3D6TB

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
125
Chain Sequence
MKLMIVGNTGSGKTTLLQLMGIDVKDWPLVLVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDKILLGFPAIRDYHFVNATEESLRKTII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat serine/threonine-protein kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 22
structure length 125
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 3d6tB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d6tB02
1ZCAA 2MMGA 4JBYA 5JJKA 4MRRA 4JKYA 1P2TA 1Z2AA 3B1VA 3VX4A 5JS7A 4DZZA 1QBKC 2CJWA 1XTRA 4L15A 4US1R 2J45A 3GJ6A 1KHTA 2V6JA 4JKIA 4LBWA 1SULA 3TMKA 2YOGA 1FFHA 5FOWA 2ONKA 2PZEA 5SZIA 2V1UA 1J2JA 1GDDA 1VG1A 1D2MA 1Q21A 5DH9A 4BFXA 4KYUA 5HKKA 2WWXA 4LZZA 1UJ2A 1YQTA 3EPHA 2C96A 5GJCA 3AKYA 3U3JA 4PSAA 1RRFA 1EFRA 1T3HA 3S1AA 4LBZA 2N46A 4EFNA 3EIQA 3SU8A 2IYZA 4JVLA 2CVHA 2XGJA 3VNVA 4LHZA 5CJPA 4Q47A 2LCFA 5AWFC 2EFCB 3V9PA 1DG3A 4LJYA 4XOIA 2VP6A 5KNBA 1OYYA 1KDTA 1RRGA 3AP3A 4IEEA 4Z1MD 2O8FA 4ILEA 3ND8A 3E2IA 3WNCA 1DAMA 3UATA 4AYTA 4EJSC 5JECA 3PEWA 1P61B 1Q44A 2C99A 1XPOA 2V4ZA 1AZTA 5FR2A 2YKGA 2DWPA 5JEEA 1UDXA 4TMVA 5SZJA 4DJTA 1XZPA 1VECA 3GLGB 1H8EA 4EJSA 2B21A 2WWGA 1Z29A 2H92A 3RRNA 1LF0A 3KQKA 3NDPA 4BWYA 1GZSA 1U2RA 2IT1A 4NMMA 3AF4A 2YNMA 3QBTA 4U00A 1Z0KA 2PX3A 4FCWA 421PA 1KMHB 2DWOA 5EE9A 1GILA 3PENA 4TSFA 5C1BA 3ZGXA 2QBYB 2VSFA 1Z0IA 1BMFA 5FUXA 3BRWD 2GXQA 4MRPA 5CJ2A 2IUUA 3U3MA 4IOLA 1TUEA 4LGMA 1W36B 1DEKA 1VCOA 4A8JB 4DSUA 1W5TA 1SHZA 1JR3E 4I1UA 4A8JA 1E96A 3R8CA 1P9WA 4PO9A 4DVGA 2CCGA 5KHOC 2XTZA 3W90A 3I1FA 4LBVA 4G01B 3TQFA 1KI4A 1YR9A 3EPJA 5KO2A 2BBTA 2VF8A 1E9AA 1NN5A 5CIWA 1P62B 2C77A 4EPYA 4CVNA 4PQRA 1II8B 1RZ3A 1YZQA 1OSNA 121PA 2QTVB 4B74A 3AVTA 1U98A 4PQYA 4MYHA 1ZM7A 2PX0A 4XD7A 3CNLA 2J59A 5EP2A 3WYAA 4B6FA 4ESHA 5LD2B 2DY1A 4IVRA 4X8MA 1JAIA 2GK6A 3ETLA 2SHKA 3QUSA 4QL3A 3QG1A 5DI9A 3T5GA 4NYMR 3IHWA 5DI3B 4NCIA 1D6JA 4D0GA 2RGDA 4QNMA 2CL6X 1TPZA 4M9ZA 4ZCMA 2JJ2A 1W4AA 3MWLA 3CF6R 4DDUA 4OK6A 1GL7A 3ZD7A 1QRAA 4DIDA 2J41A 5BWMA 4IOMA 4EFLA 4Q00A 1W0JA 3AV0B 3FMOB 2ZRLA 4GZLA 1AQYA 2FFAA 2R8RA 4YMUA 3WMFA 3KJEA 2YV5A 4BLQA 1P9NA 1E4YA 3MJRA 1DE0A 1L8QA 3I62A 1EGAA 3OEHA 3U44A 2VHUA 5FL3A 3BH6A 4KSCA 2EYUA 2O0KA 4M0LA 1KJYA 3SQWA 1XU4A 3NTUA 4AIIA 3U44B 3ZD6A 1ZRHA 4ZO4A 1NVVQ 1OIVA 2CMKA 5H68A 5JHHB 2PEYA 1AGRA 5B58C 1V5WA 2GZHA 1XTQA 1YZUA 1NKSA 1UBFA 4RJLA 4Q9IA 4PPFA 2QORA 4URXR 3KQUA 1MKYA 2WJVA 2FSFA 2NPFA 2EU8A 3U4QB 3I8SA 1E94E 2BHRA 3OHMA 3AH8A 1FZQA 1U0LA 4RKFA 2GXUA 3CX7A 2GESA 5FBQB 1N3BA 3QF4A 1H8ED 2JASA 4HLUA 3LWNA 4B6EA 4MQBA 2AWOA 1FP7A 2DFKB 2O5VA 1HQCA 3QKTA 4WAUA 4MGZR 3RS7A 4BQSA 1KNXA 2HYIC 2KSQA 2ZRHA 1E0KA 1XJ0A 2GKSA 3X1ZA 2I1VB 2FG5A 1SXJB 3T34A 5J4VA 1KK0A 1UBEA 2AL7A 3AUXA 1MABA 4G0NA 2J1LA 2OAP1 5EE3A 3TVTA 2JJ1A 2YWHA 3I73A 2QY9A 2QAGC 4EIWA 1N6PA 3HPRA 3BAFA 2FGKA 4F7WA 3LD9A 2VP4A 4JLKA 4OI2A 1U8ZA 5TB5A 4C0HA 3RC8A 3VKGA 4FN5A 4NYJR 221PA 2XEXA 3F5FA 4KLZA 1I4TD 2AK3A 2I3BA 3T06B 2KB0A 3THWA 1KK3A 2GAAA 1EK0A 3I5YA 2A7QA 2GEUA 4MUAA 3W6OA 4F92B 1TX4B 1TQ2A 2WSSD 2UZIR 2B8WA 3CWZA 4XTRA 3WMEA 2V54A 2ORVA 3ADBA 1Z6XA 3G82C 4TL6A 2IYLD 1UKYA 4OQMA 3L0OA 4KI0A 1QHNA 4EUNA 4CEHB 2ZUDA 1ZIPA 1RYHA 1X6VA 1CR2A 1NP6A 3K0EA 4IKEA 3T1VA 1EFTA 1SXJA 5AJVB 4HLDA 3TIFA 3X2SA 1Q20A 2C04A 3A4LA 3HDTA 4O2LA 3B1YA 3RS2A 5TY0A 1G8YA 3K0CA 2ZSDA 5FTLA 2C5LA 3GEHA 2CCJA 2BMJA 4R7ZA 3FYHA 4XTCS 2IWHA 4OBEA 5JZVA 2MSDB 2WV9A 4WA7A 2WOOA 1R10A 5JSZA 1ZNYA 1E2MA 4BGDA 2QTHA 4TSFD 1XX6A 3EX7C 5FTNA 3CRMA 4PC1A 1KAGA 2F1RA 4LK2A 3VFDA 2F1IA 4C9BA 3U6BA 1A4RA 1GRNA 2PBRA 4FI3C 1FQJA 4RKEA 1Q0UA 5D3QA 3DVLA 4A0HA 1E1QD 2AFIE 1X1RA 5D3MA 1GG2A 4OKSA 3A1VA 2ZR7A 2OZEA 4QBIA 4JLAA 3WYGA 2C2HA 5C4GB 5BW8A 4Y0VA 4TYYA 3RNLA 2G88A 2VHTA 5GJBA 1M2OB 4PFSA 2H57A 2QP9X 3E70C 5FBRB 1ZD9A 4K8OA 4R98A 1II8A 2FPLA 2CVFA 2WJGA 1G5RA 4M22A 3K9NA 1TF5A 2FEMA 3DOEA 3VR4A 4L9WA 1W0JD 1E2JA 1IOZA 3B82A 2XSZA 4PPQA 5TXGA 3O8DA 1HH4A 3QKUA 3DEFA 2W2TA 3ZQJA 4LJ5A 2BM1A 4KAXA 1XPUA 1F2TB 1S3GA 2ZE5A 5FFMA 4LY6A 1F2TA 2GF0A 1LF5A 2FA9A 2ZRCA 4GRAA 1BO6A 4QOSA 4OHYA 3AP2A 1S1MA 1FP6A 2O8BA 1DVRA 2FSIA 3OE7D 3VR6A 4JLBA 1G5TA 5CITA 2WAXA 5AUOB 1NVWQ 1F2UA 1CKEA 3LBIA 1LS1A 1E9DA 2QMUA 4AKGA 4XSHA 4HB3A 4GP7A 2C03A 1A1VA 2W6JA 4AKEA 1XEXB 4G5SA 5E95A 5J40A 5EP3A 5JHGB 4DB4A 1G20E 3IQWA 2IBMA 3BFVA 3Q9LA 2FOLA 4IXMA 2RH5A 3TUIC 3DMDA 4P31A 3B1XA 3AVPA 1W4RA 3ZZTA 3QXXA 1G6HA 2FDCA 1P73A 1G3MA 3BOSA 5KPDA 1OB5A 4TYWA 1GSIA 2ODBA 1CJKC 1TF2A 1HEIA 1AK2A 3WP0A 1X8KA 1LV7A 1DOAA 4GOXA 2O8CA 3DO6A 2FGJA 4V03A 3CBQA 5K8TA 4XSGA 3W5JA 1XCGB 4C2TA 2XB2A 4LPSA 4NZYA 2UKDA 3H0KA 4YDHB 1W4CA 1Z5ZA 3CF0A 4OL0A 4C3ZA 1JNYA 1WDTA 3Q7QA 3K70D 5EUMA 4ZDIA 2IHBA 2FSHA 5HE8A 2JJ8A 2MSCB 4DLWA 4R9UC 1XJCA 3SJZA 1SXJC 4B2PA 3THXB 2FZ4A 4TLBA 2R65A 4B35A 2WWIA 4LYFA 4AYWA 1M1YE 2HXSA 3O8BA 1XCPA 5AK0A 4DUGA 3U60B 3THXA 1YHNA 4OQLA 5HKKD 4QGAA 5C46F 1Z6TA 1M7BA 1PV4A 3OAAD 2IF2A 4JLJA 1NN1A 3CW2A 1R0XA 5KNDA 1FW6A 1C9KA 4LI0A 1A82A 1N0UA 2GDJA 2IUTA 4EQ6A 1Z22A 4JSTA 2Z4RA 5FPHA 4LHXA 4A6XA 4POAA 2Z6VA 1NMZA 1CIPA 2OFXA 3I72A 1DARA 3NBZC 2ZETA 3RWOA 1T4GA 3RS0A 1U94A 4GDFA 1M7HA 3OIVA 1N6KA 2ZSEA 1OFIA 3KQNA 3K9GA 5FBLB 4BRWA 4CDGA 3AVVA 2VHQA 1E2HA 1WE2A 3RDPA 3DHWC 3DKVA 5AJZA 3A6PC 4HDOB 4LYHA 3BERA 1JJVA 2VL7A 2V6IA 4URUR 3GLFE 3GJ3A 4DEYA 1NIJA 1ETUA 2WJYA 4PSKA 1JALA 3SS8A 4JLPA 1G4UR 2OXCA 1KO4A 2RGNC 2KWIA 3W8NA 1KI6A 2OBLA 1NLFA 2QAJA 1WA5A 2YYZA 1NVXQ 3D31A 3K1JA 1AIPA 2QRNA 2GCPA 2OHFA 3MMPA 4Z8XA 5KDLA 2PCLA 2WWYA 1D8TA 1G7SA 2H1LA 2B7BA 3TSWA 3I3SR 2X8AA 2ZS7A 2OG2A 3GLHB 3BK7A 2DFTA 3HU3A 3NIBA 1J99A 4TMZA 3IBYA 4DDWA 3CWQA 3P4YA 2LKDA 3DDCA 4MGIR 4TT3D 3LX5A 1Q12A 5J4YA 4A6PA 1XD2B 2ZXUA 3W34A 1H8HA 2FMXA 5FBWB 5GVSA 3CPJB 3L0SA 1VG9B 3OESA 3VU9A 1TAGA 4GOKA 1XMSA 3U3OA 1MO5A 3EZ7A 2GJKA 1XTJA 2CNWA 4ON9A 4L5BA 3DL0A 2AWNA 3MJHA 4UNPA 5EE1A 5IDVA 1FNNA 1R7RA 3CZQA 1ZM9A 2JLZA 1W44A 5AJXA 2CJWB 4Q9KA 1I2MA 4E03A 4PX9A 3K09A 5FL7A 4N1AA 4ESVA 3UMFA 1ZM3A 4MDEA 1T6NA 5BQ5A 3T15A 721PA 2ZR0A 2ZUCA 4I1SA 4KO8A 3LA6A 3L0IB 5K8LA 5EXPA 2RGNA 3AVWA 4KFRA 3GLFB 2QGZA 5GVRA 2CHQA 1II0A 1G3UA 4FIDA 2OBMA 4TWZA 3RRYA 1LNZA 2PZGA 2OCAA 3A36A 2G0NA 3ZS9A 1QZXA 4JJKA 1T3LA 4JL6A 3VKHA 5ANRB 1KMHA 1P75A 5DO9A 3BWDD 3L8ZA 3CKLA 3ICEA 4YMSA 4DLXA 1TMKA 4Q9LA 4Q4JA 1PZNA 1W0KD 1H8HD 3FGNA 4LV8B 2OO7A 5JMTA 1ZD1A 4KV9A 5EUQB 1J8MF 3MLEA 2VQSA 4TLDA 2EW1A 3FWYA 1JECA 4NTZA 5EZ6B 4DKXA 1O3YA 2QZ4A 2NO1A 1CR1A 3X1WA 4UXIA 1N5JA 2QENA 3P32A 2BBSA 2IL1A 4BUJA 3TK1A 1KOFA 1UKZA 3C8UA 5FI1B 3QY0A 4IHQA 1LFDB 2YOHA 4QJ3A 3Q5EA 3LQQA 1KY2A 3K0AA 1JBKA 3P1JA 1GKYA 2WZQA 4G1UC 2D74A 4P4SB 3GJ8A 1MO6A 4FXPA 3AEZA 4JBXA 4L16A 3ZVMA 2C95A 4IDHA 2FPKA 2ZJZA 5FPKA 1MT0A 3CM0A 3SJAA 2OAQ1 3ASYA 2JLUA 3BGWA 3SEAA 4BFSA 1L7VC 1YZTA 4J0QA 4M1SA 3THOA 4MDFA 3C4JA 2HYDA 4NP6A 3QPWA 2CEAA 2J7PD 1Y3AA 3B1WA 1CULC 4A36A 4CT5A 2XZLA 1MV5A 3JVVA 4UXHA 3J81k 2LKCA 4L4UA 3RS5A 3TR5A 1COWD 1RPZA 4CEJB 2IS4A 3V00A 2QEQA 5DE3A 2NGRA 3JVUA 2ZS9A 4HLQB 4IDOA 1FUKA 1VMAA 5E7MA 1JR6A 2XX3A 4JS0A 4JT4A 5HTKA 4BLRA 4BZXA 3CONA 3L8YA 2QUZA 4KBFA 4E09A 5IT5A 3GLGA 3T5DA 2IX3A 2D2FA 1ANKA 1KK2A 2DB3A 1E69A 3LW8A 1XEFA 4HYYA 1R8SA 1Z8FA 1OJLA 1VYUA 2ZRFA 1YR8A 3P26A 4UQOA 4IDQA 2DYKA 1ZP6A 4BFVA 1IY0A 4DB2A 2QAGA 4ACBA 1NBMD 5BN5A 1CR4A 3QNUA 3O47A 2IYXA 3TKLA 5TVKA 3SI7A 1XMVA 1S9DA 4WBSA 4PZZA 2FSGA 1T5LA 2B6HA 4HZUA 4JLOA 5FL7D 4HB0A 8OHMA 1QHYA 3PIRA 2PL3A 1EXMA 4MA4A 2ZTSA 4P0TA 1WBDA 4ZDWA 4CEJA 5FOSA 1QDEA 2ZYTX 5HZKA 1KI9A 2XXAA 4KLNA 1KYIA 3LNCA 2WMNB 2CLSA 1YRBA 1ZVQA 2P0EA 3QENA 2ZJ8A 3A1UA 1S1CA 4I4LA 5J4LA 3K53A 4YMVA 4PC6A 1YE8A 2ZE7A 2JA1A 5FI0B 2B92A 1SHKA 3CRQA 2FFHA 5H8WA 4EPXA 5LB4A 4D2IA 1S4QA 2ZIAA 1UBGA 1QG2A 4FD2A 4R2IA 1OXVA 3QXSA 4IVQA 5AUNB 4MRSA 2NTYC 4BRUA 3Q7PA 4ZI2A 3IKJA 1A5TA 1VYTA 3W3AA 621PA 5JLJA 1J8YF 3K0FA 4PO8A 2PLFA 2A5DA 3KXIA 1AGPA 3CRVA 4I81A 2VP0A 4Q5IA 2O0HA 1V43A 2JDID 1WB9A 1A2BA 2G6BA 2O8EA 3Q85A 3EPKA 4A8JC 1FTSA 1E1QA 1HQYE 2ZJ2A 4X8LA 1MR3F 5FPTA 3W5IA 4B33A 1Q1BA 4B3BA 3UMRA 4DXAA 1KSFX 4B71A 3PUYA 2WJJA 1OIWA 5J4HA 2NQ2C 4PHHA 2CL7X 2RHDA 3TQCA 2FE4A 1NNEA 3UWOA 4RD3A 4A9AA 3AVOA 4AD8A 2EVWX 2O52A 3QEJA 4LJ9A 4BLOA 4C0BA 4DCSA 3A4MA 1EG7A 2CBZA 5E7IA 3RWMB 1N6IA 1U9IA 4JMPA 4ZCIA 2IA5A 3KKNA 1MABB 1ONBA 3IBGA 2G9NA 1MO3A 4MUBA 1OH8A 2OE2A 5TDHA 2BIFA 1G41A 3M6AA 4RZ3A 4NYJQ 1S2MA 1JPNA 3T12A 4LJ8A 3WNBA 3LFUA 4G5GA 3D8BA 4Q4HA 4EQ6B 1EFCA 1E2QA 1IONA 1SVIA 4OQFA 5FPSA 2WKPA 4TZ6A 2F43B 5TARA 1JB1A 3ND9A 4HUQA 3HR7A 1GTVA 2WPDA 1G4AE 2VSOA 1K5DA 2QT1A 2HJVA 4IFBA 4EPRA 4PZYA 1SKYE 2PT5A 5L3QB 5JJLA 3Q5DA 2ZRIA 1L2TA 2ZYUX 4E07A 2ORIA 2FN4A 4NCKA 4R2HA 4D81A 3SR0A 3LAWA 1PLLA 4BECA 3KTAB 3PG5A 3JZAA 4RZUA 1W7AA 1C4OA 1I4LD 2J87A 2ANBA 4DBLC 4F4CA 1E0JA 1SQ5A 2ZQ5A 1SVOA 1U99A 1XMJA 3B6EA 1XTSA 3QPVA 1RW4A 3K0AB 1COWA 1U8YA 2DHRA 3MCAA 5HCNA 2DR3A 1U8AA 1BYUA 1UADA 3OIWA 2HXYA 2FH5B 4QJ5A 3QE0A 3HPQA 1FNMA 5F98A 3WNDA 1NMYA 4Q7MB 1X1SA 2A9KA 3PV0A 4M1WA 2EYQA 3HU1A 1W48A 4N0EA 4A0GA 2YWFA 3ASZA 1CRQA 1Z6YA 5JSZB 4IRUB 4OHVA 3TUJC 2RCNA 3R9WA 2EFHB 2GK7A 1X3SA 1VYVA 3BS4A 4IXNA 4A2WA 4RCYA 2GCOA 1LB1B 5DYGA 1R6BX 4NBSA 4Q4JB 3CO5A 3EWAA 3ZDQA 2VRWA 1ZNXA 1WCV1 4M1TA 1D9ZA 2JGNA 4RZXA 3SNHA 2Q6TA 5KSYA 3QKSA 1JJ7A 4FCTA 4M9SA 1W47A 1E79D 4DHEA 4UXJA 1JQJC 1P6XA 4B3XA 2V1XA 2GTPA 2R6FA 4WVFA 5EQTA 3UKDA 3PITA 2C78A 5HZHA 1GAJA 1OFTA 2G1JA 5LB2A 2AXPA 3V4RA 3AVUA 4H1VA 4NL4H 4ZKEA 3NBYC 1VDZA 1G8HA 4DCNA 1ZMXA 1CP2A 3P20A 2VP5A 1YR6A 2NG1A 2R2AA 4KODA 2GVDC 2B7CA 1ESNA 1QHGA 3GLFA 1E4VA 1AM4D 5KDDA 4IW3B 1NI3A 3B13B 2ZAOA 3KKOA 3NBFA 4URVR 4Q1DA 4MKFA 2ZE6A 3B60A 2VP9A 3VAAA 2G0TA 2IXEA 1QF9A 3QKRA 1VG8A 4MRNA 1G3RA 4LYJA 4PTLA 4DSNA 4M4SA 2GCOB 3KB1A 4GL2A 4C30A 3L43A 2F3TA 2A5JA 4QJ4A 1TUIA 2BEJA 2PLRA 2Z43A 4PO1A 2Q0HA 1ZUIA 3GLIB 4X8OA 3C41J 1DAGA 4FMCF 4S2EA 2ONJA 1NVVR 4A0FA 4BFWA 4L8GA 3UWKA 1KI7A 2XOKA 3KKPA 2QU8A 3TRFA 4BLSA 1H65A 5CDFE 3KDSE 3C5CA 1KDPA 3BH7A 1IN6A 1WP9A 3UMSA 4DCTA 3THYB 1JQLB 2ZITA 4NE2A 2P6UA 2H16A 4M9QA 2RGXA 3OF5A 3TGPA 1XEXA 2Q3MA 1SGWA 5E7JA 1Z6GA 1XBTA 1OF1A 2BBOA 3OFND 2HF9A 4GZMA 1T0JB 1XXHB 3VR1A 1Q57A 1U81A 2FFBA 2IEYA 1R5BA 2REBA 1FPMA 5DLQC 3D6TB 4EPVA 4CIDA 1T0HB 3E5HA 4WOPA 2JLWA 2F9LA 1S8FA 1T3SA 2QAGB 2RGAA 3GPLA 1G5PA 2EFDB 2PMDA 4DEXA 4HZUB 1E3MA 1DBSA 1KIMA 2AD5A 1FQKA 1IJFA 1E2KA 6Q21A 5JFGA 4LHVA 2O8CB 1OKKD 3MFYA 1E2EA 1TU4A 3KJGA 1HV8A 2W6IA 2GBLA 3AKCA 3F8TA 3MG9A 1YZGA 3SN6A 4XWKA 3W6PA 3JZMA 2JLSA 4BZPA 3PFIA 1UEIA 3TE6A 2ODNA 3HJNA 3IIMA 2G83A 1W36C 2Z0MA 4AYXA 2ZSAA 4XIGS 1CBUA 1HUQA 3U3KA 4KJZA 1KSJA 3EPLA 2BOVA 1E9RA 4M9XA 5DGXA 2QM7A 4Y0AA 2OCBA 4NCHA 2FNAA 1VCNA 2V8OA 4WXRA 1AJEA 3PEYA 3Q8XB 3CNNA 2VHCA 4G5QA 2ATVA 1XF9A 5BYJA 1G16A 4ZIRB 4O3MA 3U7HB 1PJRA 1OH6A 1ZC4A 2BC9A 3CLVA 3EIEA 4Q4HB 2BWJA 2J46A 2QROA 3FVQA 3U7GA 1CR0A 1YZKA 3H1TA 1KI1A 4DLUA 5JJIA 4NYIQ 3AVXA 5J5CA 1Z63A 3EZ6A 1KK1A 2QQ0A 4B3CA 2GJ9A 1AZSC 3MUFA 4F4JA 5CK4A 3GD7A 3KUCA 1ZW6A 2BM0A 2W83A 3ZYCA 2KI5A 2W6JD 4TL8A 4UNNA 2J7KA 1UPTA 3M0EA 4QGFA 1ZNWA 2PEZA 4U7DA 2ZRBA 5FBVB 4QXAA 4P4UA 4RD6A 2ZJAA 521PA 4TQUS 2GHIA 4QBHA 5CB6A 2JIZD 1OIXA 4JYCA 4Q1EA 4GMDA 1RJ9A 4YLGA 2GEVA 2NZ8A 3TSZA 1AS2A 2GF9A 3QSYA 2O0JA 2FF7A 2IYQA 1NKTA 2WMOB 4PC3A 4DDTA 2W0MA 2JCSA 1RVDA 2ZI5A 4JLNA 3C16C 4LJ7A 5FOTA 3C5HA 2ZYVX 3D3QA 1P2SA 4XWOA 1FX0A 2IXFA 3K0SA 3RYTC 3PCRB 3NDBB 1P9RA 4AG6A 1GIAA 3IO3A 5F9HA 3ADDA 4C2UA 4Z1MA 5FR1A 3CH4B 1YZLA 1JAHA 3LVRE 5EE0A 1G18A 1ELOA 1NMXA 1IN8A 3AVQA 1NJFA 2KE5A 4LC0A 4PAOA 4PPNA 3BFKA 2Z4SA 3PJRA 1N6HA 4ZDJA 3THWB 4TMXA 1YJ5A 4QRHA 5A4JA 2Q3HA 3HWSA 5FTKA 1E2IA 5CLLA 1E6CA 4Q66C 1G17A 3CH5A 1KSGA 4TMWA 2GJAA 2OM2A 3PEUA 3SJCA 2OUKA 1KJZA 3SDZA 3EZFA 1OHHA 4IOKA 2D06A 4NDZA 3AF2A 1TNDA 4II7A 2J0UB 3RHFA 4QM7A 1XMIA 3K09C 5DN6D 2ATXA 5FTMA 2WHXA 3AM1A 1NY6A 2PJRA 5HE9A 2QA5A 3HU2A 4W7SA 2BCGY 1JPJA 4EAQA 1K6MA 3U7EB 4V0KA 3RAPR 2IHYA 3KQLA 1OPXA 1DS6A 4EDHA 1D5CA 4D82A 2ZRJA 4PQFA 3PR1A 1Q22A 2ODEA 2RB4A 3ZVNA 2QE7D 4B75A 2W0SA 1XP8A 1XZQA 3CRRA 1MH1A 3VKWA 3U7FB 4D6PA 4LWZA 4GBMA 1EFUA 2JLYA 4JYBA 2HJGA 4DT1A 2A78A 5EXTA 1HE1C 3OFNA 5IK2D 5CM8B 2X2FA 1P2VA 2E1RA 4Q02A 3P27A 3BE4A 1HTWA 1DO2A 4C0KA 1QHHA 2RGGA 2IUSA 2OT3B 3CPHA 4D4MA 1DTSA 4JBWA 5SZHB 2WJHA 4QM6A 1OXTA 3BXZA 3FMFA 4B2LA 2VHJA 3B1ZA 1E9CA 4FINA 5C2JB 4G3XA 5KDOA 3EZ9A 2VO1A 4B44A 2RGEA 2Q9AA 3NHAA 5B30A 1HT1E 3I92A 4A2PA 3T1OA 4CEHA 1NJGA 2QSYA 3C14C 3SHFA 2IW3A 3EZ2A 3UPUA 1VHTA 5G3YA 1DAIA 1KKLA 3BJIC 1U0JA 2AHOA 2ZI3A 5L3RA 1GUAA 4V0ME 2XJ4A 2CNWD 4C0QC 3LQRA 1I2DA 2OEPA 4DSOA 4KHZA 2NZJA 3QEOA 3KFXA 3O8CA 4PC7A 2OFWA 3N2EA 4S35A 3S1AB 3GJ5A 2W00A 3EAQA 3QVVA 4YDSA 2F1JA 3I32A 2JAQA 1Z0FA 4KFUA 5EXXA 2VEDA 4FWTA 3K70B 3DM5A 1ODFA 1GOTA 2ZSBA 4ARZA 3IIJA 3TVDA 2ZM5A 3SE0A 2VH5R 1ZD8A 5BYKA 4PSVA 4BFTA 1CRPA 3LXXA 2O8FB 3KZ1E 1GL9B 2GILA 2JJ2D 3DPUA 3GFOA 1CLUA 2ZRNA 4E5UA 2V7QD 2ZS8A 4F93B 2FWRA 3QBVA 2WTUA 3EIHA 2ERYA 4LX0A 2HEIA 3QJYA 3WRYC 3K0CC 4XWAA 3NBXX 1ZBDA 1GFIA 4URWR 1N6NA 1Z6AA 3RLFA 2AX4A 4LYAA 1AS0A 2F7SA 1ZNZA 4TYPA 2KJQA 1OYWA 3GJXC 3TBKA 5GJWC 2W2VA 4WZ6A 2ZRAA 1GL6A 1OH5A 3U4QA 3TUZC 2D7DA 5KUTA 4D4LA 3EXAA 1OHHD 4RZ2A 2OXRA 4LJAA 2RHMA 2KBEA 2Z5FA 3AKEA 4NH0A 1Q1QA 3MRSA 2PJZA 4M1MA 3MAAC 2ZU6A 4A1FA 3G5UA 1ZUHA 3UXMA 4RFSB 1G3QA 4Z51A 2YC4C 1G8PA 5CK5A 1GRQA 2EWWA 1LY1A 3NHBA 4D4JA 2V7QA 3IDQA 4OHZA 4XVUA 3LY5A 3N70A 4M8NE 4ASUA 1E0SA 1W49A 4YC7A 4HLCA 4TQAA 1KMQA 3M4YA 2QMEA 1P2UA 1HA3A 2ZJBA 5DYIA 4QBGB 1DAHA 2D2EA 1AN0A 1K8RA 3SJBA 1RFLA 1P72A 4HZIA 2WWHA 3IPXA 2WSMA 1GNRA 4Q7KA 4IDPA 4Q18A 3K0FB 5JBQA 2N1BA 5CM9C 4ZCLA 2DBYA 4YMWA 2DWQA 4AKIA 2IYSA 5JCPA 2F43A 4B73A 1XD2A 3K70C 3X1DA 1CJVC 1L4YA 4WIAA 2D4HA 1P3JA 4UNRA 2MSEB 3VR5A 2QT0A 1M8PA 1XRJA 1XXHE 2AK2A 2HV8A 3AGQA 3FDIA 5JEDA 1QHXA 4JLDA 3GJ7A 4DLRA 3W6NA 4FMDB 3A37A 2C98A 2C9YA 4D0LB 1JEEA 1Q1ZA 3NC1C 5G41A 4TN1A 1O87A 1GP2A 3FFAA 3D7MA 1XEWY 3ADCA 5DNYB 4UKDA 4TMKA 1BOFA 3QOFA 2XOKD 1YRAA 3AP1A 5FUVA 3KB2A 4IVPA 4JL5A 4MGYR 1FUUA 3X1XA 3HR8A 2GXAA 4X8HA 3CX8A 4W5HA 4LBYA 2JLRA 2QNRA 4OK3A 4XVQA 5KPJA 4LJ6A 2ZUBA 3RSOA 4CW7A 1AKEA 2P2LA 3MWYW 4TTQA 2X77A 2X1VA 3TW4A 5LPNA 1HY3A 1G8FA 2WICA 1P5ZB 2XTNA 4DT1B 3I5XA 3T35A 3BORA 1XD9A 1K5GA 2BKEA 4DLTA 5L8VA 2H17A 5JWOA 4ERNA 2QGNA 2DFLA 5L3QA 5FTJA 4LV5B 3ZZ0A 3H86A 1G3IA 1HE8B 1KNQA 1EWRA 2GZAA 2W2XA 2ZRPA 2RKOA 2YOFA 1P60A 2PT7A 3WYFA 4FW9A 3OEEA 2D3WA 2CDNA 3F0TA 3IUYA 3L0PA 5KNCA 3V4FA 1SVLA 3A4NA 3HYTA 1KO1A 4AK9A 4EPTA 2ZE8A 3IPYA 1ZM4A 2FEOA 1NBME 3R7WB 3U6KA 2CCKA 4WZBE 1G1MA 4RD1A 4D80A 1UDWA 2BEKA 3FTQA 1TF7A 4HAYA 1DAEA 1M7GA 2WIAA 2F6RA 3MSXA 2ASEA 1M34E 2GJSA 4HB2A 1IM2A 1KY3A 2XJ9A 5JWRA 1W36D 1E2FA 2ZI6A 2ZRMA 4LOAA 4RD0A 1RIFA 4DWJA 3WBJA 1EFRD 4AG5A 4B43A 4OHXA 2H18A 4FCVA 3H4MA 4ABYA 5IF9A 1VKJA 5A5GA 4Q48A 3QKSB 3IO5A 4NKRA 2IWRA 1AQUA 1U9IC 2CHVA 2OFOA 1JXOA 4FMBB 1NSTA 1LS6A 1FMLA 2WJIA 2ZEJA 1AS3A 2ZYWX 1NF3A 2BV3A 2YWGA 2A2ZA 4LRWA 4E22A 3QQ5A 3ZIAD 1UM8A 4PAMA 1D2NA 2NO7A 1G7CA 4Q19A 3WHLA 5DIFA 4YQFA 4ZDKA 3VR3A 3WBKA 4D0NA 1BMFD 2H7VA 5DHFA 4AY2A 3WRXC 4OK5A 4CZ2A 4TL7A 2J3EA 4OQXA 5P21A 2ORWA 2VYFA 1F60A 1ZYUA 4GPTA 4TL9A 3B5JA 1RE0A 1R5OA 1EESA 4N0DA 2GVZC 3H2YA 4F4IA 3ZIAA 1OXSC 1X8LA 2OCYC 4O2RA 2IS1A 3KJHA 2KBFA 4Z8YA 4DLSA 3RABA 1Z28A 1BIFA 1IY2A 2FPMA 2GBLC 4B32A 3RANA 1U0HC 3VMFA 4RVCA 1GVNB 4Q1AA 4PXAA 5EXSA 3L2OB 1W2GA 4DIEA 4Q7LA 3FPAA 2CLCX 2JATA 4OYHA 4JZKA 3U2QA 2HLDD 4BPBA 1OE0A 4US0R 3RRZA 1ZC3A 1IXZA 1ZU4A 5M04A 4WXPA 5FOUA 3VNUA 2DPXA 2F1HA 5B57C 4XD7D 3EASA 4GSYA 3RRMA 4HLUC 1UF9A 3W8RA 4PHTA 3R9IA 1EX7A 2XNSA 4U02A 3SC3A 4GOJA 4ASUD 4BLPA 4EKDA 5BN3A 5IRCD 4BLTA 1SKYB 2AKAB 4C7OA 3WP1B 4KVGA 2QPAA 4CEIB 1KJWA 1MO4A 3I8XA 2Q21A 4P3YA 1QVAA 4G5OA 3SYLA 1NN0A 2A5YB 4B47A 1R5NA 1J70A 4TZ0A 1T5IA 3FMPB 5IHPA 4K46A 3QKRB 5CLQA 2FU5C 1N2CE 1SVMA 1T91A 3AF0A 1TADA 1OLOA 3EC2A 1TL7C 3LH5A 3SBDA 1NVUQ 5L3VA 2NO6A 4PPGA 1II9A 4HDCA 1N6RA 1KGDA 3LW7A 1IJEA 4ZPXA 5K8UA 3U5ZB 3GJ0A 5BXQC 2BDTA 2XITA 1DELA 4N3NA 4CF7A 4NONA 4Q4AB 1ZINA 2HLDA 4I1OA 4QFMA 5DN6A 4K81B 1EX6A 1F2UB 1SVWA 3GCGA 1E9SA 4BASA 3O8RA 3BIFA 3A1SA 3GQBA 3FHOA 3GMTA 3QG5A 4JJZA 3B9PA 3F3YA 4W5JA 4OQNA 1U90A 2ZRKA 2IYRA 4D26A 3GLGE 4IDNA 4C4PA 1US8A 1G19A 4CT4B 5FOVA 3AVYA 1OXUA 2RAPA 3KXKA 4A92A 1G9XA 2IYYA 3NKVA 2AD1A 5DISB 2XNDA 3GJ4A 2QMHA 3R8FA 3DZ8A 1Z07A 5JI3E 1DAKA 4JVMA 5B64A 2YZ2A 1QHIA 2ZJOA 1Z83A 4IEIA 4Q9JA 1E98A 4HAXA 5CDFA 2P6RA 4GT1A 4V0NA 1RYFA 1E1RA 4KBGA 2OLJA 3HP1A 1PUJA 1IN5A 5E4FA 1OB2A 4O0MA 1G7RA 4RCZA 2JLVA 2BMFA 3ONWA 3FKSA 1S9HA 3QF4B 5AUQA 4JIMA 2D7CA 4NPHA 4CYMA 3OE7A 2H5EA 1PVOA 2XAUA 2ZSFA 2RMKA 3T1QA 5AUPB 2F55A 2B8TA 5FUYA 1QVRA 1J90A 1Q3HA 4URZR 2GAOA 2YWEA 4NYMQ 1RRCA 3B7GA 3ADKA 1JXMA 4LDJA 1VIAA 3GEEA 4KSBA 3R7WA 1OT3A 2E9SA 5JI2E 2N42A 1L4UA 3KKMA 3SOPA 2ZRGA 4I1VA 1ZAKA 2IS2A 2BBWA 4UNSA 1TQDA 2YJTD 5EP4A 2DFNA 4KXFB 1N0WA 3BFXA 3KJIA 4HEJA 3QF7A 2VF7A 3FOZA 4DLYA 2O8EB 1OXXK 2GA8A 4PC2A 4KITB 4KYIB 1UKVY 2BCJQ 3OAAA 4GP6A 4OI4A 4XJXA 5SZKB 3CRW1 3LVQE 5TMPA 1E79A 2VIIA 3MD0A 2NOAA 3ZVRA 4GI7A 4ACAA 1P4SA 5F3WB 3LV8A 2WSSA 4RD2A 5CB8A 4UJ5A 1OH7A 2ZJYA 1W46A 4MGKR 2P67A 1IXSB 2EQBA 2NIPA 3ZZUA 4NCJA 4QBFA 3SFZA 4DCUA 1XPRA 1Q1EA 2QM8A 1ZCBA 1FX0B 1X86B 1ZJ6A 3GP8A 3U61B 2C9OA 2OBNA 4L9SA 1DG1G 1Q3TA 3BB4A 3CF2A 3BB3A 4ZKDA 1KO8A 3GLHA 4PANA 4DUGD 1B23P 3NG1A 2AKYA 4V0MA 2CK3A 4R71A 3CNOA 3C15C 1KI8A 2NPIA 3PUXA 2JIZA 1IN4A 1P7CA 3QXCA 3B2EA 5LD2C 3CX6A 3FB4A 1QHSA 3MWJA 3FHTA 4H9GA 2ZJ5A 5JS8A 4WZAE 4BFYA 5CYPA 4OI1A 1Z47A 4MH0R 4W9MC 1T8TA 2UVQA 2G3YA 1YZNA 1XNJA 1XCMA 3WHKA 1A2KC 3AF3A 4I99A 4OJQA 4LCBA 4HUTA 5HPYB 2OLKA 2VPPA 5IK2A 3TSOA 3IEVA 2X19A 5JRZA 2ZRDA 4NHOA 2ERXA 5CIQA 2REXB 1WXQA 1SVSA 1UFQA 3G0HA 2PH1A 3OIYA 3TW8B 2FFQA 4PHFA 4BFZA 3ZQ6A 4CGZA 2PMKA 1SXJD 4C0SA 3W9YA 1Z06A 5AJYA 2E87A 3CIOA 2YVUA 2ZROA 1JI0A 2JDIA 3PUWA 4LJ4A 3SQXA 2EFGA 2BKUA 2ZREA 1KO5A 2R6CA 5AJWA 3CR7A 1CXZA 1NG9A 1N6OA 4B34A 4EPWA 5TV2A 5LBIA 3OEHD 1G8GA 2IC5A 4RD4A 4Q7JB 3WXMA 1GRRA 2I4IA 1W5SA 5H70A 3GLHE 2P5TB 5LDDC 1IBRA 4GMXA 1JR3A 1WBBA 3U3RA 4KFTA 2Z83A 4MRVA 4PZLA 4BEBA 2V55B 5D3MB 5F9FA 1NLYA 4NYIR 2OILA 4B76A 1NG1A 2AR7A 3NC0C 4LUCA 3PQCA 4MKGA 1TEVA 2QE7A 1MRNA 2YC2C 3HYRA 4KFSA 2HT1A 4NU0A 1QG4A 1ZIOA 5H1YA 4TLEA 4EJSB 3C7KA 4HAWA 3RS4A 1PLKA 1LVGA 2ZAMA 4MKHA 1JR3D 1BKDR 1E2NA 1TQ6A 4PHGA 4Q1FA 1KTVA 5KYKA 4RSGA 5EZ5A 2QP4A 3H84A 1CEEA 5HR5A 4CEIA 1E2DA 2REOA 3A1WA 5ELXA 3IIKA 3K9HA 3QIAA 1E9FA 2A5GA 2IF0A 2IXGA 1IY1A 1NSFA 5L3SB 1KI3A 3EWSA 3FHCB 2UZ3A 5G40A 3KKQA 4HAVA 3RSLA 3IEUA 5G3ZA 2JJ1D 5UKDA 2HF8A 4TTRA 1DAFA 5K8IA 1ZU5A 3QI2A 4ARZB 4KCGA 1E1RD 4DSTA 1HYQA 1YU9A 2QPOA 4YMTA 1NIPA 1S0UA 4HAUA 3AKDA 3GFPA 5FUWA 1RRPA 3EW9A 2OCPA 4LSGA 3LBNA 4C0JA 4MITA 4IFEA 5AR1A 3X1YA 4URYR 3CPEA 4A82A 2C9CA 2JEOA 1GKUB 1LW7A 1PUIA 1MRSA 2D62A 3FE2A 1SKQA 1VTKA 2W6ID 2P65A 4TLAA 821PA 4US2R 4M21A 1NBMA 4F38A 3UG7A 2ZI7A 2PCJA 1XTIA 3PVSA 4Q01A 4XH9B 5KSZA 1WRBA 2IK8A 2ECKA 2QRZA 3NXSA 2QMOA 3PUVA 1RKBA 4C0AC 1XDBA 4AURA 1KAOA 1G291 2QP3A 1VIYA 2ZANA 4LPKA 2HCBA 4QHTA 3VHXA 1JEDA 3K8YA 2CHGA 1UKEA 2P6NA 1IN7A 1E2GA 1E0AA 1XJQA 2P5SA 4B2IA 5CYOA 2QPTA 1E2LA 2HT6A 4A4DA 3K9LA 4OJKA 4HSEA 5JRJA 1XFAA 4RFSA 2QQEA 2AN9A 2J5XA 1TEXA 5GADl 3CUEF 3PEVA 2G77B 1F5NA 1KZGB 1X8JA 3AB3A 4FMDF 3RS3A 3EA0A 2J0SA 2R9VA 2RGBA 3LBHA 2OV2A 2Q3FA 2GWHA 4B3GA 1TU3A 4IJMA 3TR0A 1XB2A 5J4KA 4P4TA 4JVSB 1R0ZA 3UK6A 3MWKA 2VLIA 4W5WA 3EARA 4PR0A 3B85A 3QPUA 4HATA 4UJ3A 1BYIA 4DRZA 2IS6A 3R9XA 3DOFA 1XWIA 2WWFA 5A0FA 4M1YA 3VHLB 1E9BA 4HDQB 4B3DA 2WKQA 1LTQA 1CJUC 3LLMA 4QHYA 5JCZA 1S3SA 1E32A 1XEWX 2WM9B 4JLVA 2FJUA 1YR7A 4NCNA 2WKRA 2HDNB 2ZR9A 2JLXA 1UAAA 2R6AA 2O8DA 2XNDD 2IEZA 1KI2A 3KTAA 3GLIE 1FTNA 3TAUA 4FMCB 1NL3A 3EA5A 3FKQA 3NH9A 3SYNA 1SXJE 1YVDA 4P33A 5G53C 2J0UA 3IILA 3OZXA 3MGCA 4DDVA 3TAHA 3QXJA 3WMGA 3REGA 4KVAA 5EJEA 1N25A 3E1SA 1KDRA 2GCNA 3FMIA 3AF1A 1Z0DA 1Z0JA 3UIEA 1OFHA 5KTYA 4P4SA 2WVJA 4V0LA 1KSHA 1DADA 1MOZA 4MYCA 4DCVA 1GM5A 2NO0A 3W3ZB 2JLQA 1F3OA 4BFUA 2XZPA 5KOYA 3UANA 2IYUA 3LRPA 3ECCA 4TT3A 4HI0E 5KU1A 2QBYA 3B9QA 2R44A 2FV8A 4Q21A 5J47A 4G5RA 2MMCA 1N5KA 2Q9BA 3DZDA 4WW0A 4QGHA 4C0LA 2GEDA 2GETA 2CL0X 2XB4A 4D25A 1R8QA 4AI6A 3GLIA 3VU9B 4JL8A 2WIBA 4M1OA 3LLUA 1VCMA 3A58B 2HCJB 3BBPA 1NY5A 4MKIA 4GFDA 2GNOA 1CTQA 3GEIA 2P3SA 2J0QA 1NN3A 4Q1CA 5EE5B 1R4AA 3FKSD 1XTKA 4U5XA 5F2EA 4DC9A 4TYNA 3ZVLA 2XSZD 2IYWA 1W2HA 4OI0A 1CJTC 1I4DD 1N6LA 1KKMA 3BB1A 3IGFA 4B48A 1CU1A 3LO5A 1T8UA 1GITA 1R0YA 4CRWB 2K5UA 4JT2A 3LX8A 1KO7A 1T9HA 3KX2A 1M6NA 3REFA 2A5FA 2Q9CA 4FWIB 4QC2A 2ZVPX 2A30A 2VA8A 4OHWA 1W0KA 1OV4A 5HCIA 1D2EA 1E9EA 4Q1BA 1TQ4A 2VBCA 4TMTA 2QG6A 1GNPA 2ODWA 4H1UA 5EP1A 3NWJA 4HAZA 1EFHA 3VQTA 1OW3B 1J7KA 4V0OA 1BS1A 3BH0A 2O8BB 2ZI9A 4Q4AA 1CJMA 1QHHB 2X2EA 3AUYA 4IOJA 3KQHA 2Y8EA 1HT2E 2J7PA 3QXHA 4Q4LA 1CF4A 4P32A 4ZV4A 3QVUA 1SVKA 2F9MA 3IQXA 1G6OA 3SYKA 4XVRA 2VTKA 1R2QA 1AKYA 1VCIA 3N5CA 3B8HA 2WWWA 4UNQA 3UG6A 2GXSA 3L82B 1C1YA 4AKHA 5DHAA 4GNKA 2QSZA 1NLZA 2OSBA 3FFBA 3AGPA 3ICQB 2TMKA 1HURA 3PUZA 3LDAA 2CE7A 4A0RA 1GKIA 2VSXA 4QHSA 2R6DA 3NEJA 2ANCA 3Q3JB 3DKPA 1BH2A 3KL4A 2PZFA 1ESMA 3NVAA 4TTPA 4A2QA 4AWXA 4BE7B 1DPFA 3N2IA 1YKSA 2BVNA 3R20A 1UEJA 2WBLC 2GRJA 1Z3IX 4QG7A 5KSOA 4LHWA 1VPLA 1WF3A 2I1QA 3CZPA 3ZJYA 3ZS8A 2BJWA 2EWVA 5L3SA 2W58A 3Q72A 3CR8A 4ITRC 1N0VC 4YXWA 3TLXA 1R0WA 3T61A 1Z0AA 2YINC 1IQPA 3RVBA 2H8KA 2A3RA 3WY9A 1AA9A 4QKQA 5FH9A 1IAQA 1VG0B 4Q9HA 2C8VA 2R62A 3RC3A 2BJVA 5C4MA 1RJ9B 3TNFA 5FPYA 3SFVA 1XD8A 1G21E 1VHLA 5B2ZA 1N5LA 1US8B 2QI9C 3NEYA 4JLMA 4YXWD 3TJZA 4F91B 3THYA 1D9XA 2CLDX 2HUPA 3EC1A 5BN4A 2BMEA 2XXAB 1RC8A 1Z2CA 1KI6B 1WMSA 1W4BA 3KFVA 3VTKA 2YHSA 4HB4A 2EFEB 1W1WA 1KZ7B 1N5IA 3DM9B 4MYUA 4Z54A 4C7OB 2DCUA 4DLVA 2CK3D 4TQ9A 3SHWA 2WOJA 3I4LA 5DSZA 3VX3A 2QN6A 4AC9A 5C18A 4M2LA 1XXHA 4LC1A 4ZI3A 3KXLA 5GJVC 2ZPTX 2AFHE 3KUDA 4QGGA 2VP2A 2FZLA 1IHUA 3TH5A 4RFVA 1F48A 3CB4A 1G7TA 2XTMA 4QNRA 1FL9A 2V9PA 2J0VA 1FOEB 1TTTA 2LWIA 1E2PA 1KDOA 4LV6A 5DI3A 1UBCA 3ZLJA 3AQ4A 2O8DB 1ZUNB 1A7JA 4V02A 3M1IA 3PXGA 1EWQA 2J9RA 1OFUX 3EG5A 2R6GA 5FOXA 5KSPA 2NMVA 2BMDA 2XZOA 2ZI4A 2F3RA 1IXRC 5JWHA 2AXNA 2CE2X 2WAYA 4KU4A 4B3FX 1CS4C 1ZM2A 4LHYA 1F6BA 4O25A 1GWNA 3LXRA 3T1TA 3OEED 3I61A 1DO0A 3GFTA 2GJ8A 2V3CC 3A1TA 1FMJA 4Q03A 4M1KA 2QTFA 1OKKA 2GZDA 2ZVQX 1G64A 4M53A 4BEJA 4D4KA 2WPDD 4PAQA 4EFMA 3BC1A 3P4XA 4ZIRA 2OESA 3VR2A 1Z08A 2G1KA 2L0XA 3SZRA 1GNQA 3NH6A 4TLCA 2IYVA 3SBEA 5E3HA 3DMNA 4HUQB 4BZQA 1PLJA 4DLZA 1E99A 1SZPA 2NO9A 3OIUA 1WQ1R 1Y63A 1M74A 4YONB 2FX3A 4RY2A 3ZH9B 1NRJB 2CXXA 4MYTA 4TYQA 2ZU0C 3A8TA 4A15A 1S96A 3BD9A 1B0UA 3B78A 2IYTA 2RGCA 4JVNA 4JSYA 2QL6A 3IHLA
chains in the Genus database with same CATH superfamily
4OH7A 4CR7A 2X42A 1YTLA 1Z2AA 4C8OA 4NCAA 5TMEA 4M63A 3TMKA 3OPXA 4OHOA 4PE5B 2VQEJ 1L4BA 2WWXA 2DNYA 3FLAA 4DR1F 3U3JA 1Z2OX 4WXHA 3U16A 3ABZA 2RDDA 3SJUA 4F0MA 4E15A 3TCNA 1FB5A 2U1AA 1DG3A 4MI6A 3F6SA 2DGSA 4IEEA 5JECA 3ND8A 3WNCA 3I9MA 3SQMA 5MAOA 1P61B 4JYAB 2PSJA 3QRWA 1C14A 1IN1A 4DSFA 4IUDS 4N65A 1LF0A 5EG5A 2B2XA 1UODA 1KPGA 3AF4A 3GLKA 2CC2A 5KFJA 3MOZA 1RT5A 3IC1A 2MSWA 2SECE 1PT7A 5IDXA 4LMRA 4DSUA 1N3IA 4XASA 2FLNA 3P45B 4R8RA 3GGJA 3FYUC 1NASA 3G0CA 1I7PA 1YR9A 4E5MA 1N9ZA 2HZVA 1P9YA 1XNRF 1O8CA 5IXSA 2VT6A 4X6UA 4JQCA 4URGA 2JANA 3H9CA 3GSDA 1SIWA 3KETA 4ESHA 3RF6A 2MYFA 3FCXA 5C7LO 4NRDA 2X7IA 2Q6LA 2Z2ZA 2HIAA 4R3UC 4ZCMA 4JI3F 2NR0A 4LTDA 1GRCA 3BQ9A 1DJMA 4Q00A 1IVYA 4ARSA 2PKYX 3A06A 3VV2B 2JBAB 2VPIA 2QUJA 2VHUA 2LVBA 4M0LA 1Z0SA 3NOCA 3KE9A 2XA9A 3EPRA 3GQVA 1UBFA 5EZYA 2BKNA 2BRUC 2QMYA 2UU9F 1K5HA 3C3MA 2GPSA 4ECTA 2I9KA 4FUTA 2E1CA 3FNBA 3UVEA 3QF4A 3EZXA 4HLUA 4Q45A 1OU4A 3HHEA 1YHZA 2H1RA 2PBLA 3PFCA 2HYIC 4RY8A 2ZRHA 5J4VA 1B4SA 3AUXA 2OAP1 3A3PB 1KZ9A 4ZA1A 3TVTA 1YK0A 5JJ5A 2D1YA 1PR9A 1YJUA 2MHCA 4CF4A 3OY2A 2WTFA 3I5YA 5D00A 2IJGX 4JXXA 2IYEA 3THPA 1T9YA 3MF5A 2XCAA 5DP1A 4CEHB 1KS9A 3QLUC 1X6VA 1XO1A 1I3OA 3BD6A 1I1OA 1LBHA 2HV9A 3JYQA 1Q20A 2QW1A 4JI5B 3RVPA 2HOQA 4FQ8A 1QV7A 5HZMA 2D5LA 5IT9Y 4RIHA 5E2IA 4HI1A 5FTNA 4PC1A 4E1AA 2P91A 2F1IA 3CWJA 3WGMA 2AOTB 5I7SA 3J81A 2BJHA 2QIFA 3NC4A 3T0IA 1XZGA 5C4GB 3VR4H 5BW8A 2VHTA 5ITZA 1F4VA 2FUEA 3WGIA 1EJ0A 1Q15A 2FG6C 1B7FA 3B82A 1IOZA 1HH4A 3K5LA 4JI5F 4LWQA 2BM1A 2IYIA 4LSLB 2XQIA 3AB2B 9LDBA 4LY6A 1X7VA 1SCUB 3BREA 5DX1A 1E9VA 5AUOB 2G71A 1LS1A 4Y3UA 2E5LF 4C6SA 1MIOB 3ISND 3SCIE 3ZTSA 3KOAA 1JU4A 2AQ8A 1RT6A 2GYWA 4O4JB 2AYBA 4IRMA 1WWKA 4BKPA 4R9NA 1GSIA 4DIOA 1FDNA 1MFPA 1HEIA 1Y1SA 1CSJA 1YS9A 5JR3A 1LV8A 1QIFA 1WDTA 4G1MB 4BKMA 1F2DA 4A8TA 1NUHA 3L49A 3QFHA 4QPZA 3UMCA 2WWIA 2W2LA 3O8BA 4U2EA 1C9JA 3WHPA 2YQZA 1PV4A 1FW6A 1BDJA 1MA3A 3WIOA 3DCIA 3W65A 3WLFA 5EIXA 4UBMA 3AETB 4U3JA 4XVCA 4LBIA 2CVEA 3L7IA 3WDLA 3G4SS 3EEBA 4YN3B 3G23A 4S1PA 1YVPA 1XDDA 2E44A 2ZSEA 3OXFA 4NAHA 1HNIB 4N01A 4JI3B 4MVJA 1R18A 4FGWA 1SUSA 4DV4J 4F36A 4JLPA 3D7LA 3TJ8A 2VHGA 4Q0BB 2QRNA 3CCFA 3I3SR 4LY9A 4RVHA 4H4OB 3IBYA 5BQPA 1SR8A 2D1CA 2C5FA 3AO0B 5JPCA 4TY8B 4IQ8A 1VG9B 3IL2A 3O1HB 5KIAA 2CNWA 4L5BA 5DNWA 2JLZA 3H9QA 2GRAA 1P0IA 2Z2XA 4MYDA 2GPTA 1TM5E 4GU5A 5A0YA 721PA 4I1SA 2X9LA 4QFBA 1K3UB 2RK6A 4V19X 2PLAA 4M8LA 3PFNA 2QR2A 3WRVA 1X80B 1U48A 3BMXA 4DFDA 4C6TA 3FTDA 1U5BB 2IX9A 5I7WA 2DFVA 1EP4B 4HRXA 5DRKA 4QICA 3CULA 2MPUA 3D54A 5EVCA 4PZEA 1M1GA 4ZTUB 1P45A 5JQWA 1U5CA 1UP4A 3DBHB 1N5YB 4FWBA 4BPRA 2FP4B 5FPPA 3TI9A 2FCRA 5IULC 4G9BA 3KO8A 3RC7A 2AG8A 3C4JA 2HIYA 4WKNA 3PXXA 4F4XA 3CSUA 3OOJA 3ROZA 2XMWA 3CDBA 1WQ3A 1J2TA 2BM9A 2VYQA 2A3NA 4WFBQ 2W24A 3N8HA 2HBRB 3AEKB 1E8MA 4KIGA 1NBMD 1CR4A 3HABA 3O47A 4ZMBA 5K0GA 1QX4A 4WFYA 2BABA 3CTMA 2B6HA 5HROB 3EQ2A 5IKPA 3DLGB 5FOSA 4KZPA 4EJ6A 3R0IA 4OX6A 4Q3BA 4RF4A 4HH1A 3PQEA 3SX0A 1LW0A 3C3CA 5G0SA 4KHPB 4KMOA 3R6LB 1A5TA 3W3AA 2COUA 3N0RA 1I1HA 2FDNA 1UKAA 1YGPA 2VP0A 1WB9A 3S1TA 1FXSA 4BTEA 1A9PA 4Z0HO 3PQ6A 4B3BA 1FDBA 2CV2A 1LWFB 2OZLA 1JE1A 1TL3A 4QEKA 2CL7X 3A1DA 2XWQA 1KHWA 4QOJA 3MEEA 2WA2A 3ZJVA 5BR8J 1ECBA 1ONBA 2OE2A 4MV4A 2BIFA 4EYOA 1H2ZA 1HOXA 4NYJQ 2NU7A 4X94A 3MM7A 1UBRS 4DN0A 2I7TA 1XSEA 3B6IA 1EZZB 3E7FA 1OZAA 5CQGA 2H08A 2WSFC 3AM5A 5A5DA 2MGZA 1ZD2P 2R7AA 4R69A 5IFMA 5CU7A 2W7TA 1V8ZA 2J87A 3Q7TA 2ZQ5A 5TQVA 5JBIA 4CG2A 2XHCA 1J27A 3M1AA 4MQ6A 3Q2OA 1U0TA 3NTQA 3VI4B 1EUYA 5CYGA 4YV0A 1N8RT 4JV5F 3ZIUA 1UINA 4YREA 5BT9A 1WOMA 2VNSA 4D92A 3FMGA 5D01A 4C3VA 3BGDA 4XTTA 2IUYA 2Z9CA 4NEQA 1NQOA 2Y9HA 3TCKA 2W43A 5J59A 5CVUA 1QAMA 4QYZJ 2XQGA 1Z74A 1ESNA 1Q2XA 1H98A 4BMNA 5IYZF 4FQ5A 2UVPA 2BW2A 1GTHA 4FFWA 4RW0A 5GMEA 1U1KA 4AWAA 4IZHA 4WH0A 4F97A 4YRKA 4BO8A 4Z4FA 3GLIB 2A84A 5LL6P 3FTFA 1DAGA 1H7WA 4OXNA 2FRXA 3HTXA 4AWBA 3KDSE 3SX4A 2CXHA 3SIWA 1U45A 1F1BB 1QE0A 3I6PA 3WWOA 1OF1A 1C2YA 2HCFA 1CUZA 1RXIA 1NE7A 4D7AA 4A23A 4MWSA 1KVKA 1ZL0A 5AVXA 4WOPA 2RGAA 4B84A 5L1LA 1KPHA 2IHTA 4HZUB 5HBGA 3NCQA 5U9CA 4CNQA 3E8MA 3IVXA 1E2EA 4G97A 2AMFA 2VJMA 2ODNA 4I2QB 3C7DB 2O23A 4F8JA 4LF6J 5BNZA 3PHJA 3BVPA 1L6IA 1TXGA 3LPEA 3IT3A 4UFOA 2O66A 1RCFA 2HQGA 5BYQA 3W2HA 3PPYA 1AKVA 4UVEA 3ROFA 3RU2A 3OUUA 4HGOA 4IZ6A 3LPMA 4XFKA 2Q5FA 1RM0A 1XT6A 3AXTA 4NBLA 1NVBA 1R9JA 2CLIB 2OLEA 1PJCA 4GMDA 1RXCA 3NHJA 3OT5A 4DFPA 1OYVA 4B6PA 3DGFC 3PCRB 2D54A 1GIAA 3IO3A 4AJPA 2QYSA 1SUDA 3ADDA 4Z1MA 1NJWA 3JQBA 1GQQA 1E62A 3CEAA 4B3TJ 2HS3A 1HRKA 5DTQA 2R4UA 1KSGA 4TMWA 3I58A 2PH3A 2OPQB 2O0MA 4E2XA 2I3GA 2QD4A 1TNDA 5D86A 4L5JA 2VG6A 4ZP9A 4UULA 5FTMA 2EQ5A 4BP1A 3KHRA 5KWVA 2Q45A 1L5MA 2HHCA 1E6UA 2IHYA 1O2DA 4AJNA 5KCMA 5I7EA 5EJIA 1N2OA 1KBRA 1OAKA 3KEGA 4A91A 4OVKA 4DT1A 2A78A 2DEJA 1HE1C 1FRXA 1P2VA 3EXFA 2BGKA 5LUBA 3BE4A 2B1JA 5J5AA 3AU8A 3Q7EA 4FNOA 4ZVRA 3LHSA 2Y1GA 1QP7A 1YS4A 1JGTA 1TFYA 3VPDA 1XVIA 1UVJA 1VISA 1U0JA 4KDRA 3PNKA 4C6AA 3TZYA 3DMTA 3LQRA 1KWGA 4KHZA 3KFXA 2C2NA 3N2EA 3DMRA 4U9IS 3EAQA 3ZHTA 4DPTA 2I2FA 2E9RX 2QXYA 4EHJA 4E88A 2GO9A 3PY8A 4D0SA 2OZPA 1M5PC 1VQ8S 2WTUA 5I4CA 2BGIA 4AO6A 3IP5A 5KTKA 4X00A 4CH7A 5DEIA 4PLVA 5ALZA 1ZNZA 2B4VA 4P3NA 1IWBB 4HHEA 1JLCA 3A9CA 1GTZA 3WGJA 3RYFA 4RHTA 3ZHXA 3HCFA 2WAOA 3QFWA 2PPVA 1QNFA 3F1LA 3HLKA 1GRQA 3AL3A 2EC5A 4TM8A 4YMHA 2ALYB 3BZUA 5KKAA 3P5SA 3QIDA 1GU7A 4G8CA 4QBGB 2N4CA 3L7MA 5AVYA 5HDBB 2AI2A 4WNIA 3JQ8A 2YKMA 1IAVA 2IYSA 3AETA 1M8PA 1XRJA 1U1NA 3ZQ4A 4WZBB 4EY4A 5HWSA 1U4BA 1T2VA 1WZNA 5DNEA 1KP2A 2WF7A 1EJBA 1H69A 1U3CA 2B69A 4L4RA 3RSOA 5DB4A 1FLAA 1KY4A 5HFJA 1UW9A 3I5XA 4B8WA 4ZJZA 4EW6A 2B43A 2M2BA 1WMBA 3B38A 1OQ3A 2EARA 1SBQA 3ZI7A 2B3TB 3R5KA 3JYNA 3EXEB 3HE3A 5F8NA 1OY1A 1HE8B 2AX3A 2HQDA 4BNIA 1Q7CA 4ESOA 4IUBS 1SV5B 3M6LA 4UPDA 1IBSA 2ID9A 1FUIA 1VYAA 2W7OA 1JHPA 1IZYA 3U6KA 2A6PA 1CS0B 4P5EA 5E3QA 4A27A 1DAEA 4F2DA 1SB8A 1CJKB 4KQZA 2OP5A 3B6MA 3S2ZA 3PPXA 4R7TA 2W6PA 3N07A 2WYWA 3WFIA 4HDSA 1G7CA 3VPHA 1F06A 1PT6A 1YMUA 3OTEA 4ZK6A 4FYHA 2WD7B 4BAGA 1MOQA 3ZIAA 1JNXX 1JLRA 4H6XA 3DVRX 3VO9A 4EEKA 4U6NA 1DIGA 3Q8YA 5CYJA 3RANA 4H7IA 4ZITA 2X13A 2JC1A 3U2QA 2HVDA 1VL8A 3EMKA 2PKWA 5KOJA 2L9DA 4BLPA 3VTIA 2XNSA 4PXCA 3SYRA 1OZ0A 3JQEA 3R5DA 3TXXA 1Y8AA 4KVGA 4J0HA 1MO4A 2VEOA 5CW1A 2BFMA 3QNWA 2FPIA 3F1KA 3ZHRA 2YXEA 4UDYX 3IKVA 2LW7A 2P77A 4CO5A 4KQJA 4KGMA 3EC2A 4F3YA 4XM2A 4KR7A 4ZPXA 4WP9A 2V7VA 3NIDB 4M7OA 1HR0J 3EAFA 1KFKB 5JATA 1EX6A 2ZWAA 3GLVA 1Y10A 4EUVA 1D6NA 5BMVA 5C24A 4F21A 1VLYA 3OOYA 1Z07A 4YRMA 1S5ZA 3N6LA 4PYAA 1VBMA 1Z83A 4ES6A 4GF5A 4YQZA 3GN2A 1P1FA 4DG8A 1Z4OA 2WTAA 1G7RA 2PNFA 2ZBVA 2E85A 1M6WA 4DR5B 2DUMA 3H2HA 4NBUA 2JIQA 8ABPA 1VIMA 2UUAJ 1VBFA 2JLCA 1BD3A 5ICFA 1KJIA 4HD8A 1A9ZA 3EFOB 1JXMA 4KSBA 2ZOGA 3R8YA 3L77A 3FKBA 3G2MA 1ZAKA 3KUEA 3SIXA 1CJKA 3FUVA 4AW9A 1FWLA 5JVDB 4IH9A 4HEJA 2QX6A 1YJ9S 4FDTA 3FWKA 4C7MA 1EJ2A 5F3DA 3DOUA 4ZJQA 2HNBA 2IOFA 1QGZA 2VDJA 4ZMRA 4RDIA 4EEYA 3ZUGA 1X86B 1UC8A 5CDHA 3T5AA 2OWEA 3ISNC 2AN5A 1PG5B 4HO1X 4JI4F 3UGKA 1VLQA 2VDRB 4BY9E 1RWXB 3SSOA 5A8KB 1XKTA 4H9GA 4LKOA 1FF2A 2Q9UA 1P1IA 2G3YA 2HQSA 2JH8A 3AF3A 1DHMA 2VPPA 4KTTE 2EP5A 2J5QA 3CJ2A 4BIMA 3NWOA 1KVJA 1G21B 2HNAA 3ZE1B 1WORA 2J4DA 1Q0ZA 3UNGC 5IABA 2CVOA 1CXZA 4B34A 2QTZA 2IU0A 4EL0A 2ZPAA 2DXDA 5AKLA 2EEPA 5LMUF 3ROEA 1NYRA 3OCYA 2YVSA 3GELA 2XODA 1C41A 3H04A 4RETA 2DNQA 3QLVC 4B76A 1XJ5A 3OJUA 1ZH8A 1QIJA 3C7TA 1RAFB 1M8FA 3C7KA 1PLKA 2JEGA 2R6JA 4E0BA 5T8KA 5H3CA 5I9TA 2LDYA 2VP3A 1CLEA 1HBNA 5IZHA 1Y4SA 2DXFA 2UZ3A 3A6ZA 3PNVA 3A1EA 4HAVA 1RTHA 2J3LA 3LL4A 4ARUA 4S04A 1SH0A 3TQTA 1V4VA 1D9AA 1TO2E 2QLNA 4RKWA 3IQGX 5IAGA 2O06A 3JQFA 3LBNA 3X43A 5AR1A 4URYR 3UJ9A 2O3QA 4AFNA 1SAYA 4H17A 3K5HA 3N0XA 2UUTA 1Y9DA 1E6EA 3OTDA 1UZDA 4IXDA 4F38A 2POKA 4UD2A 1NW6A 5K3CA 1W35A 3FSEA 4UAGA 1XC9A 5LR6A 4DV3B 5AK4A 4UU0A 3RAGA 1J97A 3I6BA 3TZHA 1JLAB 2GPJA 2O9JA 1GQOA 1F5NA 1JQ3A 2K1RB 2YUIA 2OAEA 1E6VB 2P6TA 3MWKA 1IMJA 1RR6A 1LEHA 4HATA 4HVCA 2IS6A 1XVLA 1LDNA 4ZYXA 5JVGQ 4BNZA 2WKQA 4MVJI 3EEOA 4HEA9 2XF2A 2HMIB 1QE1A 1FTNA 1UPPA 3SYNA 1JFVA 1EUZA 4WESB 3WMGA 3QXJA 5JAMA 5B0BA 2BMBA 2E21A 3SQNA 1RP5A 4NQRA 3PTLA 3IE1A 5DK6A 3UJNA 4MSUA 1DRKA 3QGGA 4F4DA 5BV0A 5U4QA 4G5RA 3PR4A 4WW0A 3HCEA 2ASDA 1D4ZA 1YKGA 1BXKA 3H2VE 2UYHA 2XMZA 5A7HA 3GSIA 3GEIA 3UJCA 1XQWA 3CSDA 4J37A 1JKHA 1VOTA 3I6ZA 4ZODA 1CU1A 4PAGA 4E2YA 2VZ0A 1KO7A 5CPFA 3HGTA 3G5TA 2XLIA 4D02A 1I7DA 2O3SA 4XGIA 5CEFA 3NXKA 1ISIA 4BGVA 3H9JA 3PC8A 2ODWA 3LP5A 4QULA 3X2FA 4OLPA 1EFHA 2I34A 1CJMA 2JIRA 4DF4A 4HDHA 2PXCA 5TSDA 1N32F 1N2XA 1U6ZA 3KLPX 2CSUA 5I7AA 3EXG1 5DTRA 3DO8A 4TTPA 1ICEB 4C03A 3F56A 1U1OA 3RAMA 3UGQA 1BHNA 4R1MA 2IW1A 4YJGB 2RDIA 3RVBA 2H8KA 4JT8A 4TXNA 4Y1GA 4BBYA 3DT9A 1Y6JA 1NI4A 1DXHA 1Y4AE 3O8QB 1NJZA 2PKXA 4RMIA 2BGNA 3L6CA 3ZCXA 6NULA 4V38A 2PTHA 2ZOMA 1EYZA 2C4HA 1CJSA 4G1BA 3G2KA 2C3YA 3KXLA 2A88A 5A06A 3PWSA 1K73T 9RUBA 1MAUA 1T1EA 4LV6A 4F3RA 4DY4A 5G0VA 3NTOA 2NMVA 4KYZA 3FFIA 1VK8A 4IIEA 4O25A 4ZMSA 4Y6IA 3JX9A 2GJ8A 3KFWX 2PT9A 2UXDJ 2I03A 1ZISA 5NULA 3H25A 2DRIA 5GZ6A 4DLZA 2WHRA 1SZPA 1Y63A 1WQ4A 4MYTA 3C5EA 3VAZA 2DPHA 4M5KA 5JVHQ 2JI7A 2X2PA 1V11B 3GLJA 1ZJ4A 1N5MA 3C6BA 4WUTA 4X66J 1VL6A 3EGCA 2XC9A 3W7VA 1RTZA 4U7UK 4HI2A 3AKYA 5TC4A 1Q7LB 2B98A 2CJBA 1XTVA 2EFCB 3U1BA 2QRVA 2CLOB 1APBA 3LYHA 4AYTA 2HC9A 3ZDYB 2YKGA 4R3NA 3UPDA 4MR9B 5SZJA 2DCLA 5EMMA 1K88A 1JBEA 4IXWA 2OVFA 4IH5A 1M2EA 2GGPB 5KFPA 2DT8A 3F7TA 1MNEA 2QM3A 4GXQA 1CQIA 3DOOA 3U9TA 3NGUA 3AG6A 3H97A 4OSEA 3EXFB 5FT9A 4ZC1A 3R8CA 5GADU 2MTBA 1D4FA 1PD1A 5KT4A 1DUIA 2GSDA 2K7FA 2IM3A 2BBTA 2OTLS 1HT0A 1AA6A 3TJAA 1Y7IA 3HKZD 1CEZA 1U98A 3PJXA 4ROSA 3GRPA 2D5CA 4BVGA 1RAGA 3V80A 4ETNA 4LCEA 2SHKA 5CCDA 4H27A 4EY5A 3KZNA 3H4DA 3T7CA 5HK9A 2OGZA 2PQ0A 1QRAA 4KGXA 2PS0A 2OAUA 1WWHA 2FFAA 4IJQA 1JG1A 5H02A 3BBCA 2D00A 1HEUA 5KJ1A 4ADSG 3DL2A 3OEHA 2VDNB 4BHTA 2VJBA 2YS7A 1RHRB 1ZMOA 1IEXA 2CFCA 1XK8A 1YZUA 2HSGA 1C3OB 2QORA 1PIEA 3ZTPA 3I2FA 2EK1A 1E94E 1X9GA 2W4CA 3WK8A 4J0JA 4L6AA 4QDUA 2KHCA 2MGZB 2B7LA 3OP4A 3H1PA 1WPXA 4BQSA 3FSRA 4XSVA 2HZ7A 2PUDA 2AL7A 3M5DA 3IURA 3POTB 1T9ZA 3UICA 1FJGB 2QAGC 3CA8A 3HPRA 1H1DA 3SMZA 2FN3A 1MVNA 4I2VA 1SBHA 2FCAA 3T06B 1DIAA 4MIKA 1S7GA 1TX4B 2DGVA 3CVXA 3PYGA 1ZEMA 2P1ZA 2XKAA 4DQLA 2WQ6A 5B6JA 3MYYA 2MLXA 1ZIPA 2C9BA 3AFGA 1NP6A 2PWZA 2VONA 3CEMA 4ZCRA 2HRQA 4XTCS 2NO4A 4XWTA 1TUGB 3B70A 1P5RA 2YZ7A 1E1QD 2QG4A 3TIGA 3RG2A 4HAOA 3UAGA 4CKEB 1PKUA 3LP6A 3H5AA 4R98A 5CFRA 3T1HJ 3NHUA 5TS3A 1J5OA 4OLOA 3DEFA 4C2MA 3CVJA 1S59A 3V4IB 1BVHA 2MKYA 2G9RA 3DEYX 1MX3A 3U4IA 2IVMA 1ZD3A 2I5JB 3MS4A 1S1MA 5GY7A 3BDIA 2CPXA 2OSVA 3GU3A 1NJ6A 4M6WB 2POCA 4AKEA 1EVZA 4V2IA 1SKBA 4KO4S 3LA0A 3WB0A 3DMDA 4BNMA 2L48A 1T9WA 5FNVA 3ACCA 5JYEA 1SH3A 1Z73A 3GEBA 4NYPA 3AEQB 1QSYA 1WKCA 3DYAB 2JFNA 2RI6A 4XI9A 1JILA 1FERA 3H0KA 1S0MA 4C3ZA 3HO1A 2Q5IA 3LA8A 2IHBA 5BURA 2IU6A 1SXJC 4LSZB 5EQDA 2QMUB 4ZP1A 3ILJA 1XR3A 3WE7A 3CNQS 3M82A 3T7IA 4AJ1A 2MKKA 3BMNA 4GQBA 1WY7A 1EXDA 3DGEC 1Y5RA 1JJFA 3GD5A 2NVBA 3E9QA 4AY5A 3ZZRA 5IUJC 2ZPUA 2GAGC 4KIFA 5FBLB 7FD1A 1RT7A 2ISSD 3A6PC 2VUGA 4B7UA 2F9FA 2GZMA 3VR6H 1RYZA 4XJTA 2VICA 3EZ5A 2X8AA 4OYBA 2YKNA 4JYZA 4ZOLB 2WJZB 5A4MS 4RA6A 2YN2A 3T9AA 3O95A 4YP1A 3AR2A 4JI1B 5FBWB 4O23A 3BGLA 4C76A 4QYIB 3DVQX 1ZUNA 2O3DA 2BISA 4PX9A 1U3GA 4ESVA 2Y76A 2ZSIA 4MDEA 1M6VA 4EQZA 3H13A 1WNFA 1P6TA 1XCLA 5FORA 2QGZA 4Q7AA 5KAPA 1SBZA 3FC9A 3VKHA 1K7SN 4JNKA 3PT5A 4MK4A 5DHTA 3PXBA 4M7RA 3L4BA 4PXEA 2GFIA 2OOKA 1U04A 1CQZA 3V6MA 4U8YA 1NX6A 5EZ6B 2XMGA 3AJ8A 1IKXA 2FMIA 1JNZB 3C8UA 3QY0A 3HXMA 3TTUA 3Q8RB 1KAHA 3J7TA 1HL7A 1FS5A 1JG7A 3OQJA 1T7PA 4JBXA 2XCRB 2E4WA 5KNBH 3LC7O 1K8QA 3FOCA 3OURA 3SX2A 4MV6A 1DC4A 3UTCA 4AMBA 1RQXA 4LZWA 2VFUA 3G17A 2IY8A 1PYSB 2FVQA 3V00A 5I45A 4HLQB 1GVHA 4JT4A 3LXUX 2F1KA 4HVAA 2B8PA 1Z68A 3O9VA 4MUFA 3V1YA 5JSYA 4GW3A 4X0EA 2QRMA 4BMVA 4F50A 2MJNA 3TM4A 1RPNA 2HKIA 3DKIA 3CY6A 1CQWA 3DOIA 4OHKA 2R2SA 2GKOA 1QG6A 4N7TA 2P5UA 4IHJA 2RRNA 4E8UA 8OHMA 4KG7A 4P0TA 3C3BA 1SQGA 4HXEB 1E3DA 2PO4A 3ICPA 2CPZA 5CLGA 5C8ZA 5DCUA 4CCSA 3E22A 3Q2SC 2ZE7A 2O59A 2OPRA 1YVRA 5C52B 3M05A 1UBGA 1F6TA 5K4AA 3VRHA 1M8JA 3WJ2A 1VFJA 3MUEA 4LF7J 1AGPA 2ZZTA 2OFHX 1A2BA 3WAJA 1E1QA 4XKJA 2AT1B 2QRPA 3PRDA 4PQEA 3KQVA 4L0QA 4PHHA 3GZTB 1ATZA 3UWOA 5IJ9A 4BLOA 4XD2A 3DFKA 3A4MA 1H4SA 1S1XB 1HWJA 4LZAA 5DM1A 4Z86A 4ZYYA 1VGRA 1WEZA 3OJLA 1OX5A 3C7CB 1G8KA 1A7UA 1OI2A 2VDPB 3TX2A 3LKBA 1JB1A 3HWRA 2JIBA 4CLOB 2WPDA 3GOQA 4OJMX 4QYRA 1EM6A 3O3OB 4B4VA 5GAEI 4IVNA 3K5IA 5CVVA 4R2HA 1FK8A 5BWBA 4DMMA 4G3IA 4N39A 3KTAB 1NRXA 1I4LD 5IS2A 4K9PA 4OIFA 1SQ5A 5F41A 2ES4A 2YY6A 4YUWA 1E1DA 3GFBA 1BFDA 1NMYA 4G5XA 4M1WA 4YUVA 3WHIA 2R66A 2V8DA 1U1MA 3GW8A 5B4TA 4ZT7A 1XK7A 4Q4JB 2WFMA 2BE9A 1ZNXA 3VWSA 3HKDB 1R0AB 1XYVA 1IWOA 1YZVA 1Z12A 4LN1A 1KLMA 1GCIA 4KJXA 3K0KA 1U2PA 3WLJA 5HZHA 1GAJA 1E1YA 5L4SA 4FTWA 1YDEA 3CVWA 1N2BA 1CP2A 2VP5A 2E7WA 3E35A 1IU9A 1HE5A 4DN9A 2GIFA 2ZE6A 3B60A 3UC5A 1RIIA 3KL2A 1AXRA 2GCOB 3KB1A 3TTYA 1S5PA 4ROTA 2A5JA 4HPWA 3UK1A 3TOXA 2JFZA 1KYVA 3NM4A 1RJJA 1BROA 2GTHA 1C2PA 2DITA 3KKPA 3TRFA 3GRCA 1KQ3A 3DPIA 1WEKA 3M8QB 3IS9A 3BGRA 3OUYB 3ICWA 2IJNA 2FFBA 5JAZA 2JLWA 3BIXA 4RHYA 2EZ8A 4Z7CA 2GZRA 4QIHA 2FGCA 3BXXA 4RUCA 5EWGA 2FEKA 1O5JA 2O8CB 4GICA 1OKKD 2NV2B 2CDCA 3MMAB 1VKOA 1VZ3A 3Q0EA 1BA3A 4PS0A 3TE6A 4LVOP 2XCQA 4K4SA 3AIKA 4XIGS 2R8ZA 1YI2S 3GR1A 4O33A 1KSJA 1LUAA 4MO9A 2MYNA 2BOVA 3HXTA 2DRBA 3K96A 4LZJA 1YCFA 2ZHBA 1G16A 3ETJA 3STYA 5C3MA 1OH6A 3BGFA 3FF1A 3O94A 3MECA 4FXOA 2CQ2A 2KU7A 4W8OA 3ZDFA 1E7QA 3M0EA 2D4AA 4QGFA 4KXLA 4ALIA 5F52A 3UH1A 1Y1TA 4TSKA 4G67A 5EOVA 3OPVA 2XUOA 3DB1A 3E9RA 4ZO7A 2I6GA 5FOTA 3C5HA 4FI3F 4NWBA 3K0SA 3RYTC 4AP5A 4C8KA 1X14A 3K31A 2CNOB 2WZ1A 4J2TA 2VPWA 3GN1A 3HEBA 1MGOA 3NGKA 2GN6A 1B16A 2H0QA 3OJXA 2O05A 1BCSA 1YJBA 3LECA 4LMPA 3VH3A 1NVEA 2GEFA 2OUKA 1CQPA 1PGNA 3ZHZA 3COYA 4XPIA 3HRHA 2GD2A 3R6GB 1YK1A 3BKUA 4WEQA 4QJIA 4WADA 1A9RA 3A0UA 5THQA 1F1JA 4CLRA 5IM0A 4ECXA 4IGIA 2ZRJA 1L3KA 2NZYA 2XZDA 4EGQA 1RBLA 1K6IA 5CM8B 4J5OA 2BFFB 1Q82T 4RYDA 4E1BA 2Y71A 5F8MA 5JRDS 2NSCA 4LWOA 1OXTA 4PX5A 4RWZA 3PGJA 3H5LA 1TVRA 1HT1E 1M1YB 1U8SA 5G3YA 2ZI3A 2WUDA 1BXGB 1XJWA 2A2CA 2BHTA 1CF9A 4BC9A 3BN4A 3RJ5A 1W2WB 3AOGA 2DNGA 4WOCA 4OUKX 5FBKA 4JI2J 4L6CA 3AXKA 2JEJA 5BVGA 1ISRA 4DA4A 3C97A 4HY3A 3LCCA 1HYGA 1Z4IA 4ML3A 1JJIA 2EIHA 3RK4A 4O4LA 2JA2A 2XY6A 4RTRA 2GX8A 3X0DA 3RS9A 4C0WA 4AX4A 3TBKA 3AHDA 4ILLA 1VSQA 3OJWA 3ZGNA 1RWOB 3ICOA 1T35A 4K6MA 4RZHA 4RZ2A 5F9LA 4BV3A 4M60A 4EHFA 2J5RA 3DEIA 1G8PA 5K1ZA 3LY5A 2A6MA 5I42B 1KZ1A 5DBGA 4MUNA 2JRCA 1RT6B 1UZHA 2E1MC 2WSMA 1U3DA 1ULZA 2E5WA 4TUYA 2QVZX 3OP1A 3Q3GE 3LPNA 3T1HF 1X4HA 3NHLA 2H5LA 3PCXA 3M5WA 3M1YA 1AZWA 3W6NA 3GFSA 1U7WA 3D0GE 5CNJA 1L5OA 4L72A 3V4VB 1WSDA 1CNMA 3SQGA 3U7IA 2GHVC 4QFDA 3BXOA 3VAYA 2VK8A 4CW7A 2DCUB 2GVDB 2DCMA 1VRQC 3LC1O 3OHPA 3OM9A 1C9EA 3I9V6 2WUWE 1PILA 3FLBA 3AUKA 4FXWA 2B9XA 4XIUA 2R1ZA 2W2PA 4X6YA 4IR7A 2KI2A 2JFQA 5KYYB 5IWAF 2ZBGA 1W0CA 3QSYB 2ZBCA 3W78A 3HYCA 1R5JA 2X5NA 1U4NA 3I01M 1KO1A 3IPYA 2VA9A 5CAEA 3IG1B 3PQ8A 4WZBE 1TRKA 3QJPA 1UDWA 2C83A 3RJ9A 1RTDB 4IG3A 3DZHA 1WF2A 4JV5B 1S1WB 4YFYA 2HG4A 2R60A 4FM9A 2JJYA 4OHXA 3M6IA 2G67A 2C7QA 2OFOA 3H8WA 1USVA 1NUTA 1LQ9A 4ICLA 4K4VA 4FS3A 3UPTA 2J0SD 3A8JA 2H63A 4CZ2A 4ZGBA 5EYPB 3D8UA 4OGWA 1LH0A 4N0DA 1DNPA 1C7ZA 4DQVA 1P33A 3LE8A 5C35A 4RXTA 4UATA 3IO1A 4HTIA 4DKJA 4B32A 4R2KA 1R16A 4Q1AA 2IHJA 1BNCA 2EJWA 5EXSA 3D8RA 4PG8A 4JZKA 4WRRA 4OM8A 5M04A 3RRMA 1K2WA 1XWWA 3SC3A 2HF7A 3RD5A 5LNK6 2COLA 4BO6A 2JK0A 1NNI1 1ULUA 2XCUA 3ZK9A 3HB0A 1EDEA 1J70A 4XK8C 4MQUA 3ZE8A 3QKRB 4KT0C 2ZB2A 1TADA 2PBFA 3BTOA 3NGXA 3RW6A 3KSBC 4EMTA 2XITA 4LXUA 4N3NA 1ZMTA 4Q4AB 1BJRE 3FROA 1H1LA 1K0UA 1F2UB 2P8JA 2OBXA 4EHAA 3B1FA 1BHSA 5AW1A 3OSPA 4R4JA 3N8GA 1J1ZA 2WVCA 4X4QA 1GT91 3RB4A 2QMHA 3K8VA 1FRHA 2PGNA 2YZ2A 2ZJOA 1P4HA 5CD1A 3HP1A 1OT5A 3DFIA 2ZD1B 5KOXA 2YH1A 4QWAA 4GI5A 4NE9A 2P27A 5AUPB 3ZGYA 2M9KA 3C16B 4MJKA 3GRUA 4LDJA 1VIAA 3GEEA 5CDTA 3UOGA 2N42A 3SOPA 4JI0B 1P77A 2I7DA 2AZXA 2O07A 1VRTA 3E8XA 2ZH9A 3BFXA 2I87A 3K5OA 1K2VN 1DRJA 1Z7WA 4QT4A 3LGXA 3ZW9A 5EPEA 2I2BA 3FZBA 2F3SA 1X39A 1T6ZA 2XXJA 5ARCA 3RYCB 4NCJA 2WVBA 2OBNA 1S0OA 4BX0A 2ZDGA 4L9SA 1PYGA 3BB3A 5B5SA 5J63A 3TA1A 1QQTA 2B5JB 2NPIA 1IN4A 1G2QA 2QL7B 3CX6A 5IT0A 3HKCA 3O93A 4JUDX 4GD3Q 5K45A 5HPYB 5IK2A 4ZEXA 3L40A 3WC4A 4RJKA 1KN6A 4WBFA 4O4GB 5IP5A 3TZCA 1RHUA 3F67A 3DF7A 1U2GA 1CZKA 1Q1KA 1SXJD 1F8GA 4OYPA 3Q41A 4JI1F 5CYFA 3PUWA 4IPTA 1RU1A 4X65B 1OFUA 1NVMB 2VPTA 4DFMA 1EK2A 4P73A 2NW6A 5TV2A 1V3ZA 5CD9A 1JR3A 4KLCA 2V55B 5K8PA 3V8MA 4LUCA 1K63A 2Q79A 4R2XA 1T2UA 4KFSA 1E1LA 5WRFA 1G1AA 4TLEA 4P7KA 10MHA 5JD5A 1SXLA 1VRCA 2F62A 1DLIA 2HPAA 3AR9A 4EF6A 2BQ3A 4RGYA 1K9VF 4ZYVA 1JJ4A 5HRUA 3HJUA 5G3ZA 2EZUA 5JNWA 1T03B 2RGYA 4HR2A 5A4IS 3MI7X 5FJIA 2J9FB 2H1CA 1RHKA 3GFPA 3EW9A 1THGA 3WLRA 4Y6OA 1DLJA 1X5SA 1VTKA 5ALPA 4US2R 2IGBA 3P2KA 4O1IA 2C0CA 2CFXA 3QT6A 3LWBA 1YACA 1VKZA 3SZOA 4MPDA 5F9NA 3I2GA 1X5TA 2HT6A 3TLAA 4DA0A 4PVCA 2Q3LA 3UT6A 2O2XA 1X8JA 4HJRA 4O1MA 5DNDA 2J0SA 1KEWA 3EUEA 1AF7A 3M8PB 2XNKA 1XB2A 5IJAA 2VLBA 4MROA 4Q15A 3FG9A 3D0IE 2YXLA 4ECYA 2DRAA 4QNNA 1M10A 4PICA 4AQ7A 1LTQA 2ILTA 1S3SA 2PIIA 4KE7A 4XWWA 2R6AA 1YZ7A 3NH9A 4G1QB 4CUZA 3OZXA 5L4LA 2BSQA 4BIIA 2ZUVA 2ZXFA 5ICEA 3M2RB 3ZTYA 4MCHA 1DADA 5E3CA 3FOBA 4IRCA 5JH7B 1AFIA 2FQXA 2XZPA 4NPCA 4ENQA 5IM4F 4D4GA 3YASA 3KG2A 4ERDA 2NLWA 4IIJB 1CB7A 5KZMB 2YNFA 2V9KA 3WYBA 1SBTA 1GQ2A 4J9UE 2G82A 1P2BA 3LLUA 5HQ3B 3W6ZA 16PKA 4CLUA 3WWPA 1CZOA 5EI5A 5LDGA 3DNPA 3VPXA 1GT6A 3A4IA 4LF6B 1OZGA 3MT7A 1DJ0A 5KYTA 2YNGB 4IINA 3R7BA 2LVWA 2YFHA 4JB0A 3KBOA 2BFBB 1VE9A 3KUXA 2KM8B 3DYAA 5EKXA 1EP1B 4BO1A 1T0IA 2I4MA 3BH0A 2ZI9A