibrio vulnificus.
pubmed doi rcsb |
source organism |
Vibrio vulnificus
|
total genus |
15
|
structure length |
76
|
sequence length |
78
|
chains with identical sequence |
D, G, J
|
ec nomenclature | |
pdb deposition date | 2008-03-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02501 | T2SSI | Type II secretion system (T2SS), protein I |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Pantoate--beta-alanine Ligase; Chain: A,domain 2 | GSPII I/J protein-like |
#chains in the Genus database with same CATH superfamily 2LME A; 3CI0 K; 2GR8 A; 2RET A; 5BW0 B; 3CI0 I; 3CFI A; 2GR7 A; 3EMO A; #chains in the Genus database with same CATH topology 3N8H A; 2OGF A; 1N2E A; 4DDM A; 2IEC A; 4G5Y A; 4MQ6 A; 3UY4 A; 3CI0 I; 4EF6 A; 4MUG A; 3IVG A; 3CFF L; 2EJC A; 1N2G A; 1IHO A; 2A86 A; 4DDH A; 2A52 A; 4IXJ A; 2A88 A; 3MUE A; 3CI0 K; 2I52 A; 4BHR A; 3IUB A; 4DDK A; 3COZ A; 3IME A; 3IMG A; 1V8F A; 1MOP A; 3IOC A; 1N2O A; 4MUH A; 5HG0 A; 3Q10 A; 5G2F A; 3UA0 A; 3QTT A; 2A54 A; 3HL6 A; 3IMC A; 3IVC A; 2G5Z A; 2A7X A; 2X3F A; 3IOB A; 3AG6 A; 2G16 A; 1N2I A; 2A84 A; 3COY A; 4MUE A; 2GR8 A; 2GW4 A; 5BW0 B; 2G2S A; 3CFI A; 4MUF A; 3ISJ A; 4MUI A; 3LE8 A; 2RET A; 1N2H A; 4MUJ A; 3INN A; 4FZJ A; 3IUE A; 4MUK A; 2A56 A; 1N2J A; 3EMO A; 2LME A; 5KWV A; 4MUL A; 1UFV A; 3IOE A; 4DE5 A; 1N2B A; 2G3D A; 4G5F A; 3MXT A; 2GR7 A; 2A50 A; 2A53 A; 3AG5 A; 3IVX A; 3COV A; 3CFH L; 5EXC A; 4EFK A; 3COW A; 3LF4 A; 3CFA L; 3Q12 A; 3UK2 A; 3IOD A; 4MUN A; #chains in the Genus database with same CATH homology 2LME A; 3CI0 K; 2GR8 A; 2RET A; 5BW0 B; 3CI0 I; 3CFI A; 2GR7 A; 3EMO A; 3CI0 J;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...