3DE3X

Proteinase k by classical hanging drop method before high x-ray dose on esrf id23-1 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation stability of proteinase K crystals grown by LB nanotemplate method
pubmed doi rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3de3X00
1C3LA 2W2NA 2X8JB 1OT5A 4OMDA 2HPZA 3GT4A 3DDZX 3LXUX 4OMCA 1V6CA 3BGOS 1AK9A 3SICE 4KB5A 5FFNA 1SVNA 1SBCA 1T1GA 1TMGE 1TO2E 2PKCA 2Z56A 3F49S 3ZXYA 4KPGA 1LW6E 1P8JA 4C3UA 1Y3DE 4BWGA 5ARBA 1TK2A 1AU9A 5JXHA 3DE2X 2PQ2A 4J94A 4WOBA 4Z2AA 2ZWOA 2XTJA 5I9SA 1GT91 1GNVA 3DW3X 3GCXA 1P7WA 1BJRE 1Y1KE 1NDQA 5K7SA 1TM4E 1TECE 3P5BA 3TI9A 1MEEA 4FONA 2Z57A 2SBTA 4LVOA 4HVLA 1SIOA 1T1IA 3AJ8A 4KG7A 4NMXB 3A3NA 1SIBE 1TM7E 3DE1X 2Z2ZA 5ARDA 3VTAA 5JXJA 4CG0A 1IC6A 3I30X 3DVQX 4NE9A 1WMDA 1MPTA 3D43A 1OYOA 4B5LA 2HD4A 1SCAA 2GKOA 4H6XA 1S02A 1SBIA 1SUCA 3EE6A 1DUIA 3PTLA 1AQNA 2ZWPA 1S2NA 2IY9A 3VV2A 3LPDA 1SCNE 1TO1E 4CFZA 2PRKA 1UBNA 2IXTA 1SN7A 3EIFA 3SQOA 1GTL1 1BE8A 1YJBA 3EDYA 3L1KA 4I0WB 2SECE 1Y9ZA 1WSDA 1Y48E 2PWBA 3QTLA 4LVNA 1A2QA 2ID8A 1R64A 1NLUA 1C9JA 4HX2A 2PWAA 1Y3CE 1PTKA 2SNIE 3WHIA 3DYBA 3I2YX 1WMFA 1AF4A 2DQKA 2WUWE 3H42B 1ST2A 1Y33E 1BH6A 1PEKE 1SPBS 1TM3E 1GA4A 2ID4A 5SICE 1KE2A 1PJ8A 1V5IA 3VV3A 1GCIA 4K8RB 4ZOQI 3BPSA 5JXIA 5AVJA 1Y4AE 1C9MA 1SUAA 2QTWB 2ST1A 1BFUA 5B1DA 3DE6X 3WIVA 1CSEE 1THMA 4DWWA 4CFYA 5AMXA 3I34X 4H6WA 1CNMA 1AV7A 3DE5X 3LPAA 5FBZA 5FAXA 1ST3A 2P4EA 3AJ9A 1BE6A 2Z58A 3A3PA 3DWEX 4YN3A 2W2QA 1YU6A 4RYDA 1T1EA 1ZVKA 3UNXA 4C3VA 3BX1A 1GTJ1 3D9QX 2E1PA 1GTG1 2DUJA 1EA7A 1S01A 3LPCA 1JEAA 5B1EA 1SUPA 1P7VA 4OV6B 4DJ5X 3CNQS 1SBTA 1SUDA 5AQEA 1SUEA 1TM1E 3A3OA 1GA1A 2SICE 3F7MA 2XRMA 4MZDA 1PFGA 1WMEA 1YJAA 4H6VA 3DE4X 3VYVA 3PRKE 3WIUA 3DE3X 3F7OA 5AVKA 1Y3FE 2B6NA 5CW1A 1VSBA 1YJCA 4ZARA 2WWTA 2Z2XA 1R6VA 1SELA 5JMOA 3Q40A 1SUBA 2X8JA 1SBHA 1C9NA 1NDUA 1SH7A 3DE0X 1SCBA 2PYZA 3DW1X 1BFKA 2ZRQA 1OYVA 1SCDA 1Y3BE 1KDYA 1KE1A 1HT3A 3VSBA 4AKTA 1GNSA 1Q5PA 3AFGA 3Q5GA 1SBNE 4NE7A 4DZTA 3CO0S 3OSZA 1AH2A 1ZVJA 3ZXXA 2V8BA 3DE7X 2W2PA 2W2OA 1TM5E 1DBIA 4GI3A 4JP8A 2TECE 2Z2YA 3QMPA 1XF1A 1KDVA 1AVTA 1SCJA 5JXGA 3DVSX 2PMWB 3WQBA 1EGQA 2WV7A 3GCWA 1GA6A 2G4VA 2W2MA 4WOCA 4AKSA 3I37X 3TECE 1Y34E 1IAVA 1Y4DE 2WUVA 3T41A 3HJRA 1SIUA 4M1ZA 3QFHA 2DP4E 3GT3A 5ARCA 2Z30A 1WVMA 1R0RE 1KDZA 3DVRX 3VHQA 3TI7A
chains in the Genus database with same CATH superfamily
1T5TA 2Y05A 3U7EB 3UICA 3FWHA 2UZ4A 4LJKA 3T7TA 1XLUA 3UKOA 1QO0A 3P9YA 3D8RA 4IICA 2EKQA 3RNLA 2AN1A 4MYSA 3UG6A 4BKRA 3EIOA 4C3UA 2ZS8A 1BIFA 2VHUA 3DUWA 3JQRA 1FFYA 5L7TA 1W9MA 4FW9A 1RBZA 4KI0A 3MIIA 5HVNA 1JQEA 2ODPA 3T7SA 4EW6A 3W1EA 1Z2NX 3ZN2A 3K72B 2RFLA 2QN2A 1J6UA 4U7JA 5A3QA 2QGZA 2PE5A 3IKTA 3F5MA 1HTWA 3DKIA 3IELA 2QNRA 1JHUA 3O8CA 3A6JA 1OYOA 3RSOA 2DFTA 4C5AA 2OZEA 1J0BA 5BOSB 4DR3B 3DFKA 1C7ZA 3JAWA 3KOWA 4MV6A 5EP1A 4RC9A 5EQFA 1TUIA 3FHCB 4O3MA 1G6OA 4J8PA 3RF6A 4AJEA 3ZZNA 1RLIA 3SZLA 3B2NA 4B6OA 1A7KA 5PGMA 5MFPA 1TEXA 1KJJA 1MJHA 1K9SA 2XNDA 8ABPA 3DZKA 3K0AB 1K5GA 3QOXA 2X2PA 4P83A 4YRFA 4Q39A 3ZDEA 4YV1A 5EHZA 4PTLA 5AOVA 3BD8A 1CDEA 3R7LA 4XFKA 2G80A 3TW4A 2BKVA 2P40A 3QUQA 4MLZA 2H2IA 4RS3A 5COBA 3TS1A 4F9TA 2H7XA 4DWWA 1VBFA 4IJVA 3TJMA 2IHYA 4TS9A 1RNLA 2V9ZA 4C20A 2RGBA 4QJIA 3SP1A 4B7ZA 3RHTA 2YFYA 1O96A 1RVV1 4L75A 3CX6A 3TTVA 3OPYA 1KKLA 1IMJA 4OSOA 4NCBA 4Y9TA 2SKDA 3U3KA 5BWNA 3KPJA 3RFXA 2HADA 4DAEA 5DKFA 1OV4A 4R1LA 3UFBA 4J0HA 5DISB 3QMVA 1A4RA 5DOZA 3C3AA 4B32A 4XLLA 3HE3A 4HB0A 1B16A 1UJNA 2OM2A 3OQIB 2EWWA 1JB9A 4N4AA 2ZPAA 5CHYA 1I7PA 3G23A 1PS8A 5H0IA 5KREA 3ADKA 4IQFA 3I58A 1L4MA 4REMA 2X0FA 1TF5A 4KIGA 4MS3A 4TGLA 4BBAA 2CUZA 1ID8A 2AEFA 3WJ2A 3THWA 1KAHA 3OQJA 1VXOA 4HLCA 4JLWA 1IQUA 1KZYC 3ROKA 1IOWA 4CCWA 3Q6MA 2A9KA 3RTEA 4B9EA 3TTYA 3PRYA 5EVJA 1T9KA 1LDMA 4PXYA 1EX1A 1NDUA 1TMOA 4G9BA 4ZOLF 1WY7A 3KSAC 5JWHA 3PUVA 4HS9A 2HIHA 4KN8A 5FBQB 2RKOA 2XDQA 1QU3A 5IZCA 1A4XA 3WJAA 2NU9B 4Q9DA 4A8HA 2AN9A 1RHJA 2YQZA 3DVSX 5IKMA 3L0IB 2FH5B 2VP4A 3LSTA 5HGXA 1DARA 2EF1A 1XTRA 4BQPA 2TS1A 3E1GA 2GBLC 4N7BA 3C24A 3GRZA 1B41A 2ZSFA 3R0QA 4ZEXA 2DOKA 4AYTA 3O4HA 4EY6A 2VL7A 5U4XA 4ZOCA 4MRPA 3UF0A 4D0RA 4PGAA 5E1MA 2HM7A 4KIWA 3WQQA 2FP4B 2QSUA 1BFDA 3CN7A 3PD0A 5ESWA 2C7RA 1YS4A 3IBTA 4UNIA 5F3WB 1J33A 2JBHA 3LHSA 3NHSA 1UK7A 2F3RA 3GLGB 1T1GA 1I6LA 2AW5A 3VZPA 2V7VA 5CXUA 1XAHA 2QLFA 2IK8A 4EKEA 4G85A 4OXQA 2EGUA 3TRDA 1G21B 1Y4UA 4M76B 1NULA 4BNHA 4POOA 1NG9A 1PQYA 2J30A 3F90A 1GPBA 1T2VA 2KMLA 3HM2A 1GTMA 3LKZA 1H8EA 4UVHA 2ODNA 3E5HA 4C22A 5LKAA 1L7NA 1N2BA 3R3YA 1R6BX 4WNAA 2XT9A 4PV7A 1FQOA 4YHHB 1RM4A 5CVJA 1R8JA 5B4VA 5AVSA 4E5PA 1GADO 1MNAA 4IW3B 1W8IA 4RWEA 2BIFA 4B5LA 4GM4A 1M2NA 4D4IA 5C5EA 3HTXA 4KXNA 5I4KA 1THTA 3OIFA 4JOCA 4JXJA 3M9XA 4PO1A 5EZ5A 5DIZA 4I3HA 3HY4A 4O4LA 4WQMA 2JL1A 4ZPXA 3I3OA 1N6PA 1RPTA 1E58A 1U2GA 4IYRA 1F9AA 4JJZA 4PBSA 2C9CA 4X1YB 1I5EA 3DDOA 2DQ4A 4QDTA 3DQQA 5DH9A 5IBPA 4EHBA 4LYAA 5IFLA 2IW3A 5KDOA 2BMFA 4CR7A 1GAXA 2IWHA 1U65A 4HUQB 3WBBA 3M83A 1CERA 3CIOA 4MI3A 2Q27A 4RZXA 3C15C 4HN9A 3TH5A 1ZW1A 5C5IA 3LCVB 4TSFD 5BRJA 3ZDCA 3VBCA 1J56A 1S2GA 3DTVD 1P7YA 4KWIA 1NLMA 2D2FA 2HDOA 1WXDA 4JYCA 4LWOA 4RY2A 3KWFA 4BCCA 8ATCA 2B0JA 4U00A 1ADFA 1OVMA 4AO6A 4TS1A 3CUWA 2QORA 4K46A 3QX3A 3EQ2A 2Y3IA 5JADA 1L9KA 5EJAA 2Q3HA 2QVXX 4BNYA 2WM8A 2H54A 3DZJA 3IV9A 1ZA2A 4M38A 2DT5A 4NF2A 3VPDA 3NM6B 4R8KA 2RK4A 1R6AA 2VQDA 4F6RA 2W90A 4HPWA 2FFBA 3LP5A 4JFAA 1T5LA 1WD7A 3LT1A 3TQHA 1LBEA 4E5MA 1LQTA 1C8KA 1S5PA 4XCQA 1QCYA 3ED1A 4COKA 1L5NA 9ABPA 4AJPA 2PCLA 4ZO8A 4D3DA 4ALLA 5U1PA 5CD1A 3DO6A 2BGWA 2Y1XA 5E2BA 5CYGA 1QU2A 3REFA 1AGRA 4KXMA 4G56A 3IHTA 1EM6A 1ULHA 1SXJD 3GLVA 3DZIA 1M5UA 1VLJA 4GOMD 2I9KA 1XLVA 2YWFA 2B4AA 5K01A 4LEIA 4TWBA 2YFKA 4TV9B 1LW7A 2ATVA 2CMGA 3FKSA 3OSZA 3P0FA 4OAPA 4JUDX 1ZEMA 5FL7A 5F1OA 2XCQA 4JP8A 4MARA 1LC0A 3A9CA 1E3LA 4U5XA 3VZRA 1UJ5A 1L5SA 3NOXA 4IVRA 3N2EA 1EFHA 2BFNA 1WQ4A 1BDHA 5CM9C 3CUSA 1YNOA 2KW5A 2MMCA 2V74B 3Q8WA 2HWKA 4J7XA 1UK8A 2PV7A 4UUNA 4LMBA 4W7HA 3UT0A 3M1YA 4FYJA 2HA4A 1N5JA 1HZZC 5JFOA 4JEMA 3K09C 3CH5A 2BDTA 2FG7C 2VNKA 3MWJA 3RC7A 3PR3A 4F5YA 1CUEA 4CM9D 1R9MA 1UT5A 3HBMA 1NN3A 4XGQA 5FTWA 1PL6A 1X8LA 4C6HA 4AUNA 1M1XB 1CY0A 4RQTA 2IYYA 2UVPA 5EXSA 3WGYA 2ZWOA 2P9GA 4HGOA 2PUBA 5EMKA 3KYJB 2XF2A 3PI6A 4GX5A 5EKXA 3UM9A 3NEPX 1G3RA 2BFEB 3DNFA 4RUKA 3HDYA 3VNQA 1XDBA 3GUYA 3SEQA 2MOKA 4LVOA 3WQRA 1L4NA 4ZVQA 4JR1A 1R27A 3T5MA 1NTRA 2Y0BA 1LSSA 5FO1A 2RJ3A 3ZD9A 5JOQA 1AQJA 1R10A 2VJMB 3GT0A 4V1CB 2ODAA 3U1TA 4O02B 4B3TB 1PJSA 3LPDA 4IZHA 3CEJA 5JNLA 2OXEA 5IC4A 5D01A 1QGED 3SZMA 3NAMA 2VUIB 3I28A 5AJHA 2IGTA 3QUAA 3C3YA 3ZDFA 3IBSA 1XQ1A 2ILVA 3LPMA 3CTPA 5CW2A 5DHQA 1GZ5A 3NHPA 1TYDE 3FY4A 4M9QA 4ZQEA 5KQMA 1M74A 1I4WA 4O4JF 1DX4A 4F38A 5AFSA 3AI1A 2H2WA 2G83A 4IKOA 5CNJA 3RYHA 5ECGC 1Z6AA 2HRDA 2WNSA 4ECAA 4G1MB 2L69A 5H83A 2YL2A 1XXHE 4II7A 1NZJA 2GHIA 2HX1A 3I2GA 4R83A 5AMXA 1C5KA 3FDJA 4MWDA 1U0NA 1K5PA 2C31A 4ZMRA 3HU5A 1GQFA 1U31A 4LPKA 1JHAA 3P1JA 3FLEA 4LVUA 3QUBA 1Q19A 2R4UA 2ZIUB 3O1HB 4P3YA 1Z9BA 2AWOA 1TNDA 3H8JA 3TIIA 4MYCA 1ZXLA 2MSNA 3ET5A 3TVYA 2O5RA 2F3PA 4U2BA 1LDBA 1UBLS 2VTBA 1O77A 5B1SA 5L3QB 1N4DA 3KE9A 2HBRA 2PSSA 3HB7A 5JNSA 1H1TA 4HNSA 4OU5A 4W99A 4GKKB 1I8TA 4TLDA 2NV2B 4EA6A 1XK7A 3QTTA 5BR7A 5LP6F 4HB3A 5LP6A 1YA8A 3B53X 3DSRA 3UJAA 1YIOA 3IXLA 3NDJA 4IZIA 1FMJA 4U2FA 3ZDDA 1LRJA 4QU8A 5GJCA 5K0JA 3SVTA 1K8YB 4FFPA 3RW9A 5JAPA 3UXYA 1LTKA 5FA8A 4IEIA 4DQLA 4E1BA 5FI3A 1B1CA 3EEBA 3O26A 3N2GB 3SJUA 2IA5A 2VH5R 2VXOA 1E7MA 3DE0X 2BDEA 3OE5A 3OLQA 5BWMA 1BXRB 3AETA 1N3LA 2H6EA 3CRZA 3IMFA 1RWQA 3UFXB 4AJNA 2IS2A 1EIWA 1R6TA 2YIJA 1BQ3A 4IXWA 4PHFA 1EVJA 7GPBA 3D5EA 4EQ6A 2FN4A 3V7NA 3DP9A 1CUZA 1E0DA 2OZLA 2JB9A 3HLTA 1XMIA 3KXIA 3PC8C 5KQPA 2ZJAA 3WLIA 1W4AA 3VSCA 5ABPA 2VG8A 3SIPA 2EKDA 4WASA 4B84A 3TSZA 4AXBA 3LPLA 3ZHCA 1JIKA 4G5FA 2I4LA 3R5SA 4RAQA 1R0RE 5JLJA 3OIUA 1R6DA 2OLKA 2O2XA 4ENVA 3VC7A 1J2RA 1N6HA 5JCJA 2IE0A 5K3AA 4MQFB 3SJAA 1FB5A 1PG5A 3C5CA 4EG4A 5CAEA 2JGMA 3ZYCA 5A4AA 5K8IA 1TO2E 2XYRA 3GLQA 3DV0B 2FVXA 2BFWA 3WV4A 4YP9A 4E12A 4DC0A 2GHTA 5TEVA 2W6CX 2BZGA 2RE8A 2QQGA 3ZHUA 4GWLA 1TXGA 4QEKA 1DBPA 4XZ3A 1CR0A 5C8XA 3QYAA 3RKSA 3GRPA 2G5CA 4K26A 4LDNA 3TNYA 5K3OA 3JD0A 1T8YA 2PG3A 3FGNA 4K2AA 2O7SA 1W34A 3WICA 1JRLA 4C3ZA 2WWGA 3IVRA 4N12A 2B98A 1CUFA 4IDNA 1UF9A 5IH7A 3E48A 1X9GA 3ENVA 4LFBB 1QJ4A 5DX1A 1CW2B 1N2CB 4F4UA 3ZGVA 1XEWX 2JEOA 1ENOA 5LQMA 2VWHA 2O1XA 4L4SA 1YH3A 2BBWA 1UC8A 2OCYC 4OBXA 4ZOLA 5EESA 3T94A 1HSZA 2G0NA 5D2CA 4CTOA 4TTAA 4LI3X 1XFDA 4AN1A 3EZ9A 3KVRA 1TEHA 2FDRA 4DIFA 3G8CA 4HB2A 4UCFA 3TPZA 2WY2D 4GYYA 2WF6A 1XVLA 4NS4A 4RFLA 3HRHA 1NUUA 4FGZA 3DO5A 3FOAA 4HTAA 3WHIA 1WRBA 2OKGA 3WJ7A 2HHHB 1TYAE 4LF5B 3KOYA 1JT2A 1AURA 3W5JA 1NATA 2I55A 2IP1A 4BYGA 2IH5A 5FWAA 1O5TA 4OGWA 5HZKA 1U2TA 3U31A 1RHKA 4YRSA 2V7PA 2C99A 4A36A 2NU7A 2V5AA 1WF3A 1UK9A 1F0KA 3C7DB 3LZ6A 4PC2A 4RK4A 3O3OB 1H85A 3LX6A 2H1VA 3EIQA 5LQSA 3SLRA 3W8NA 4M8IA 2W6JA 2EKLA 2IUEA 4UXJA 3WAJA 1HDIA 2D4HA 1MX5A 2IOYA 4EEXA 1E3QA 3GDGA 1DNPA 1Q7CA 3F6SA 3FMGA 2CLHB 3H1GA 3OF5A 2XUOA 1Y4SA 1YS6A 2C4UA 4Q5IA 1Z4QA 3ND8A 4KBFA 4RIEA 4XQ0A 4Y7DA 5FTKA 3S28A 3X2EA 4LYFA 2AYZA 1MAVA 4QUKA 3EXIB 2XVXA 3F7OA 5CH8A 1OU0A 5K8LA 1YJCA 1I2MA 1K6XA 3FTNA 4JL5A 4EELA 4B2IA 1IQRA 2GNOA 4BLTA 2B8JA 2NWQA 3HNOA 2WTUA 1L4EA 2CLDX 2KE5A 3FFWA 3FB1A 3HHEA 4NZMA 4LZPA 4O4LF 5LLDA 1T34A 4FUTA 2B1QA 4GDMA 5FBLB 2OR3A 3DOIA 2YUTA 3I2JA 4NAHA 5F64A 2BKXA 2NGRA 3I1YA 3SE7A 4TTTS 3RT7A 3U2QA 3W4IA 1YKSA 1ZOLA 3DDUA 3M0EA 4AY4A 4Y1RB 3QVGA 4HGNA 4KO4S 4DABA 1E0KA 1FFEA 3PRJA 1OLOA 4RVNA 2E5LB 2FJ0A 4PNZA 4DQKA 1E7WA 4FIZA 1J21A 3MT8A 3O8OA 4QASA 4WZAA 4Q93A 3UJ9A 4F4HA 1F9EA 4B3JA 2CDCA 2I4RA 5EUBA 4IH4A 2Q5CA 1OBFO 4LBVA 3ZHBA 3D8SA 3JQ9A 3SGLA 2ODBA 2PZFA 2RBKA 3L0DA 2PZJA 2UAGA 3AEKA 3OHPA 6CHYA 4OQLA 1HZJA 2Q9CA 4Q4HA 1FMLA 2VDUE 3V2GA 2VA8A 3CJRA 4GGPA 2ERCA 1IN5A 2QMOA 3FLBA 3Q2OA 1SUFA 2X1LA 1Y6QA 4V2IA 1Z0AA 3AR8A 2CHFA 3N2KA 2IODA 2LE0A 3I1FA 3RNOA 1P2SA 1RIFA 1I24A 1O9HA 2PZEA 1E79A 2EKZA 2KQUA 1Q0SA 4WTOA 3YASA 3ZLBA 3HYRA 3O93A 1I1HA 3DAGA 3SEFA 2G1JA 2BW0A 4YMGA 1YMQA 4XWAA 5I8PA 4NE9A 1GNRA 3WNZA 3CN9A 2YVLA 3OU7A 1QHFA 2QP4A 5CDUA 1H2AS 3H84A 3PENA 3ZQUA 3AUTA 1BYIA 2EBWA 4HO1X 1L7AA 2APJA 1J07A 5KCMA 1QGUB 3AFNA 4KN6A 4UC0A 4HJRA 2HA0A 5HFNA 1OXVA 2COKA 3EDYA 1XRMA 3L1KA 4TV9A 5K3CA 4C6TB 4DNFA 4CLRA 4DIBA 2VJDA 1II9A 3KP1A 1XZAA 4EFKA 4BEVA 1K3UB 4NV1A 4HLUA 2F62A 3EY4A 4EGCB 2DC1A 2KI5A 3L82B 2WKQA 4Y9RA 1H8HD 5ELXA 3L0PA 2P6UA 4OBBA 1XZNA 1NMXA 1XTTA 3FYTA 1SUAA 4J0EA 3S2FA 4JODA 4S1NA 2UVQA 3K2QA 4JQCA 3K70B 1YR1A 1PZXA 1S9DA 2QT0A 3QIAA 4Z4GA 3W2TA 4XWYA 1I0LA 3VI3B 3CX8A 3S8EA 4CMEC 1R1DA 4MV4A 2W2QA 3FMOB 4F71A 5CYPA 2WJZB 2ZWMA 5AT1A 2XE8A 4GD3Q 4EDHA 4Z1MA 5JY1A 1V8FA 2FNAA 2QIOA 4LJ9A 4MXDA 5IVIA 1VSUA 3DZBA 1T24A 2R6JA 1XZQA 2Q8QA 3AEUA 4RHCA 4TMXA 3LD9A 4D42A 1G3IA 5ELLA 5IPFA 3Q7EA 1USUA 3GNQA 4PPNA 2WINI 3P7MA 4A23A 5JBQA 4E5VA 3G0GA 2PY6A 5AVQA 1E0AA 1XKTA 1YRBA 2YS7A 4PFQA 2AR7A 4QE3A 1E64A 2RJOA 3E61A 1DBQA 3G7SA 1ZNQO 3NU1A 4R0MA 5JYBA 5ALRA 3ZXUB 2WHPB 1W4LA 4FCVA 1H22A 1FCJA 4O2RA 4OB7A 3WMRA 3EAQA 1G19A 4AMUA 2LBPA 4E46A 2WOJA 2VQFB 1AKRA 4MR9B 3CYFA 4CMIA 4KI7A 1U1DA 1VBKA 1YQQA 3BCHA 3QUCA 4KJXA 2FEWB 4PNPA 2OGUA 4QXOA 4WKCA 5KPJA 1KMQA 4B73A 2BFFB 4UTXA 2EJUA 1Y4DE 3L79A 3OUZA 3TD6A 5KKCA 2VWQA 3GYGA 2OK8A 1GTZA 3FKQA 1R5NA 3QVLA 1N3IA 2VP9A 2O6LA 4A6DA 2IWRA 2DU8A 4FMDB 2VHTA 2W5UA 3D2LA 3QG1A 1D07A 2HPHA 3SJZA 4BU0A 4EHNA 521PA 5BN1A 5AUPB 4R3NA 2W9XA 3LBIA 1CUAA 2BI4A 3B9QA 4K6FA 4BRUA 1DADA 3HLKA 1MOPA 2CUKA 1UZAA 4JVSB 3GCZA 1IMOA 4EI2A 1N92A 5JO0A 1O96B 4M0DA 3EMBA 4AUKA 1SBCA 3G68A 3A11A 3WR5A 4DDUA 1U3VA 2HV9A 3LQ1A 1PFVA 3ET4A 3GC6A 3ZDAA 3T3OA 1HC7A 3DYIA 1X8XA 2PKYX 3OFNA 3VC3A 2XTJA 3OT4A 1GZ7A 2E4YA 1Z38A 3G2LA 1USKA 4Q7KA 4LTNA 5AW7A 2QYSA 3WSWA 4CIDA 1A8UA 4ME6A 2WB4A 4EUHA 2R8BA 1VMDA 3FUUA 3WC4A 4DLSA 2XT0A 4RK7A 5IYZA 3DLIA 4W1RA 1WDKA 4G2NA 4H4EA 1L0BA 4AAYA 3HDQA 4JX9A 4CLHA 1Y8AA 3TLBA 1SUCA 2O59A 4G8DA 3DCJA 1SQGA 3PDHA 3JALA 3RSZA 1I4DD 3I9LA 3M3HA 4ZCPA 3QKRA 2BSAA 2IXTA 2RC6A 4PSDA 2WJYA 4V0OA 4YCJA 5AYVA 1ILEA 2O8FA 2XDQB 1G7TA 1XCPA 4W5NA 1QAOA 1OVGA 4QD3A 5LQKA 3K3PA 4R2MA 2COUA 4IFIA 4N0DA 5F21A 5TJ9A 3T3MB 3N0VA 3I2YX 5NULA 3KZVA 4AJHA 4J1TC 2QD3A 1SKUA 4EFDA 1VCMA 2JGLA 2JRCA 4NBLA 2R0QC 2OFXA 1J06A 2QLMA 1QH9A 3CWZA 4IDOA 4H7JA 4XASA 1DXOA 3MCUA 3TQSA 2ZWVA 2C07A 3PPYA 4MRMA 4BBPA 2CDAA 2HIAA 3NKLA 4IZOA 4OK6A 5EP2A 2IU4A 2X7XA 4MUYA 3C3PA 2BR5A 4LTDA 1CYDA 5HHTA 5D3ZA 2ECPA 4OB6A 3JZAA 4BBJA 1PR4A 5EWJB 5ISMA 1K3TA 4NFYA 5FUVA 2V7QA 1RM3A 2HRBA 4CDNA 3TGLA 2EQBA 2Q2QA 2XHZA 3PK0A 3CM0A 3GJ3A 3QPDA 1F12A 1M34E 4GF5A 4OLHA 5FWNA 4IH1A 2VC2B 1HDGO 1GR0A 3A1NA 3TAUA 4BJ3A 5A0VA 2CLMB 2HPVA 1OBCA 1ZGJA 3JRNA 1BW9B 4GQBA 2CJFA 3KUXA 2QKYA 4UQOA 2OB1A 2IW1A 2R66A 4X6XA 4RTLA 3UMBA 4G0WA 2RI0A 2C98A 4MJXA 1K9VF 1OLUA 1XMVA 2I6TA 2VH2A 1YQXA 2PQ0A 3KOOA 2EERA 1L7XA 4D4GA 3DT8A 5TR9A 621PA 1UIMA 2A9PA 1M1YA 1UWVA 2G8LA 1GZ3A 1NUAA 2Q3BA 3P9CA 4OXNA 4M6WA 3B13B 3Q88A 3T15A 5BN3A 5J4VA 4DMHA 2FRDC 4RHTA 1QMPA 1UEIA 4KITB 2GCNA 2WFAA 3UUFA 1R4ZA 1U4NA 3QF4A 1XZIA 3THRA 1XF1A 1NQOA 2XWSA 4DSTA 1KEVA 3CMCO 2X5OA 1K92A 1ACLA 1KYZA 3AEZA 4CLDA 1DC3A 2PSDA 1M7BA 1ONPA 1Y34E 2J31A 3FRIA 3NV7A 1N9GA 3D8TA 3VKFA 2JANA 1X80B 2G67A 3P2JA 2FMUA 1I32A 3PHJA 1LPNA 3ROPA 1VBMA 4HRYA 1CT9A 4GUDA 1JSRA 3GF4A 4WEOA 4CCYB 2MHCA 1P1CA 3P2KA 2KYRA 3BG5A 3W79A 1QIKA 4A0GA 1T26A 3H9QA 3DXZA 4GOLD 4EI8A 1TYBE 1J49A 1I2DA 2H3EA 3BRWA 1BXKA 3UUEA 3OA0A 3TXYA 4JELA 1PJBA 3L7MA 1L5LA 3BB1A 2J5KA 3QA3E 1DC5A 3VPBA 2IIVA 4BNKA 1WDMA 5HIAA 1RC0A 2GA8A 3NMUF 2XBMA 1WVGA 1N1MA 5KJEA 5AUOB 1L7BA 1C0IA 5GP1A 3UZUA 4UDXX 1EGMB 2ZI6A 4CDRA 5A9TA 1WPXA 2E37A 3PWKA 1EMDA 4NONA 3SU8A 4RTRA 2CUTA 3QE9Y 1NE2A 3CVJA 4WSOA 2JVJA 1CJKC 2VHYA 2WWVD 3P4XA 2HRZA 5BOSA 2QDKA 3HKCB 2RMKA 4MS1A 1YOVA 2EWVA 4L8VA 1JV2B 3GLSA 2ZDHA 5LN1A 2AOVA 3GJ4A 4BNVA 4QDXA 2AFVA 3OCZA 1WETA 4FLEA 1HPLA 2M2IA 3AF3A 5LCXA 3U0VA 1EG7A 2WIGA 2Z8YA 1L1FA 3STWA 1OU4A 3B9PA 4J1TA 1XZKA 3SDZA 1KDOA 1FBNA 1QX4A 4KR7A 4XGRA 1IH8A 3OI7A 4FVTA 3D64A 2GCPA 1YS7A 5E9JA 3WYGA 4X1YA 4LZNA 1TQ4A 4AJ1A 3PI7A 4K28A 5AVJA 3UB2A 2ST1A 1GKIA 4ZO7A 4RDXA 3R5FA 2Y77A 3GFQA 3ZV4A 2H9YA 1T3TA 3EZ2A 4C87A 2GPAA 1BDIA 3D3WA 3GLKA 1XTIA 4C2TA 4G5YA 1ZIDA 1NN1A 3PXBA 2XZLA 1Q0ZA 4IIHA 3IDZA 1BJKA 1BEZA 2W2LA 1RWKA 1Z07A 4KSBA 1E2LA 1EA7A 3KU1A 3IJEB 4ZANA 2YH2A 4KVFA 4AS3A 4ZAYA 4Y6RA 3RVSA 4LDRA 2JPDA 2RI6A 2KJQA 4E21A 1YK1A 5CFRA 4I1PA 3HPQA 3RRFA 1W2GA 2VDOB 4FP9A 1RI5A 3PQ7A 1W93A 1TQ6A 1MXHA 2Z08A 3TO5A 4CEIB 5EGSA 5EQDA 3KLPX 1KIFA 2GZSA 2Y1EA 1WZUA 3RVDA 3VJKA 5ED4A 3O82A 3C45A 4GGMX 4NIMA 1WJGA 4J0JA 1LPPA 3A9RA 5MN6A 3DBRB 3NBAA 4QBHA 1DG1G 4CKCB 5T4BA 2AFIE 4X7RA 4K2HA 3K0EA 4ZVNA 1C1XB 5KNBD 3F5DA 1H0KA 2IXEA 1P6XA 5YASA 2NPOA 5CA0F 1A3CA 3C48A 2GM4A 4QTTB 4LF4B 3LUHA 2W00A 2X0NA 2G09A 4DLNA 1XE3A 3W77A 2XI4A 1R3UA 1QRAA 4LAFA 4LJ6A 1CEEA 1SOUA 1E1NA 2C4MA 3LUPA 3RIHA 3SWWA 2IYTA 2WNHA 1XDWA 4PIPA 4B3RB 4UMVA 3SCZA 2QL5A 1Z6QA 1UADA 3FPGA 1U0EA 2H51A 2DM6A 2Z30A 3IQIX 3N8IA 2A3NA 4HLQB 4YJHB 3WQHA 1EP1B 1NP3A 1OCEA 3HBJA 3QENA 4MTCA 4J4BA 4OQEA 4C4SA 4EBFA 3WSTA 3MBOA 2QLTA 1JHDA 2ZKIA 3BERA 3DEJA 4BC1A 1Z4NA 4RKRA 2XMGA 4UM8B 1J09A 1FJGB 2LTAA 3BAZA 3EQ6A 3PNLA 3IUMA 1EDOA 1B3RA 4V0ME 2A5DA 1OE0A 1ISFA 2OMKA 3FCCA 4XJTA 1JPNA 4QFMA 3NFRA 3UBMA 1TW3A 3LP6A 1O5OA 1T29A 1FSZA 2IYZA 5FX2A 1TZ2A 1ZUNA 5HILA 1Y63A 5K6RA 2FQ1A 4I6GA 1N0IA 3I04M 1P2VA 2P11A 4R9RA 2PH7A 3C3CA 3RUIA 1IB6A 1YQWA 1QPZA 1ZM3A 4EVIA 1LFDB 4CNBA 3TQFA 1KH3A 2XR1A 2CT8A 1OPXA 1EM8A 1TM2A 4WCFA 4CKBA 1N4AA 5J4KA 1LV7A 5IT0A 4F4FA 1J24A 3T8YA 4Q9NA 4BVAA 3BGVA 4RL4A 3MOSA 4PAOA 1Q7GA 4UU7A 5HXAA 1HFWA 1GGVA 2HBZA 2I2WA 2I7VA 3I73A 3VU3A 6REQA 3EH1A 4Q4CA 4CL8A 3MGKA 4XVRA 4EFLA 5HOQA 5FR2A 1A8IA 1JHQA 1N1EA 1ULBA 4UNSA 5FV7A 4G5QA 2FEOA 1HRKA 2HPAA 4GMHA 3FNRA 1UEXC 1T8TA 3JPWA 4OHXA 2XV1A 5B6JA 1O97C 3FNHA 2XJ4A 2NO4A 2J67A 4F93B 4JVNA 1AB5A 4EUNA 3NO4A 4WOJA 3GPDG 2QTWB 2HJVA 4NULA 4U7TB 2G9NA 1XGKA 1G41A 3VYRB 2I65A 4ZDJA 4UZSA 4LF8B 3AOGA 1SCUA 1ZRHA 3UWSA 5EJMA 4ZQBA 5A5GA 1ZVKA 2CL5A 1IEXA 1Q0PA 4YLGA 1MRSA 2H8KA 4ZI7A 5L3SB 3KELA 4MS4B 5F9HA 3OU6A 1CQJA 2X58A 1PP4A 2O57A 4CL2A 1I5OA 3BIWA 4A2WA 5L3SA 2IZ1A 1UXIA 2B78A 1RCUA 3P9NA 2QROA 1DJLA 3A58B 5HJ2A 4ASUA 4H1TA 5J2UF 4EH1A 4AUMA 2VNAA 2CNOA 4YRNA 4RTJA 4I7EA 2UKDA 5HFAA 4E08A 2QRNA 2QUAA 3PGLA 3G8DA 5JI2E 4J1QA 3FI9A 4U8GA 1NW5A 3FBTA 3R4VA 4KE8A 5EHNA 5G0UA 1T0PA 1ZR4A 4EHFA 3SNKA 3L1JA 5KWIA 1KK0A 3OP4A 5DE3A 1C9NA 2HK8A 3DEYX 3SFTA 3HR8A 4RVGA 1PT9A 5FULA 1QIJA 1KJYA 4YIHA 5FPHA 4P4GA 1NLZA 2FUG1 3K4HA 4W9MC 3FCAA 1T9BA 3ITDA 3R6DA 3AUKA 1OPRA 1SCJA 5I7HA 2NOAA 3PKIA 3T7DA 4I9NA 4W8HA 3JYOA 3WSVA 4ZYWA 4YX9A 5B7PA 1O87A 2NO5A 4RK5A 2IXFA 5JANA 4Z51A 3T4PA 3EFHA 5DM70 5KNCA 4QQFA 1ZJZA 2AQKA 1SRRA 2GSWA 3EA0A 4URYR 2IPAB 4FUQA 4R1SA 3W5IA 3N05A 4C0HA 1AKMA 1EJ0A 2C77A 5DZSA 3L6EA 4IJ6A 3UQYS 2EFHB 1XVVA 3UPTA 1E2FA 1MDFA 1E2MA 1TMGE 3ENNA 1P9NA 3FCSB 4TTSA 1IE3A 1I7DA 1K88A 1Y98A 3HDTA 5A5EA 3MB5A 2DAPA 5BN5B 4IWXA 4NZYA 2PQ2A 5SYMA 1ZUHA 2RGCA 3I9JA 4FWBA 3ILYA 2DPMA 5HDQA 1J99A 1QR2A 1XNJA 3MCWA 1E62A 3TGWA 5BYJA 1TAHA 3E9QA 4H3SA 5H16A 2R47A 3CPSA 2J48A 4MSUA 1OASA 4IDDA 3VDNB 1T2UA 4MVJH 4TT3D 4V24A 4Q24A 7REQA 1P1JA 2GN4A 2I34A 2WV9A 1K8QA 4OHCA 4ZOEA 5FH9A 1AA6A 5HNKA 1Z3IX 2XMDA 3N3AC 3ZQJA 3D6NB 4MKFA 1MTZA 1T0IA 4B76A 2NLOA 3QKTA 2Q5HA 1R15A 2VDPB 4EYQA 2A6PA 2VFAA 5AVVA 5HRAA 2WA1A 4GNRA 1KJZA 2N42A 1VMAA 4FINA 5DBEX 3B60A 5DCYA 2P9JA 3BWMA 4IR7A 1OFHA 3T61A 1JFFA 2IUFA 3GLHE 4BBZA 4GEKA 4CQMD 1VL8A 2FRXA 3DC7A 5AVWA 4TKVB 5CYFA 2NMVA 3GRRA 1D2EA 1H42A 4TWIA 4X91A 5KX5B 3CLSD 4ZT3A 5E3HA 4ZK2A 2I76A 4RTKA 1GZHB 1R64A 3GL9A 1YA6A 3P9RA 5ESXA 3Q8MA 4XPIB 1NPDA 1OBHA 1L7DA 4TN5A 2WI8A 4JFRA 4BKOA 1AJEA 2P77A 3LDUA 5BUZA 3EG9A 4EBBA 1TGYA 1RYMA 2WPDA 2F00A 1JBQA 1NSTA 2OLEA 3JTEA 4U5QA 5BRNA 1ZVQA 2VPPA 2EFGA 3TFWA 2D54A 3DDNA 5BVHB 3LM8A 2P30A 1EDBA 3MUNA 1QZZA 5EQTA 5G40A 4DLKA 3QE0A 1OXMA 4UM7A 1Z7YA 3DCNA 3KQTA 2O7VA 1YZHA 3CCCA 2CF5A 1K7YA 1L3BA 5L3QA 1J42A 2DUNA 4LVCA 3SC6A 3A7EA 1PDWA 3AR4A 2XNHA 3QV2A 1MG5A 4ZVLA 5JT1A 1KWKA 2ZYVX 3TPCA 3ZYZA 2FU5C 1JS1X 2VPQA 3UQZA 1PR9A 4KQEA 1CZHA 2XQGA 4OSEA 1WULS 3ASYA 1ZWLA 1STOA 4O59O 3KXKA 4MV8A 1XHLA 4HWGA 5HCNA 1W48A 1YFJA 1DKLA 2HHAA 5BSKA 4R1OA 3R7DA 3G79A 5KYYB 3PHGA 1E61A 1JXMA 3C4QA 2PZLA 4R51A 4Z4EA 1GR1A 1S6YA 1TKRA 1E3WA 1SUBA 3P26A 1TJ5A 4NCXA 3H5TA 3C14C 1ML3A 1CUVA 4BRZA 4C5CA 5IWAB 2Q7XA 2R65A 4ZA2A 4ZU6X 1GL7A 3USZA 2IBSA 1AH2A 5L3ZA 2P8JA 2G88A 3ECSA 4P4SB 4Y3UA 1XRSB 3EFOB 4MV3A 5HIJA 2WYUA 1NBMA 3KT0A 1RWOA 1E5TA 3QUTA 1V4VA 4KDCA 4QDZA 3GRYA 5EJ7A 2D1RA 1RMTA 3HKBA 4YONB 2C8KA 1HNNA 4DLZA 3WWPA 5A06A 4JYZA 1RYNA 1K68A 3S5JA 3IAHA 2NYVA 4PRZA 5BXQC 2W8BB 1TQHA 2Z8XA 1AQYA 2X3YA 1JU4A 2H5LA 2IZ7A 4L8WB 4YFYA 3UHJA 2SKEA 5BUQA 5K8TA 4HGPA 2WJ6A 2OAP1 3GT4A 3LXUX 4GOOD 1BWPA 2GYUA 3AHJA 3DNMA 1RAAA 2GZ1A 4FEGA 4ZU3A 1K7XB 5BV0A 1W85A 1E3JA 1BU8A 1G0OA 2R6HA 1T5DX 2WD7B 3WO0A 2EX0A 2XDYA 1TYCA 3QV1A 2XQIA 4YRIA 2WP0A 3D02A 3QNUA 2ZXFA 3OZCA 3QW4B 4BLWA 1VJCA 1YJQA 5TV2A 1HV8A 3BKWA 4R54A 4B40A 2ZK7A 1PN3A 2IXAA 1G8GA 2O0LA 5BORA 1D5CA 2Z57A 1TUBA 5C1DA 4TYYA 5HUHA 2F4NA 2N0SA 2QJRA 4KFUA 4PINA 2IY7A 1R0WA 4EHIA 4EW2A 4IRUB 4DUZB 2Y1FA 3KFLA 1BX1A 1OA0A 3ZE7A 2ZVQX 3H2KA 3HCAA 2DTXA 3N59A 1SC4A 3HCOA 5B55A 3EODA 2G25A 4PLYA 2HR1A 1FYWA 3WRXC 3IR7A 4YRAA 2QPTA 1JDZA 3VYUB 3RI3A 5I7SA 1V16B 4XQ9A 1Z82A 4F0JA 4UHJA 4S05A 1RYYA 3GVXA 2VVTA 5IXJA 2SECE 1MO2A 3EDMA 1WXIA 2ZE6A 4MP3A 4CEHB 2PRSA 4O1MA 1R0XA 2HLDA 2PWBA 1RXSA 4JB8A 2QS9A 2UZAA 4IM7A 1O89A 2OKCA 2VO1A 2W6OA 3L4BA 2ASEA 2VJBA 5DTMA 4EYSA 4HX5A 2OCPA 4ZOQI 4ALIA 2OCAA 2ONZA 2Y0CA 3AFHA 3WLTA 4XXHA 4GG1A 1LSOA 4PZZA 3TRJA 4Z1OA 1L5MA 1KSFX 1SJ9A 4ZKEA 5FAXA 4EW1A 1P60A 2VKQA 3A37A 4WI1A 1OW3B 5HRCA 1UM8A 1ZGHA 2GF0A 3RG2A 2VDWB 4HDOB 4PWYA 3KWLA 4QPPA 3IR5A 5E4FA 2UZ1A 4RTQA 1SUPA 2ZEJA 4HNQA 1TVCA 1P75A 3V3KA 3AVPA 1I0IA 1YMVA 3ZH9B 2QX9A 4DUGA 1HL7A 2H1WA 5DWQA 2X6QA 1S3SA 3KZKA 4MGEA 1QIHA 3M6UA 1OIWA 4QYWA 3ZCVA 1G291 1RCFA 2PYDA 2ZAYA 4HNVA 3M1AA 2HI0A 1XZJA 5FUWA 1F14A 4JJ7A 3PB3A 2PT5A 2PSEA 4K9MA 4ZCSA 2VT2A 4Q3KA 4BNUA 5BW8A 4H0FA 5I8ZA 1MEJA 3OZVA 2EJBA 3CLUC 5HYVA 1JJFA 4HYEA 1RAFA 1KMHB 1M83A 4RD1A 5I7FA 4O6VA 2QRPA 2OZKA 2QL6A 2Y6VA 3B3AA 3LK6A 1Y3BE 2ZRHA 4QODA 5EIOA 4G5OA 1TZCA 2X0DA 1ULTA 1V8DA 4UZFA 4ZKDA 1IU9A 3L7AA 2PZ8A 2AKEA 1SB8A 5IVKA 3BL8A 1SIWA 3DE7X 3CFYA 4MW5A 1YB1A 1M8PA 1Z2PX 2YBDA 3S2UA 4ER6A 1QHNA 3GRKA 4DCNA 4EMUA 4MQ5A 1HE2A 1AVTA 2IYRA 1JHXA 3K94A 4R2XA 4X8MA 5ALWA 4A8JB 2GEFA 2NUTB 2FZVA 4AS1A 1SCQA 4A4DA 3A9WA 2I2DA 3P52A 3UAVA 4RJTA 1JIVA 3H2IA 1RJ9B 3L84A 3FZEA 3O75A 2GHRA 4M9CA 4ZQGA 4WNAB 1GKKA 2BZ1A 4DRXA 2BJHA 3FYUB 3L8CA 2PWYA 3Q7TA 4ER7A 1EUYA 3B8HA 4C0QC 2R6AA 3SZRA 2HPZA 2Q0QA 2EJWA 3K8QA 3LUFA 1I3NA 3LVFO 2QUHA 5DEOA 4PGGA 3PFBA 2PL9A 4ARZB 5IAJA 1DHRA 3BICA 1EVEA 2UYYA 1ZIYA 3MSXA 4B1FA 1KEEA 4LY3A 4Q3OA 3TOCA 3TRHA 3SKVA 2JJ1D 1KIAA 1JR4A 3PXAA 2YXBA 4RLFA 4MVJA 4HLNA 4YYZA 1TT7A 5L7WA 1TTQB 1IONA 1G20B 1CEQA 1VGVA 3R7AA 4AF6A 4B31A 4G0PA 1IN6A 1BHQ1 3VR5D 4DLXA 2Q3FA 3ZWQA 4RJIA 1VYUA 3EQ8A 4G81A 4WXRA 3SXJA 5KYXB 2JCGA 3RHZA 1GXSA 1XX6A 1JDVA 1L1RA 2J46A 4JA0A 5SYAA 3SF0A 2AB0A 3CH4B 3AH8A 2DUUA 3D2BA 1HYQA 4FLFA 4I4NA 3GEHA 5CH5A 3TX6A 2H1CA 2IDMA 4QOSA 3L4SO 4RHYA 4BLPA 5IMBA 2QQEA 4IMRA 1OB5A 1P1IA 1UMDB 1BDBA 3WB9A 4CUZA 1IDOA 1NMSA 3KC2A 4R1MA 5DU2A 5DYIA 2RH4A 3TB6A 4K9PA 3RVQA 1JLRA 3OAAD 2B7LA 5IP5A 4YPFA 2P41A 1HDOA 3JQAD 1F0NA 1U9ZA 2W2KB 1JJIA 5B7QA 1DRKA 5FOVA 2EKBA 1K4KA 2PGIA 3RSLA 1TK9A 3TMKA 4LE1A 4UVGA 4TXMA 3AF6A 1ACJA 1NY5A 4JLSA 4I5FA 1V9SA 5DLYA 2K4MA 1Y7HA 4I4LA 4F2WA 1VIVA 4PZUA 1UMCA 4G0QA 1PFWA 3FCXA 4ZVUA 4MJLA 2ZG6A 2D2XA 3BVPA 5DM2A 3U81A 3RC8A 1NC3A 3FVRA 4X71A 3UXHA 3AEUB 3G85A 2C59A 1KO4A 2OSBA 3O2JA 3QBJA 4KRXA 3F97A 2QI9C 4MAAA 4D3ZA 5JSFA 2VP2A 4PLZA 3EXAA 5ALOA 2JAQA 2R7NA 4OUDA 3Q1LA 4M1OA 1TCVA 5JLAA 2EXXA 1GOTA 3V1YA 4EGQA 1ENZA 4IJQA 1DAHA 5LZ2A 2QVYX 1DLJA 1XTVA 3LYAA 4LY9A 4KQWA 1VYTA 3ZNNA 2QMYA 1TZBA 1Y5NA 2Z3VA 1CUIA 2O54A 5DNEA 1CDDA 2WIAA 3BSFA 5ADHA 1U8AA 3R9XA 1JBEA 1EQUA 5C8YF 3NAZA 2NP7A 3VU1A 1E2DA 2NTYC 3IQZA 1KDYA 1NW3A 3WDKA 3ETJA 1X38A 3HXPA 4PLGA 3V2IA 2V3WA 1GNSA 5FOQA 5KOYA 1QAMA 1WCWA 5KWVA 2C2HA 3UOAB 3RFTA 3TKAA 2GILA 1UCFA 2HGSA 1SQSA 1YBFA 2XMQA 4CMCA 3BREA 1ORRA 3N2YA 4MMYB 5G4KA 4CIXA 4HK4A 4W8OA 4G37A 5CPFA 4ZZIA 1QK5A 2AI3A 4P2GA 1WF6A 4PZPA 2RKBA 4R8LA 4GP6A 1W36D 5AI5A 3K0HA 3EHDA 1P0PA 3IOCA 4J03A 1QOQB 1IWBB 3BMXA 1E63A 3ZVMA 2VT7A 4O5AA 1GQSA 1G16A 2YNMA 1V3UA 1EP3B 4C0BA 2CV1A 2W42A 2VP5A 3C39A 1OXKB 3AEQB 2WPDD 4EMSA 3D8BA 3FVWA 1CRQA 4URWR 5TMDA 3TOSA 3ANXA 1C3OA 4JLMA 3HXOA 4P7KA 3KZCA 3TSWA 2ZIXB 5FPPA 4ZXFA 3U26A 4C7OB 1B74A 3ZE1B 1WABA 3H4TA 4GVXA 4RY0A 4W1PA 4HDCA 2P5SA 3A3NA 1T4BA 5ARDA 5EEGA 4C7MA 3H11B 4ZZ3A 2OENG 5HUQA 1MNQA 4YJ2A 3ZUPA 4MCHA 4EHKA 3A6ZA 5TQ0A 2PEYA 3ZWPA 4LOIA 5GVSA 2GSDA 1Y80A 1JXOA 4UBNA 4CF3A 3RVRA 4CGZA 4NXMB 1ZU4A 2QV0A 1BDMA 5HG0A 1R3DA 3V33A 1RE0A 2YYSA 1VPVA 3UMSA 3BD9A 3O2SB 13PKA 2CSUA 1N2EA 1X94A 2ID8A 4LWZA 5EJ6A 3IUNA 1DGQA 3EQ7A 3CNHA 5ALQA 1AKNA 3FKJA 1HFJA 3LIIA 1B8VA 3O8OB 4WZAB 2V7TA 1TMKA 1POWA 4RPJA 1CQWA 3CPEA 4P6VF 2ZUBA 5IUKC 3P0EA 1N2CE 1AQ6A 3U7IA 3JV7A 4LMPA 3QVKA 1ZKDA 3MUOA 1SAYA 2JFQA 3OIYA 4UTNA 5JU6A 3FFBA 1QHHB 2XY4A 4DMMA 1HRDA 3BWXA 4KVAA 5JYDA 2HIGA 2XCTB 1S2MA 2PO7A 1ZH6A 2JHPA 3F9IA 4EPWA 4CMKA 3ZDBA 1GRNA 1OH7A 1RLUA 1VDMA 2WHXA 2Y99A 4UHDA 3NTQA 4DF3A 3QKSA 3NONA 4XSVA 4XWKA 2HK7A 3HV2A 2IFTA 4A26A 3N8DA 5LMZA 3TZKA 3K9FC 4G67A 3AXTA 3FR7A 2NZXA 4P3KA 3EZGA 4MW2A 1TQ8A 1K5DA 1L4KA 2WIDA 3P71T 3OPNA 2EW8A 3ZQ6A 3C6XA 3UAXA 1E8MA 1JZSA 3LBHA 2YOGA 4JCCA 3OUTA 4O4IA 1Q11A 4Q3BA 3QELB 1TVMA 1L8AA 5HMLA 5KOIA 1XDSA 2GD1O 3BZUA 3HVJA 2A78A 1KBQA 4A0SA 4DL9A 5L95A 5ADWA 5DLDA 2Q3MA 1MUUA 2IPXA 1BFKA 5B12A 7ABPA 2QPOA 3QHAA 4UTPA 5KSYA 1N7IA 4XVCA 3DB1A 3CSDA 3EBOA 3HA2A 4L8LA 4EHJA 1A4IA 3KR0A 5FA5A 5LJIA 3E1KA 2IEBA 5E4TA 3MUFA 4UHHA 3FYDA 4M1WA 3LBYA 2BLNA 1E9RA 1ZG3A 4YB8A 1N5MA 3TSAA 2PT7A 2CYCA 1RHQA 1GT6A 1F8XA 1W0CA 3BN3A 4B33A 4YV2A 1QGZA 5ELMA 2QOEA 1O95D 4RA6A 4EJSA 2GEVA 3F4LA 3LX8A 1DT5A 4NPAA 1FSSA 3PFWO 3U7HB 3ND5A 4LCJA 4L9WA 2XQFA 4WBNA 3U3JA 1OF1A 2VPZA 2J3QA 3KJQA 4QZVA 3SSNA 3AM4A 1PJTA 5C1OA 4M0CA 1NLFA 4YJ3F 3L6UA 1USVA 4MPRA 4DNOA 3F2IA 7MDHA 1D04A 1SOMA 4QELA 3ZHQA 1EQ2A 1UWKA 2YDYA 1FS6A 3ESXA 4RGVA 3PF9A 2YW2A 3THXA 1VKRA 4F04A 3HJCA 4GC9A 2C2ZA 3AP1A 1LJ8A 1YA4A 3R7WB 3DZGA 2BTOA 1X9IA 1MO3A 2H4WA 2HCRA 4J7CA 4FONA 4UBKA 3TLAA 5BRAA 1RLMA 1SIOA 1NTOA 2I8CA 1W4ZA 5GWXA 4ENUA 1SIBE 5CT5A 2JJ2A 5J1SB 4ZDKA 3O38A 4UASA 4EKNB 1EWKA 1ESDA 1L7QA 3NWPA 5JAZA 5GONB 1M2JA 2WSBA 2VSOA 2P4HX 3NANA 4PX2A 3TXAA 3MAJA 2IPOA 2R7MA 5CRIA 4MAMA 4TRMA 5AHOA 2MSCB 2G5PA 2X76A 2ZWPA 1C9KA 1QC5B 1UJ2A 3ROXA 3ED5A 3SNHA 3FA2A 1QC5A 4YP1A 1KY2A 1VZ2A 3B9RA 2OVBA 2Q3JA 2IKSA 3G13A 1VIYA 1Y48E 3ETDA 4HX2A 1XELA 2HU2A 3DEFA 3F98A 3S2IA 1GPNA 1J0AA 1P0FA 2Z6QA 5GOTA 5GJBA 5F33A 5D87A 4WZ6A 1DQRA 1GFSA 2JIBA 3KQOA 3OOEA 4MH0R 2OQIA 4WGGA 2V97A 3RVBA 4BZWA 3PXDA 1NVKA 2ZBQA 1PFQA 4EB3A 3O21A 1BVUA 3N39C 2ZRCA 4O2AB 3N0WA 2CBXA 5K8UA 4CDMA 3AB8A 3F73A 4HAWA 1KVSA 3SJ7A 3SDSA 1PLLA 4X20B 3RS4A 4D56A 5JAOA 4YCMA 4IG4A 2I62A 2JFBA 3KYDA 3H9CA 3N1UA 5KIAA 1QUFA 4HN4B 5A03A 2XYGA 4AZSA 3CNOA 1I4OA 1XDDA 3RK1A 3WGZA 1XEXB 5ITZA 2F4VB 1UZUA 2AE1A 4RFSA 4C4PA 1E7SA 4MB6A 4A0RA 3L7DA 4DXDA 3LGSA 4ZV9A 4RAOA 2OYRA 5L6MB 2QENA 3IIKA 4KJZA 2HF9A 4ZALA 3LG2A 2ET6A 2I3DA 3NBFA 4LSMA 4MINA 2I33A 2JJQA 1VJ5A 1XTZA 2J0VA 2XBLA 4FMDF 3WZLA 5CITA 4EPYA 1C9DB 3G17A 2B69A 3DMRA 4ZAZA 4D9NA 2BEWA 3AESA 1P7ZA 3PJGA 3EASA 4MVJD 4IHQA 2CGEA 4C05A 3GFVA 2P3QA 3ZJUA 3ONDA 1W6UA 2RI1A 2FPKA 5SZHB 4B2LA 3P2EA 5EMHA 2CDRA 2ZTLA 5G3YA 3PEYA 4KZPA 2J9YB 2C9BA 3EPPA 5HCIA 1CP2A 4RJKA 2GGSA 3HWRA 2ATXA 3SYTA 1FLDA 4IDCA 4ZJPA 2WPNA 121PA 2PMWB 5C8ZA 3L49A 2WSMA 2VOJA 2R5WA 4N47A 5JDCA 3ZBUA 4AXXA 1OMOA 3CUVA 5CFMA 3CZRA 4COOA 4O1IA 1N0VC 2FA9A 4UQPA 2AJ8A 3V1LA 2O07A 1XPRA 3ORHA 2OYSA 5JSZA 2YQ5A 4BNXA 3NP9A 3N8GA 1KY5A 5B3JA 1J8QA 1G4AE 2ZT5A 5FTLA 1CY4A 3R7NA 5KNLA 2XIQA 3ZWNA 4DCVA 1F7UA 2ZJ7A 2R1TB 3HYTA 4TMVA 2O7NA 1XP8A 2D1QA 1C8LA 4GKAA 4ZVVA 4KN9S 4LJSA 1VE7A 4O1HA 4H1WA 1DDIA 1NFFA 4CKWA 4KHZA 3WO1A 4DIOA 1GPJA 1KMIY 2AUMA 4IIUA 2H2HA 4LHYA 1VPLA 2O3SA 5E7QA 1G5TA 1XDZA 5K5EA 5SV2A 4AKHA 5JBNA 2Z83A 5HF5A 3EZXA 2PMDA 3E35A 2WTXA 2J3DA 4B75A 3D5TA 3F9CA 3QKWA 2OPBA 4CF7A 2BM1A 2BBSA 4OIMA 4BUZA 1KVQA 1IM8A 1S02A 3RSGA 3RTBA 4DJJA 2DTDA 3WWCA 1A69A 1QONA 3R5JA 2O23A 3QITA 1HQCA 1YBVA 4CFZA 3RFCA 3T6KA 3A4VA 3DA8A 1X0XA 1S8OA 2XX3A 3I8SA 5TQJA 2NSJA 1DRWA 4MEBA 1UQUA 5BPHA 2YJGA 2ENUA 2I1QA 2WG0A 1XJ5A 3VZQA 1MZPA 2JJ8A 3OJ0A 1I3CA 4QSMA 4UNQA 1AF4A 4W9NC 1EQAA 1QIMA 1MVLA 3HYCA 3MELA 3A4YA 3SLGA 1BH6A 3UNXA 3HP4A 3EXEA 3X1YA 5HFJA 1T8WA 4GL4A 3UY4A 1C9MA 2MSWA 4R71A 4OAQA 3D54D 3GJTA 4D4KA 4ZMSA 1LEHA 2DUWA 3EY9A 4CE6A 5EHXA 4HEQA 4JLNA 2RG7A 3T7CA 3V8RA 2QVZX 2QW1A 3B9BA 1XTUA 4ND6A 5ES4B 2O5VA 3NH9A 5G0SA 1P4AA 1UQTA 1G8PA 1W2WB 4KTVE 4E6EA 4W5QA 2GO1A 4NYJR 1TJ3A 2JFGA 1XAIA 3I8OA 3IVGA 1G2PA 3B3FA 5AHWA 3X1KA 2JW5A 2FXVA 3DTVA 3FE2A 1GAQA 1HTTA 4X00A 5AW9A 1TLLA 5K2MA 3U4DA 3HXLA 4JI8B 1MIOA 5IANA 1P45A 2OO7A 3UMGA 1BU5A 3RRXA 1OZGA 4MPTA 4K40A 2BKLA 3P27A 4LF6B 1J22A 1B93A 3IAS6 3UGQA 1JPUA 3AVWA 4MEAA 1XMQB 1SOWA 4L78A 5HTKA 1R6VA 1YZKA 2E4ZA 4P84A 3A6DA 3SN6A 5FAKA 5CK4A 5C34B 2UYCA 3WYFA 2QTNA 4MUEA 4B17A 3VGJA 2NT4A 5D51S 1K7SN 1QQTA 3K4QA 1W25A 1XWWA 3L3BA 4RJJA 1Q50A 5KINB 4JBWA 4QVKA 2G70A 1FTGA 1WV1A 1Z37A 3NUGA 3TLMA 1KBOA 4F4IA 1SVSA 1T3HA 2ZYRA 3IDFA 3SFVA 2JNWA 5C52B 4ZZ2A 3UWMA 5A71A 1NMYA 3VKHA 1F2UB 2PBLA 3IIEA 3LMKA 2H31A 5E7JA 5K51A 1NYRA 4UVEA 3LFUA 3N8HA 1IIRA 1DMSA 3EUWA 4WKGA 3RUEA 4ARCA 2ATCA 3TSCA 4BV2A 1P44A 5DF1A 4O2LA 2DSTA 3AKEA 3EVZA 2D5BA 2I87A 2JKVA 1Q83A 2FEPA 3EN0A 1QM5A 3OLYA 3SPXA 3P2MA 5K4GA 2FFQA 2ZQZA 5EFZA 2OQVA 3WNQA 2VP3A 4LV5B 5DHFA 3EGCA 2QD2A 3ZLVA 4LFAB 3IURA 1CIPA 3LKVA 1IYZA 2QQ5A 5AM5A 4XM1A 3AF4A 3TN7A 1GV1A 2FSIA 3PJFA 4O4LB 4BMNA 3A10A 1E32A 1JKJA 1VE9A 4E70A 3A8TA 1LK0A 1C50A 2CNKA 2E82A 5P8WA 4QVIA 5M29A 2ODEA 3OM1A 2D7JA 1QFSA 3CBQA 3P5BA 3QXCA 5C51B 4LMAA 1WQ1R 4AP6A 1X92A 3HWSA 1LXCA 1C7QA 1SXJA 2Z3WA 4V0KA 1T1JA 3OKPA 1KYXA 2FWPA 4B3XA 2GA9A 1XYVA 4RV9A 4BV8A 5JHHB 4P36A 4LF7B 3HB4X 1DUVG 2BCEA 4Q1BA 4HRAA 1LPSA 3PGJA 5A6VA 1EAYA 4NNJA 1O95A 2GJAA 4LOKA 1VGQA 1KWGA 1YGPA 2RHCA 4HD8A 2BGJA 4ENTA 3OQMA 1XRJA 4NFSA 2EP8A 2BH9A 2Q1YA 4EECA 4NBKA 4AX4A 3FUCA 5K03A 4G2TA 3GCDA 3QW2A 5JSHA 4AQYB 4LHZA 2R6FA 1CVIA 4BHTA 2PRYA 3T9BA 3EUFA 3ADDA 5AVYA 1US8A 5HUJA 2ZUFA 3KKNA 1V16A 3L7BA 4R1QA 1LZKA 2GEDA 1P5FA 5CFZA 1GPUA 1DKPA 1TLTA 3DPUA 6ADHA 2FZ4A 2LPMA 3O4RA 4FCCA 2GPWA 3LDHA 4I55B 2PXCA 3S8YA 4AY3A 5BSMA 4BO5A 4CODB 2Z58A 3LYUA 2YFQA 3EA5A 5JBIA 5I5EA 1YB4A 4IQGA 5CBPA 3RM3A 3I05A 2PD3A 3FGPA 4FXOA 1TAQA 4LHVA 2X23A 4YRTA 2ZCJA 4Y0AA 4ZQIA 4IWNA 4QUHA 4G24A 4BZQA 4ZI2A 5KCZA 4JCOA 1CS0A 3W9YA 2QRLA 2AYYA 1GV0A 2WVAA 4MV7A 1TU3A 1SBTA 4QO8A 4UATA 1KZ7B 2RCYA 3H2YA 1XPJA 1PV1A 2Q6IA 4OA8A 2I7XA 1ICEA 1T13A 1VPWA 3ESDA 3MPOA 3OF2A 1E99A 2ACVA 3C8HA 1WDWB 1KC3A 1U99A 2C57A 3GQVA 2VDJA 4R5HA 1EWQA 4LZLA 3WMWA 1XVAA 3I1IA 1Y3AA 2J41A 1NUHA 3A36A 5I9BA 1WZ2A 1I14A 1Z74A 2R8RA 1WHSA 1G63A 2BEVB 1HQDA 2WTNA 2YWDA 1TQDA 4FSXA 3THOA 2G1AA 3TL3A 2QZ4A 4F4DA 5KHLB 4GVLA 4F12A 5JROA 4MA4A 3HO8A 3UWDA 4BB0A 1I6MA 3KEOA 1I9CA 3MJDA 2JAPA 4K9LA 3M34A 4ZTBA 1YQGA 1BJTA 4XVHA 2ZETA 4YCBA 4N39A 5H1YA 3K6SB 1W35A 4U3JB 1YU9A 3ENQA 4DCSA 2B37A 2B4TO 4CTKA 1CUYA 4W82A 3MJSA 4XW2A 2E3JA 2XWPA 2P3OA 4D9FA 4BGEA 1W0KA 3WLSA 2ZRBA 2IVFA 1HDEA 1YDEA 3MT0A 4GR5A 1A7AA 1UDBA 2OBBA 3IEXA 4FNMA 5JDCC 3S1SA 4OX9Y 3HFJA 2P2YA 1W5BA 4Y6SA 1AK9A 1FTYA 2A7QA 2VUSA 1RJ9A 3B1JA 3HCBA 3KIPA 3BE4A 4HGYA 4JBNA 3AWDA 4Y1GA 1G8KA 3G5UA 1GLGA 1IEWA 2ZBDA 1UBOS 3HKDB 3KEMA 2OXCA 1FNBA 2Y1LA 4GSLA 3ZWCA 3MCTA 4FQ5A 1JG1A 2XUQA 4WGFA 4XE5A 3H1TA 4Q1FA 1XP5A 3EVNA 4IDBA 2Y9PB 2H7CA 3QWHA 5D00A 1A04A 3NIDB 1CUBA 4LSWA 4E2XA 3I01M 4GM0A 1K7FB 1NBOA 3SX2A 5GZ1A 3OPMA 4HWPA 4CCAA 2ZREA 2BHNA 3DEZA 4ZI7B 3ON5A 3N5KA 4BU1A 3JXEA 2KBEA 1MPTA 4OHBA 4PRKA 3VPXA 3C74A 3WLPA 2YINC 1K5HA 3EXFA 2ID9A 2XXBA 1QGYA 2AKYA 3KWJA 4BMCA 3M3PA 1U63A 4NMHA 1AHNA 4JUCA 3KOXA 1I7SB 5BSUA 4F06A 3TUJC 2BFAA 2NIPA 4OYHA 2QY6A 2MTBA 5CA0B 5K1ZA 3OBIA 3M5CA 1B76A 1E3IA 1DU4A 1N8NA 4M0MA 5F2OA 3USCS 4ZEVA 1IOLA 4A03A 4BLUA 1XJCA 2FWRA 1G8HA 5IX8A 1UODA 2AXQA 1AHIA 3D6HA 3PWTA 1EFDN 1NVGA 4H27A 3CW2A 2GPYA 1FP2A 2QUJA 1AGYA 2H16A 2OESA 1E5VA 2B35A 3E3LA 3FTCA 1FRNA 3I9V6 2VSXA 5F2EA 1VJRA 2I2AA 4IILA 3T5DA 1JAHA 3HH8A 3C3DA 3NHAA 4LY0A 2O3UA 4PAQA 4J2TA 1YNSA 1G3QA 1N2JA 3NC0C 5CX4A 4AKIA 5LQCA 5HA5A 2DETA 3NEYA 2AK3A 5CB6A 4FMBB 3FPJA 4X9XA 1ZXBA 1CQPA 3BDIA 4R69A 4TOIA 4R2WA 2HZ7A 2F3SA 1WB6A 4H1HA 1SVOA 4HXYA 4KRGA 3KD3A 5JCXA 2X8WA 3FOWA 1E5LA 5HS4A 2A30A 2REQB 3CNQS 3TLGB 3PXUA 4NMLA 4ZT5A 1AKUA 4LZJA 4MJ7A 4URZR 3ZCSA 1JX6A 1PK9A 3G8YA 4OB8A 3DV9A 2EBHX 5EPEA 3UJNA 3CE6A 4FEYA 4PZYA 3VYVA 1H6CA 4HDMA 4B4OA 5LXTB 3T4UA 3M5DA 3H3FA 1NNLA 2D59A 1KH2A 1PVDA 2Z2XA 1DZ3A 3GIDA 4PX3A 5CNKA 3TDNA 1TJPB 4MDHA 5JZ9A 5CIYA 5JSZB 2WUDA 1FX0A 3G9XA 2F1JA 4EHAA 4F5ZA 4RF2A 3EXEB 3MTDA 3L18A 3BA6A 3ORFA 1NXWA 4KIJA 5EOVA 3Q5GA 3CGGA 1RLOA 3OZ7A 4DLUA 4OSPA 4Q05A 2R96A 4YV0A 2CD7A 3VNSA 3ZXXA 4CKZA 2W2OA 2R1TA 3CIFA 3I12A 1UJ4A 3MBKA 2ZSAA 3DXYA 1KQGA 3LY9A 3QMPA 3TTWA 4AKSA 5BUSA 2ASVA 4GMKA 3CZAA 3AR5A 3GD5A 4NI5A 3S7TA 1U0BB 4AL4A 3HR7A 1HORA 1JR3A 3OIWA 4M98A 4RXTA 3FYUA 1OY1A 4L5BA 4O8ZA 1U7ZA 4BE7B 4ZYVA 2PJRA 5JIBA 2XDWA 1NXQA 4M8KA 3GP5A 1RCTE 2A5LA 1JN0A 3EZ6A 3V4PB 4DMCA 4A5SA 1X8JA 2EIHA 5A3SA 4Y2QA 3I2FA 3PHLA 4DV0B 1CUGA 1DQPA 1E77A 1NKSA 1WR8A 1Z7WA 3O2NA 4G89A 6YASA 5ALEA 5IAEA 2GCIA 4G5HA 2IEDA 1PEYA 3CISA 4LRYA 3RIEA 1LRLA 3JD1A 4R31A 3TD2A 5IKEA 4BXOA 2NVWA 5AIBA 4QUGA 4LWPA 3G0OA 4P08A 3ZGLA 2CNWD 5I9SA 3PT5A 4KXYA 5C4MA 1WW2A 1ZD8A 4BE9A 5C5CA 3KCNA 2Z5FA 3FPEA 2YJ3A 2PBZA 1DTWB 4JEIA 3CUEF 3JR7A 3U4HA 2JF0A 3O8QA 1P19A 5FNVF 4H2DA 5KJCA 4MIKA 4PPGA 2X3UA 3TR5A 2QUIA 4NYIQ 3FOBA 2D5IA 5KQLA 1QVAA 4HQ0A 5CT8A 5BMVA 4PW0A 3D7NA 1I2CA 1YBHA 1KH1A 1SCNE 2FI1A 4FT4A 4KRFA 1X39A 4GMXA 2XEDA 1YJ8A 4IFTA 2HO5A 3O90A 3STYA 1IVYA 2NVBA 4BNWA 1A8SA 2QRVA 4KVZA 2QK4A 4QNRA 5IC5A 3TW0A 3N2GA 5J4YA 4PFKA 1VKOA 1U5AA 1FP4A 5MFZA 4PCUA 2B7BA 3JRXA 5EXXA 4YECA 2XUDA 3OD1A 5KHOC 1ZJJA 2GO7A 3F46A 3R76A 4EM6A 2AA3A 4PYIA 1JKJB 5JXIA 1FXSA 1G8AA 4RABA 4JOSA 5F51A 4IOLA 2PJUA 1THMA 3QLUC 4CZ2A 2J3HA 5DT2A 2OM6A 4II3A 5KOHA 2UVDA 3AVUA 2LW7A 2NAPA 1RJEA 4P53A 2Y9MB 3QBVA 1VJ0A 3AL0C 1G7CA 2W37A 4PAMA 2NADA 4BKMA 2DBVO 4ENPA 1DEHA 8LDHA 5CCXA 2BTEA 2JFYA 1IFXA 5EHIA 1J2TA 1IB0A 1W29A 1Q12A 3GZJA 3VDQA 1LVUA 6Q21A 3CRMA 1MC8A 1P4GA 2REOA 3O1JC 3RQIA 4GRIA 3ZWMA 3ZCXA 2PQMA 3Q7PA 4FJ1A 4D8XA 1ZW6A 1W88A 1K6MA 1E8NA 4DMFA 2WAAA 1V41E 3FDIA 3B3GA 4HH0A 1N7JA 1FDUA 1A0OA 1T9CA 4PZLA 1DIAA 3OIGA 1XTBA 2HLPA 2GZ3A 3IUJA 5DYNA 3RABA 1M67A 1H5QA 2YZNA 3NBUA 2C0QA 3IVAA 5JMWA 3J81k 2WZCA 4PZDA 1SQ6A 4G8CA 3OQPA 5LP6C 4FK8A 3ZV5A 1QF6A 5AI4A 1P0CA 2OTCA 2YC2C 3LLSA 3GEGA 1G4HA 4DCJA 1UBGA 2PU7A 2E5WA 1NBIA 2IIPA 3BE5A 2EFJA 1LDYA 1Z06A 3OWOA 4C7KA 2CKDA 3PPXA 3DZCA 2CNBA 1XCGB 1ZHHA 2CHQA 3UUWA 5KSPA 5IAAA 4HNGA 4F97A 2O1SA 3WRYC 2Q4TA 3GEEA 1UC9A 5ANRB 1QG0A 2QYTA 1NRWA 1BC5A 4BQNA 4L7QA 4C06A 3K70D 5GIPE 4FQ7A 2XQJA 2CN1A 3PUXA 4MUKA 2OV2A 5FBWB 2JIRA 4IIVA 4Q7MB 4HTFB 5CDFA 4W4TA 3N8KA 2HCFA 4V0SA 1F2TB 3BIJA 3JYNA 3TI7A 3ZNQA 4I5DA 3ZJ5A 1Y6ZA 2PUHA 4ND4A 1GRQA 4IG9A 1JF8A 3DMYA 1S8AA 3I01A 4NICA 5TLSA 2YYZA 4CF6A 5IK2A 5A4JA 4XIJA 3KYDB 1TCCA 2P9YA 3V4OA 3I2KA 3QXXA 4M7PA 3P19A 1UJMA 2HWWA 1Q1QA 3AR2A 5B7NA 3DE2X 5DX0A 4EY4A 4ZT2A 1W76A 2XKKA 5I7VA 2Q50A 1X7WB 2X5KO 4CQJA 1Q16A 5KQSA 4NYMR 1HDXA 1VRWA 2B6HA 3KBBA 5FF9A 1XL0A 3IS3A 3S70A 3ZZUA 2PTGA 1RPAA 1KI4A 4U4AA 5A7HA 3VX3A 5BP7A 3QLJA 4MP8A 4MI9A 4CG0A 3EOBI 3U5TA 3L93A 2I66A 3U4CA 4AG3A 4A0HA 1JFLA 4BIIA 2GKOA 2EYQA 3I8XA 5DHTA 1W0KD 2WJVA 5CPBA 3FAKA 4CMJA 4JI6B 2CBZA 2A9FA 1NVWQ 2WG1A 3CF4A 4PLWA 4RGYA 2B25A 3VV2A 3WLJA 2YHAA 5T5QA 2FE1A 4B82A 4D3XA 3D7MA 4D9KA 1KOJA 1LNQA 4JY7A 3N86A 4Z4CA 4J3JA 4FNAA 2I22A 3WLMA 2CXNA 3AR9A 1JB1A 3H9EO 4A82A 4F2DA 5FIUA 1OBVA 4HVTA 4HGQA 5ENVA 5GONA 1TEZA 1JKMA 1ZGZA 5I01A 1PYDA 3X1WA 1M2VA 2A9VA 2P3SA 3AL3A 3TW8A 3IJRA 2A1TR 1D6MA 2BF7A 3E7PA 4HJXA 4IDFA 4PLHA 3AR7A 4Q4DA 4NNOA 2BGRA 3FJ1A 3R7FA 3VI4B 3FLMA 2BKAA 2L0XA 3AKDA 1GRRA 1L7VC 3L0BA 2X1VA 1ADJA 1FXWA 3OZAA 5KTMA 2I71A 2ZI3A 4GPIB 4U7PB 3LL7A 3LJKA 4BFSA 3SC3A 1OILA 3NGLA 4B87A 2OFWA 1MB3A 1NDHA 2QRGA 3M82A 4KAXA 4TXHA 5HQ3A 4B3SB 4V02A 2YOHA 1T4DA 1P5RA 2IDZA 5BSHA 4ON9A 4DJDC 3FI0A 3RK0A 5IF3A 4N5DA 1X7HA 4ND2A 2AXNA 2EQAA 1FNSA 5AWFC 5BY2A 3Q72A 4UUMA 4UEQA 2WYHA 4CT5A 3UENA 3OAAA 3TRKA 4A3SA 1L4UA 2BGMA 5F5LA 1JHMA 5HKOA 2BGTA 1CZUA 4K9RA 1KEKA 1LNZA 4PC1A 3B3JA 1ZS9A 4WXPA 3QYJA 3WNCA 4EG0A 3CRNA 5FADA 2GCOB 3PQ3A 4D8VA 3ZY4A 5HIKA 4ZGBA 1AMOA 4S12A 4BNZA 5GGXA 3THSA 4D8TA 1PJ3A 1U0TA 4BQOA 2NXEA 2GJ9A 2ZAOA 4YP0A 2UYHA 3EBLA 2G04A 3WE7A 3PXEA 4M86A 1X9HA 1I5RA 4NBTA 1D03A 5IJ9A 1P6UA 3DHYA 2O9JA 3D5QA 4D45A 2LIPA 3KT3A 3D3EA 3PYLA 5A4IS 5SZKB 5EUMA 2E87A 4YAEA 5JE8A 2XUZA 2ZIVB 1CQXA 1R6XA 2OG2A 1CJMA 3HEAA 3HKDA 3KDPA 3QELA 5IC6A 5K0FA 4NKRA 1TIKA 3T3NA 3D6MA 3EF1A 3AETB 1AS0A 1HF3A 2R25B 1QBKC 1M66A 1ZJ5A 1UANA 2H1FA 4KIFA 5LP1A 3AR3A 2IYNA 4BFUA 1W5SA 4Q19A 4Q9LA 4EG8A 1OJ7A 4GLFA 3GBSA 3FOCA 2Z9CA 3ESCA 2V7QD 2VHZA 4MITA 2Q5QA 2V59A 1TOAA 4EWLA 4MAFA 1LW6E 1BHO1 3EW7A 5JQGA 2BMAA 1J97A 1GYQA 1KF0A 2C78A 2FN3A 1SKAA 4PSKA 4GH5A 2WUGA 2XTZA 3WGLA 1RJGA 3TIFA 3VYSB 2WW8A 1H3FA 1S3FA 2EP5A 3H9JA 1Y1KE 3MTAA 1CRZA 2FPIA 2O2JA 3OTWA 4UU8A 5DHSA 1UOPA 3VISA 1KAQA 3VVBA 4RPLA 1EJ2A 3Q8XB 2HTFA 3FPLA 4FOPA 4PE5B 4EQZA 2J08A 1PJCA 4H3KB 3IA2A 4LA4A 1WMAA 1Q2XA 4B09A 1CK4A 1RI2A 3A26A 4M53A 3WS7A 5LNK6 3DL4A 2O0KA 2P2ZA 3FZNA 5E9QA 3UC5A 1ODIA 4B6JA 2FOLA 1GN8A 1V9LA 5B4TA 3JD2A 1HEYA 3PNQA 1I7NA 4DR4B 3VR0A 3CZQA 5C8DA 2J7PD 4XGNA 3TLKA 3QEAZ 3LKBA 4MRRA 4FB4A 2BYTA 5KC8A 1JDNA 3T7AA 1A96A 1G5QA 1U2SA 1EVYA 1VMKA 1YBMA 1GCAA 2WDPA 3I92A 4XR4A 1ZHOA 3QVUA 2LXNA 2XCRB 4O4HA 4EW3A 3DJFA 1DEKA 2BCJQ 4J0QA 1ZOSA 1S2IA 3AHGA 5IDYA 3WAKA 1V1JA 5D3KA 1I51A 2QD1A 2ID4A 3F96A 4QRHA 4J6EA 4UJ3A 2O8DA 3HXQA 3LWBA 2VCHA 1HUQA 1CUCA 1P18A 4MKGA 3ZHYA 5JPCA 3D8HA 1CSEE 4XCXA 5T4FA 5CLHA 1EPUA 1H3EA 1QH8A 4TSFA 1FRZA 2C5AA 3PX2A 5BQXA 3U61B 1ISIA 1VA5A 2W70A 2IZOA 3LGAA 3NATA 5D6NA 1IUOA 3FTFA 4YEDA 1S8NA 3K4PA 3CVUA 1QIGA 3LAWA 6REQB 3EWIA 5FLEX 1RQ2A 2IIBA 4NYMQ 1EB9A 1WS6A 4LE0A 1KRXA 2XVMA 3NHBA 4OQMA 1LUAA 4R0VA 2Z4RA 4J16A 1WE2A 2ZBEA 1MFZA 5KYWB 3ISVA 4IUCS 3IIMA 1VMIA 2VDQB 3GGJA 4JUFA 3CTMA 1N9GB 5I6DA 2BV3A 4H08A 5HDBB 5IDQA 3AM5A 2N9UA 5KYYA 3PQ8A 3WP0A 4ZYTA 4OHKA 1RD4A 2O50A 2WTEA 3HFGA 4YJ2B 1V45E 3C0KA 4OJQA 1RXUA 4PG7A 3V8PA 2OFPA 5TPZA 3EWSA 5E7IA 2KX7A 2O2ZA 2AI2A 2A33A 2W6ID 3FUTA 3TAXA 1OKKA 2YJZA 1SUSA 1SVLA 2I3BA 1GUAA 4FKZA 3QX9A 5AXDA 3S6JA 3V4SA 4AICA 3VR6A 1EHYA 721PA 1GPKA 4FZ5A 5F78A 4ZYZA 4ND8B 4X93A 1RJWA 2QQFA 1Q0RA 2WG2A 2D1FA 1BN6A 2ZRKA 4FYVA 4ZIRB 4PXAA 2VEOA 5EERA 4QAQA 2BJWA 2FR8A 2RAPA 1GFZA 5ERYA 1Z4PX 3SC4A 1CDZA 5DTQA 1GKYA 3BJEA 1NQ5A 4W5WA 2CVPA 2HK6A 1M2OA 1O8BA 4XFJA 4N5LA 5DCLA 2ZM6B 2QSYA 1Z25A 4UNRA 3IBYA 1UWCA 3O8QB 4MPJA 3GLIB 5K20A 3WLKX 3GLIA 1W49A 1MAWA 3ONNA 4QGGA 1C3LA 1Z5NA 4MRAA 2BFCA 3VNRA 1QHHA 3ESAA 4GXRA 4UM9B 1P1BA 4FDLA 4LDJA 3AW8A 4UW9A 1D2RA 1G5PA 2PZKA 3R6LA 5AKZA 1YHNA 1E9EA 2GDJA 4H7PA 5CVCA 1PKXA 2Q6LA 3UG7A 3RWBA 2JCBA 1XLTC 4PF1A 2FCAA 5DTIA 2IHNA 3ETHA 1X13A 2LKDA 5F5XA 3V1TC 3PNBA 1XN1A 3GLRA 3NHMA 4PTYA 2NU6B 3KSDO 4FCWA 2BEUB 3HDVA 1P17A 1I2BA 3OZXA 4N3AA 4RIIA 5LIRA 1RAIA 4RBNA 1MF7A 2JGEA 4ESEA 1DIRA 2XYQA 2AC2A 4QXQA 5DGCA 4XSGA 2D1SA 2OP0A 4XM2A 5LBUA 3D3KA 3N2KB 1QYIA 1BVRA 3GVIA 3LUJA 4G97A 4GFDA 1V43A 1JQDA 3E0QA 1IPEA 2YIMA 1XO1A 1ABFA 1AG9A 3ESZA 3GRAA 3OCYA 5DULA 1ZP6A 2NSDA 4MKXA 5DMXA 1VTKA 1XZHA 3HXTA 1XZFA 3AWIA 3KBOA 1IPFA 4ZDWA 3PC4A 5SY6A 2QHXA 1TRKA 2GJKA 2GYVA 3H8VA 3N5CA 5A9SB 4QPZA 3EVEA 4OHFA 3RKRA 2YZ7A 4EKGA 1WHTB 5JNUA 2WUWE 1PR3A 1U28A 5KNDA 4AP9A 2DBZA 5BQPA 3V4VB 3FOFC 1XQWA 4IIEA 4BTLA 2HMWA 3BH7A 3NTRA 2JARA 1YONA 1DJQA 3LQKA 5AHXA 1BFUA 2X6RA 3IPYA 5CTJA 3TR6A 4YXFA 1NWHA 2OXIA 4ENQA 2QMEA 4KH1A 4YY3B 3ZVNA 2WWFA 4DDWA 1JMYA 5IJ0A 3FDXA 4HADA 4JASB 4YPOA 4G63A 1YZLA 2CZQA 3IT1A 4EENA 3JQFA 3E5MA 2R11A 3FG9A 4F9EA 3HZHA 3RODA 2QAGC 5C80A 1W1UA 3V55A 3GLTA 4MX8A 3VO8A 4JT2A 2FX5A 4JOQA 5BNFA 2X5XA 5DTEA 2IBTA 3GB9A 1JEOA 1NQUA 2O3TA 2Z04A 5CBPB 1KFJB 1JQKA 5IKXA 1Y3IA 1NR7A 2WAMA 2ZIFA 3MM4A 221PA 2IXGA 2NNLD 3PUWA 3PQCA 2D74A 4BJHB 4PAWA 4OK3A 4QJ4A 2EL9A 1D9XA 1P2DA 4L6IA 1KJNA 3K0CA 3NYRA 2YR0A 4LJ8A 4OFZA 5K0EA 5KWEA 1NXXA 4K6CA 5K0SA 3RIMA 4KPEC 1JYSA 5KNCH 2JIZD 1OLSB 4LJYA 4NOMA 4BMDA 3K1ZA 1E4OA 3PXXA 4RSRA 4UBJA 1MHTA 1QWOA 2ECFA 1IXRC 4AWXA 2C61A 4TYPA 4ZZ0A 3B85A 2NU7B 1CQIA 3WQBA 3OM8A 1E9VA 2R4QA 4MWOA 4CI0B 2OSVA 3O8BA 4NHEA 3ESRA 4GZ3A 4NEGA 1BMTA 1KS9A 1Q0QA 2IP4A 3E22B 3RYFA 4DUGD 2AR0A 2CLCX 2CMHA 3OMXA 3OJXA 5IFKA 1M1ZA 5J47A 4ZV4A 1RLTA 1ODLA 2EDAA 2QRVB 3K0AA 3O8DA 3PEEA 4FR2A 4IH9A 4RIGA 1WIWA 1ZD2P 4Z54A 1YL5A 4DR7B 1SU6A 2QG4A 2FR1A 3KOUA 1RQ7A 3FD8A 3GNLA 4KYVA 3T38A 4CMBA 2DWUA 3VA7A 4RMGA 1IN1A 1KI2A 4WACA 5FHRA 3UIEA 3IYLW 3HADA 3H5WA 1WV0A 5EE1A 2CCKA 2YWCA 3RIXA 2FUG6 4ABYA 2I1WA 1X15A 4ZO4A 1JYFA 4Z4QA 2X8BA 3K2IA 4GT1A 2HMSA 2OUKA 2VJYA 4D92A 3NTVA 4DT1A 3RREA 3JQEA 4KE6A 2DWPA 1UFVA 4QPCA 1W85B 3QMMA 1MEEA 4HLDA 3O8NA 3Q7SA 1BOFA 3BF8A 4Q02A 4NMXB 4WL0A 2PANA 4O3FA 3Q10A 2DQYA 3QE4A 3KQHA 1U6KA 3VZDA 2BEWB 1OGYA 2RAUA 2VHEA 3AESB 4RSMA 1R0ZA 3GEMA 2WUEA 2WWIA 5G0TA 3RUPA 1YR9A 5LQRA 5LUAA 4QPDA 3U37A 4OLFA 4EPTA 4D5GA 3GARA 3VVCA 3K7EA 4F2HA 2HCJB 3CT6A 2HSZA 1ZONA 2WJJA 3N0TA 5HM8A 4D4LA 1ECCA 1HG1A 1UMBA 2FW0A 2PKQO 3OIVA 3SIXA 1VL1A 3MTBA 3ZK7A 5JC8A 2Z0MA 3HFRA 4X3OA 3TQIA 3WBKA 1FUUA 1OLXB 3O92A 3D3QA 421PA 1Z0IA 4EAAA 3KQLA 3R3WA 3HG7A 1YZ3A 5CDYA 1L5OA 1MB2A 1V8Z