3DF7A

Crystal structure of a putative atp-grasp superfamily protein from archaeoglobus fulgidus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
305
structure length
301
Chain Sequence
SLKLFLFEFATCGERIEDSTAVEGLAMFKSAFDGFKNYYEITGFVRPEFSCLFTLPVDSMDSMEKYLEKSDAFLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVTSDKWELYKKLRGEVQVPQTSLRPLDCKFIIKPRTACIGFSDEVPDGHIAQEFIEGINLSVSLAVGEDVKCLSVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLNGYVGVDIVYSDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYVSVGDYTLEIIDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ATP-grasp superfamily protein
publication title Crystal structure of a putative ATP-grasp superfamily protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 83
structure length 301
sequence length 305
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
A PF18301 preATP-grasp_3 pre ATP-grasp 3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3df7A02
3.30.1490.350 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3df7A03
3.40.50.11770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3df7A01
1KJ8A 4YAKB 2Z02A 5JQGF 1EZ1A 1GSOA 3JZFA 2CNQA 4O81A 5CA0F 1C30A 2W6OA 1ULZA 3Q2OA 5BPHA 4MV3A 4O7RA 3TQTA 4MV9A 3TW6A 3TINA 3N8DA 5JQWA 2YW2A 1KJQA 5FNVF 1Z2PX 4FE2A 4FU0A 4ZQIA 3VMMA 4HNUA 2GLTA 3NUAA 2FB9A 4FFOA 2V5AA 1IOWA 2W6PA 2YRXA 3WNZA 2YRWA 2YZLA 4MAMA 4MA5A 4MV7A 2DLNA 4C5BA 2R7KA 2YS6A 4WBNF 3OUZA 1SCUB 2QK4A 4MV6A 4YJ3F 3VA7A 5CA1F 4IIJF 4HQ6A 3Q1KA 5H80A 4FFNA 2GQSA 3RFCA 1DIKA 2NU6B 2V58A 3GIDA 1I7LA 2FPGB 2YS7A 2R7NA 2VR1A 3LP8A 2DWCA 5CB4F 5D8DA 1CQIB 2W6MA 3JZIA 2NU9B 3HO8A 5LOVF 2R86A 2R87A 2GQRA 4IZOA 2GPWA 1B6RA 1GLVA 2GPSA 1M6VA 4I55F 4O7NA 5IYZF 3ORQA 4O82A 2YYAA 3RV4A 4O4JF 4HR7A 2SCUB 5BMVF 4E4TA 3R5FA 2W6QA 4XZ3B 5JVDF 3U9TA 1W93A 3KREA 3ETHA 1W96A 5LA6F 1OBGA 2I8CA 3ORRA 2FPIB 4HNVA 5J2UF 2CNVA 4O4LF 3KALA 3U54A 2W71A 2PN1A 2I80A 2W6NA 3AX6A 5LYJF 1KJIA 4YAJB 3TIIA 3AW8A 1T36A 5C1OA 5CAEB 4O7YA 4O83A 3VPBA 4ME6A 3K5IA 1Z2NX 4O4IF 4O7WA 3R9RA 2NU8B 3TIGA 3UFXB 4O7TA 1GSHA 4TUYF 1AUVA 2J9GA 3QFFA 4FFPA 3MJFA 4O2AF 4ZOLF 2W70A 4XX0B 2DIKA 2FP4B 3E5NA 2R82A 5LXTF 5BPFA 2IP4A 2WYOA 1EUCB 2X0SA 1PK8A 2ZDQA 4FFLA 1BXRA 1JDBB 4Y8VB 3JRXA 4YJ2F 5GONF 4EG0A 4EGQA 4DLKA 3WO1A 3JRWA 1KUTA 4TV9F 4ZHQF 2I87A 1A48A 2XD4A 3VPCA 3G8CA 4YBZB 3BG5A 1EUDB 3OUUA 4DIMA 1KBLA 1DV1A 1B6SA 2W6ZA 1VBHA 4FFRA 2ZDHA 3V4ZA 4EGJA 2DZDA 5EZYF 1OBDA 4MV4A 4O84A 1M0WA 3HBLA 1DV2A 2XCLA 1KC7A 5KX5F 2PVPA 1WR2A 3MWDA 1AUXA 1PX2A 3R5XA 2Z04A 1KJ9A 4FFMA 4L1KA 2ZDGA 4O7ZA 1JDEA 4O2BF 1GSAA 3MWEA 2NU7B 1E4EA 4RZQA 5C1PA 5JVLA 3N6RA 2YZGA 1E4EB 3HB9A 2YZMA 3WO0A 2FPPB 1A9XA 2R7MA 5J2TF 3GLKA 2OLSA 1M0TA 3U55A 3ETJA 3DF7A 3RUPA 4I4TF 4O7LA 1KJJA 3I12A 1CE8A 4XYMB 4YB8B 1C3OA 4ZI7F 4HNTA 1BNCA 4MV1A 4M9UA 2V59A 3K3PA 3LWBA 2HGSA 1KEEA 3KAKA 2C00A 3KAJA 4I50F 1I7NA 1JKJB 4O4HF 1CQJB 1VKZA 1Z2OX 3K5HA 1JLLB 2QF7A 5KKNB 4MV8A 3R23A 4NYEA 3SE7A 4C5AA 4O86A 5HBRB 1VBGA 3G8DA 2VQDA 2YL2A 1IOVA 4IHJF 4QSHA 4C5CA 5JH7F 3V4SA 3VOTA 2YWVA 2YZNA 4FGRA 2CZGA 4MA0A 2R84A 2NUAB 2PBZA 1EHIA 5DMXA 2R85A 3RV3A 1EYZA 2R7LA 1CS0A 2CNUA 2HJWA 3R5HA 4XYLB 2VPQA 4O7SA 5C8YF 2P0AA 4TV8F 5HV6A 4O7VA 5LP6F 1GGOA 3U9SA
chains in the Genus database with same CATH superfamily
1PJSA 1F1BA 4OK3A 1YFJA 1WR8A 1YV9A 2DCMA 3HXMA 3BEDA 2ZUWA 3AVOA 1XCBA 2J45A 3FBWA 3FPHA 1Q7GA 3RRZA 1KJQA 1XAIA 1PR1A 1P7PA 2F1RA 2HPZA 1T26A 2YJGA 2GEKA 1CT9A 2F90A 4ED6A 2ONYA 3LV8A 4TT3A 4US0R 4DQKA 4R0MA 1E1MA 3LECA 3HM9A 5K0FA 1VC2A 1U0LA 4LSGA 4RFVA 5AVJA 4WN9A 4G09A 2PTHA 2Z5LA 1P7CA 1ZMOA 5J5AA 3KIPA 3GV5B 4J9NA 3FLMA 4JUFA 3D59A 1JLRA 3A1WA 1DDOA 1II9A 2RH5A 2HDWA 1SVKA 1R0SA 3D0QA 4O08A 3ZHCA 5CBPA 1BEZA 4BP8A 4M49A 1OWPA 4Q3KA 3T3IA 1KK0A 2IU4A 1ODKA 3O0TA 4EQZA 5FWYB 4E2ZA 2HIVA 1XTKA 1JZTA 3HO8A 3BXHA 4JSTA 2G0AA 1RJGA 2QP3A 4C4TA 3Q41A 4X1IB 4N6GA 3OO0A 2WJPA 1GL3A 1V5IA 2ET6A 2CHEA 2PT7A 3BHNA 3I6BA 4RDHA 4BNNA 4YR3A 4C7JA 1JEYA 5EQFA 2ZCJA 2C22A 2FAXA 1FMFA 3MW8A 1JDUA 2B21A 3GMIA 4M8LA 4PIMA 5FV7A 3ON5A 5C5IA 1SMKA 1EWTA 4P54A 1SC9A 1SU8A 3MTAA 2QA5A 4IJ6A 3PDCA 1QVAA 2P6OA 2QL6A 3NUGA 4JQYA 4UNNA 3VHQA 2JI4A 2DWQA 4ZHQA 2PWBA 1G18A 3T5MA 4AJEA 4E94A 1QFMA 3A7EA 3ANMA 5KFVA 2VTDA 1VRWA 3QFSA 4QPNA 5I5XA 3N58A 2B99A 3OEYA 4AF8A 3UY4A 4BN0A 2IKQA 1RAIA 3RTDA 1FRVA 1ORVA 1SKAA 1WRVA 1K4YA 1YUBA 3NIFB 3CX3A 3MRTA 4QUGA 2EIHA 4H6PA 2HLDD 3OPQA 2F67A 1UFVA 1SRQA 3FNIA 3DQZA 1KEPA 1SHLA 4CCYA 1KZYC 2A2ZA 4MUMA 4DREA 4FE3A 2R1TB 4AY6A 2WOOA 1XVTA 2OSBA 4BMOB 3B78A 3TEFA 3AP1A 1M6EX 2OR3A 5EQJB 4H35A 5CLQA 4LTDA 5ARBA 4HQRA 4JI6H 4XOUA 1QUEA 2FF7A 1DT5A 4PF1A 1YR2A 4BMYA 1T3TA 5KOIA 1E4EA 1JVNA 1LA2A 3Q3IA 4ENTA 1CKNA 2J5RA 2C5HA 2JLRA 1W19A 4R1MA 2ZJ8A 4UXJA 1JJAA 1NNI1 4A03A 3KBBA 4A7PA 3AEKA 3EIWA 1UEJA 3EGXB 3LNTA 4G23A 1W85B 5KOYA 2Z56A 2NXEA 1PQPA 3T9AA 2H4WA 2YYSA 4FZ3A 4GQIA 2RGNA 4FFWA 4J1NA 4R2LA 4CG2A 4D57A 4KR7A 4YP7A 4CEIB 1C3XA 5JSQA 2IMWP 5EE0A 1MORA 1E1NA 3WLEA 3A25A 4EF6A 2P3LA 1FXSA 2DEUA 1UJ4A 3BMXA 3OFVA 3QUBA 1RPJA 1L5SA 3AIKA 4M1SA 5C7IO 2OAEA 5DP1A 4PBSA 5IX8A 2Z6QA 2Z2YA 4Q9HA 2WV9A 4X41A 3T06B 4BLOA 5KVCA 4MA0A 2J6CA 4P3KA 5AK5A 3HCCA 3AF0A 3TPZA 4Q4DA 3ZWMA 1EK1A 3EQ7A 4HXFB 2YQ4A 2O3JA 4LKOA 5KINB 4ECYA 3LRXA 5EC8A 2HREA 3VU9B 5IVDA 4OBWA 1HFJA 4FT4A 4ZVSA 1SZCA 3LH5A 4Q34A 1C30A 5KTOA 1OZHA 3FGZA 3LQKA 1FC0A 4B3SH 4ZOAA 4QVIA 4QUIA 3OZUA 1VPWA 4J9SA 1PR5A 3WGZA 1DWUA 3KM0A 3LUHA 4JQOA 5EP2A 5A7HA 3OX2A 3VGPA 1K8XB 3JW8A 1LPMA 2MSWA 4E2FA 1DNPA 1JHVA 2KB0A 3NEYA 2GZRA 4ZYUA 1SU6A 2AJCA 3H40A 1YIDA 1S3SA 1Q17A 1EUQA 3A4VA 4V1CA 1TYEB 4H7EA 1XBTA 3Q1KA 3DDCA 3WZ2A 1BC5A 2WHRA 1HNXH 3MMNA 1NFQA 1AA6A 1IBSA 3GLHB 1FUYB 5KC9A 3NOQA 4N3GA 3V1MA 3SMVA 2ZPTX 3X1JA 4M8IA 4FWIB 4CMIA 3SWWA 1S1CA 1GGKA 2H31A 1GZ4A 2L18A 2OV4A 4TSFA 4F4JA 2P4UA 3LX6A 3WGYA 2V7QD 4V38A 4LY6A 4OKSA 3RUFA 3GPBA 4GI7A 3ADBA 2HWUA 2PKRA 2A1IA 1DT3A 2GCNA 2BF4A 4L8YA 4ZO6A 1ECFA 3RK0A 3U7QB 4YCNA 4FMDF 3PFWO 2PZ8A 3VNSA 5LMNH 1XA4A 4GS5A 3PVXA 4FQ7A 3V8PA 5D3QA 3WGHA 3KP1A 2GXAA 3FMAA 3ZZ1A 4J4BA 4RLHA 1RQRA 2VJLA 3Q0TA 4OQYA 4B3XA 2O8FB 1XJWA 3IQIX 3KWJA 4IO0A 5JXWA 5KQLA 2YY6A 3C3AA 1KPIA 1JW9B 1N3YA 1XO1A 3ABQB 3DE7X 4NOKA 4XGRA 5GQSA 4P6VF 1W581 2YDYA 1OXXK 3MS7A 3SZRA 4EFBA 1A5SB 2P6RA 2JVJA 1ENPA 4H17A 2WM8A 1TTQB 3J80W 2AC2A 4EZEA 5IHPA 3DBRB 2C84A 1D2AA 4OHVA 4FGWA 2PQMA 4B33A 1M8FA 4URUR 4UHBA 4I50A 3W9SA 3CVVA 4TXJA 2GBIA 3KTAA 3UK2A 2HMWA 2VQFH 3NYIA 2VPSA 4LNAA 4A10A 4ALIA 1XC7A 4YPOA 3OSNA 2TMKA 3HVHA 5TARA 2Y9MB 1KDZA 4MS1A 5D84A 2PWAA 3WLNA 1XWIA 4XH9B 4V0LA 1Z38A 3HR8A 1ESDA 1NZDA 2QXUA 4DV1B 2Q9AA 1C7EA 4KQGA 3RT1A 3HTXA 4DQUA 4FGJA 5ENZA 1HZJA 3EF1A 3UKDA 1TMOA 4Q4CA 1XZLA 1GQ2A 3OIWA 5J2TF 1SUCA 2PA0A 2FEKA 3MUEA 3OMWA 3SJAA 3JQAA 3W90A 1G6HA 3IUYA 1U5BB 3D8BA 2P9YA 4Q7LA 3K70D 4LJLA 4DUZB 4IIJB 2EWWA 3ADKA 2V54A 3A3YA 3P5SA 1P1CA 4KXXA 3THOA 1NBME 3AVXA 1KY5A 5DP2A 2C83A 1E2LA 3QY0A 2XE4A 4HDOB 2J5XA 2LV8A 4JKOA 4UDYX 5EMLA 4BTVA 5JT1A 5ENVA 3CF4G 4RNOA 3GGPA 1NL3A 3H83A 3LA8A 4PGMA 3I5AA 5LP1A 3GA5A 3BCRA 4AYWA 4IX9A 4MV8A 1KYWA 3KUUA 3OPYI 4P86A 1C0KA 1ADYA 3IRVA 3LPDA 1ZJYA 4O59O 3WGOA 1YONA 3U4MA 3TW8B 4IRUB 1UXJA 4HH1A 2OHJA 3U3DA 2UXCH 1WXDA 3ZXXA 2WYIA 3NOOA 4KP7A 3TK1A 4D97A 4XDZA 4TRJA 3WGQA 2XTNA 2Q5LA 5HV6A 2ORVA 1RACA 2IY9A 4MR9A 3A9WA 2IZZA 2AQ4A 3EHDA 1UBGA 2JIBA 3M5PA 4PAWA 3KVVA 2W9XA 3MBOA 1ST2A 5EG5A 1NNEA 4CQNA 1K9SA 5DO9A 3OTWA 1FX0B 2PJDA 2IYVA 4S0XA 2CLHB 2QNIA 1T4BA 5MF6A 1ESZA 1P18A 4ZTUB 1F7UA 1U8ZA 3DD1A 3UBTA 2VJBA 2Y1WA 4UHEA 4WEQA 2IGTA 2J48A 2YRWA 4PR3A 1RHJA 1V2GA 3FBGA 2IEGA 4YDRA 3O1LA 3R7WA 5A4IS 5ELMA 1JMVA 2GAIA 2H4ZA 3JQAD 1G5RA 5L4NA 2HLHA 3TR5A 3IUMA 2FW0A 1HXHA 2WSYB 5KEIA 1FIUA 4OQ4A 4CCAA 5EIAA 1L5HA 3HUUA 4LSWA 3D8UA 2PWPA 3GWZA 4BPRA 1NOKA 2NUPA 3NVKI 3N59A 1Q3HA 5I9LA 3L7BA 4FHZA 3KKEA 1GV1A 3MOGA 3NC0B 3LW7A 1LVGA 1QONA 1PDOA 3LLCA 1T8RA 4LFBH 1ADBA 1Z9BA 2P7IA 3D1VA 4CV2A 1CY1A 4TMYA 5JDIC 1N48A 5AHWA 2BFEA 4C6HA 5K0GA 3IG0A 3EARA 4FE7A 3D6AA 4M0LA 4N0EA 1G64A 2B98A 2ZJ4A 1B3BA 3QEMB 5GPBA 3AHCA 3NBXX 4PSAA 2RHMA 3VTZA 5E9AA 1IUPA 2ATVA 2D0IA 4JI2H 1UJ2A 2BHRA 3CE9A 3DPIA 3HV0A 3IJPA 4KFRA 3RSLA 3SDSA 3TNLA 3VZSA 3W3ZB 1EG7A 2HGZA 5MN6A 3U7GA 3T5LA 1ISMA 1UBOS 3D5TA 1JAYA 2R8IA 4OP3A 5KKCA 3FDFA 4RMNA 3UC9A 3E0XA 1R2QA 3WLSA 4B3RH 4INPA 2HIMA 4R8RA 1QLWA 3A37A 4GGMX 2AYYA 1ZY2A 4KXFB 4RFSB 5MGNA 2PO5A 4F84A 3ROKA 1G3QA 2XGMA 4OHUA 1W5SA 4MP8A 5JAMA 5EHZA 3AFOA 2VWPA 4N9WA 5EKTA 2FLNA 2ZSBA 4F60A 3WLPA 4B76A 4MUNA 3JSNA 3IKTA 4UCFA 4A0RA 4JSYA 1LNZA 4CL0A 3WB0A 2H85A 4E2WA 5EOYA 2W8ZA 4IS3A 1GTMA 3LVBA 1PHRA 2QUHA 4EB6A 3W9BA 3OM0A 1C4KA 2FGKA 1DC8A 4EK9A 5HHTA 3GEDA 4LNHA 4DLVA 1VSBA 3BWEA 3GLGA 3JQCA 3T1HB 4X8MA 5D6OA 1DUIA 2CLKB 4RKWA 5IJ0A 1SVSA 1VLLA 1ZAUA 4ZYWA 1ZHSA 4LJRA 4XEHA 3K30A 2BFFB 4BVBA 3L0CA 3Q72A 4R5HA 4BNWA 1NLFA 1KI9A 3O4GA 2WPDD 4A1OA 5COBA 1JDBC 5CJ2A 5TPZD 4NU0A 3TLCA 3Q6MA 4ALMA 1Y4UA 5GIPE 4WK6A 3O91A 3EN0A 4KQCA 4AMGA 2ES4A 4DEVA 2WKRA 4LXYA 4Y2VA 2YCBA 2PUGA 1ZD1A 5BN4B 3FZQA 1SZPA 4QJBA 1QG2A 2XKBA 5FLKA 1E6WA 1ZOOA 4R1TA 4UCWA 4XW2A 3V2UA 4DADA 1P0CA 1XFDA 5DNVA 1I2CA 2CVZA 3KQUA 4NAUA 1WTCA 1C8BA 2ZT5A 1PL8A 2O8FA 3L7IA 4E7PA 2ATIA 3PNKA 5BNTA 1X14A 3L0IB 3MTEA 4IJKA 3OX3A 5GOTA 3OKFA 4U8GA 3RVPA 1WUJS 1YQUA 3OZ7A 4MUEA 3G5AA 4Y98A 3D81A 2CNLA 2GAAA 2GZHA 3T1YB 4OHYA 2C5SA 2ZATA 5H1YA 5LDGA 3RGGA 1U5AA 4YRFA 4FB4A 4BKOA 2Q6TA 3ENQA 2J6UA 2FUG6 3KV1A 3IAM1 4MR8A 3KHKA 5KJEA 4TPKA 4B43A 2QZPA 1YAHA 1L3BA 1QH0A 5JASA 4KXQA 5E38A 3Q8SB 4QELA 1Y1TA 4TVKA 5I9IA 2X2OA 3GJSA 5IXJA 3GFSA 2GESA 3DO5A 3PENA 4JBNA 5E4TA 1Q57A 3GRCA 4ECZA 4KLAA 4ZALA 2XA1A 4PN7A 4YX9A 5IVPA 3L7JA 2PSSA 4MIEA 3L9WA 4PC1A 4YUVA 1FW6A 4O7NA 3HEMA 5UKDA 4MWEA 5K6RA 4OFZA 3HLKA 3PP8A 4QTXA 1IU9A 4ZQEA 3RV4A 4RBNA 1G60A 4HG2A 4E4TA 1EAYA 1V95A 3FKSA 3A0UA 5E8RA 5FJ8G 1DG1G 1GRQA 1IH8A 2CXNA 4PFJA 4R0NA 4YJGB 1CPYA 3NH6A 3EIUA 3MR3A 5LMCA 3QKRB 5J2UF 4HUQA 3IAAA 4OYRA 1WEKA 3JYQA 5FL7A 4AWAA 1I13A 4M55A 1C1DB 3E8XA 2O0KA 2QM8A 3LYHA 1PYGA 3E84A 5C8YA 2FEWB 4O6VA 1XMOH 1PT6A 1FJHA 2FRDC 2F9LA 4YRCA 3OTOB 1XDUA 1JFTA 2C4UA 1G8GA 1NX9A 3PIIA 5E95A 2W9AA 4UMDA 3EFOB 4LEIA 1V8OA 4EBCA 1ONOA 4MDYA 3RB6A 3P0EA 3N05A 2EX0A 5B7QA 3OKAA 5KG0A 3H20A 1OI2A 3PG5A 4CMCA 2I71A 1O54A 4LVUA 4R81A 2N0SA 3EULA 3CSDA 3C8UA 3BKXA 2V3WA 2ZQYA 1E8MA 2JI8A 4OXQA 4LGYA 1P2BA 5K6AA 4DIMA 3OQHA 4NI5A 2C88A 4B4WA 4CR7A 2CT8A 2XE6A 4LYAA 3ZCPA 4QU8A 4B0PA 1R0RE 1SCKA 4I1UA 5FHQA 4BTEA 4CV1A 1ZVKA 3FWYA 1THGA 1HL7A 4Y6PA 2B8TA 3EVCA 4QBKA 5BNWA 1R0YA 2VO1A 3Q12A 1Z8HA 1KJ9A 4COOA 2R1TA 2RHLA 4WBNB 1GO2A 2VH5R 3NWEA 4ZYXA 1LI7A 5FF9A 2QRVA 3M6VA 4Z5XA 4ZAVA 3GVHA 4BYMA 2O8BA 4GI5A 2QENA 4N8SA 4ND3A 1H85A 1O0SA 3LIPA 3R6GA 4KYVA 1S2DA 3JAMW 2OLKA 1J22A 3P2EA 4LHSA 1HOTA 1GFZA 1I1HA 4KWIA 3P2MA 3A9TA 3R3XA 3T7DA 4J0IA 2QL7A 5IJWA 5JPCA 1BGVA 3H0CA 1BFKA 2FHPA 3TR0A 5L9AA 4NZMA 1RYFA 2W4QA 3FPEA 3K2QA 3A9CA 1KFCB 2ZTHA 3BFKA 3EEBA 1D4OA 3GJQA 3JQQA 4G3IA 1T0HB 4QSHA 3R6WA 4MUIA 3VX4A 3WQQA 5IDQA 1OWTA 4G5OA 3ZDRA 4OHFA 5LFAA 4WEOA 2W2LA 3RYCB 3W5BA 4BIIA 2PBZA 4YY3B 4BWGA 1XZKA 5FWXB 3CWQA 4TX1A 5TVGA 1P4JA 3HYNA 3OJCA 6ABPA 2NADA 1P6QA 3JZMA 5FOQA 3SZUA 1L6IA 1F0KA 1GKLA 1ZJ5A 1DSSG 3LA6A 4TXLA 4JI4B 1RMQA 1EP9A 1KJNA 1JE0A 2QR5A 2W8BA 3EVNA 1CVLA 3OJ0A 4K9MA 4P36A 4P7GA 5CM9C 3NTLA 4CQLB 1C2YA 5KSWB 2BV3A 3K9QO 1MIOB 4CPDA 4DV6B 1JBQA 4R2HA 5LZ8A 5I3CA 5KTSA 4XQGA 1G3RA 1TVCA 4PZDA 4O3QA 1RCTE 4U7DA 3FPKA 3NORA 4RYDA 2Z95A 1W1UA 1YI8A 3GUUA 4X8LA 3UICA 4GSLA 3WKDA 5LPNA 1V47A 3AEKB 3EGXA 5DNEA 4MAMA 3HB4X 1PWXA 2I7TA 2Y0SE 4OXKA 1IMOA 1PLLA 1SCUA 4UE3S 1BGXT 1XD9A 2Q5JA 4J1SA 1PWEA 4HGNA 4ZXFA 3ROFA 1C9NA 4U7CA 2DU8A 1RI5A 4HRAA 2C82A 1J8QA 4KMOA 2Q4DA 1RWKA 2Y93A 2COUA 4NBTA 4XLZA 4Y7CA 2R9VA 2W0SA 1R4NB 3OQBA 1Z08A 3ORFA 2JBHA 1DIHA 1CVRA 1K7XB 2PA3A 3GTMA 1GPWB 1NVMB 1NW5A 1ZGZA 2YY5A 4F56A 3RADC 2IS1A 1U0NA 4MR7B 3NHRA 2Y1LA 1QZUA 1N7IA 2FW9A 5BORA 2E2IA 1XLUA 4D0RA 1EQUA 2PUBA 4AM8A 1KZ9A 2SKCA 1EKVA 3EVBA 3WVNA 4CMIB 2JCXA 2IOQA 4JT2A 1RC0A 3N2ZB 3TDKA 1L5GB 2HG8A 1JKMA 4Q7KA 1QKJA 4QQFA 1UADA 1BWQA 2I5PO 1ST3A 1TI7A 1JPJA 4JQZA 5CVVA 4YPVA 4WESA 1Z56C 1KK1A 4NU8X 3VDRA 2WYHA 1ENOA 4IUDS 2BFPA 1QVWA 4CV3A 1S2IA 1T3NA 1NQTA 2BEVB 2XOXA 3ZHRA 4ND2A 1CUBA 1JEDA 2WFZA 2QPTA 2XNKA 2ZJFA 3C0KA 3HS3A 3L04A 4JC4A 4KIJA 3HCPA 1CY7A 2R82A 1CUYA 3ADCA 3GFQA 3N2GB 4NDNE 4NHOA 1C81A 2JVKA 2H5JA 2X7JA 3TPCA 4QXAA 4NLLA 3TEJA 3CUEF 2I87A 3IP6A 3QVXA 4O4LA 5F1YA 4AF6A 3RTAA 4ZV7A 2EJVA 3FDZA 2XX3A 4LRTB 2VJYA 4CC5A 3FIJA 2HHFA 4MCIA 5KG5A 4JV5H 2N75A 3GJRA 4FC7A 9LDTA 3ZHTA 1BE0A 4CKBA 2LPMA 4GC7A 1FYWA 3I39X 4RPJA 2WNHA 4O2BA 3S68A 5KOJA 3H1GA 4MQBA 4NWIA 1OW3B 1PKXA 3GJ5A 4XEUA 5EJGA 4D9FA 3TS1A 4YJFB 2ZAIA 2RONA 2ZVPX 4Q4HA 1U1DA 3VC3A 3CEAA 1F9AA 1CF9A 4UFZA 1FJ2A 2C1XA 3AHGA 4ENPA 3EEOA 5U1PA 3PPIA 3WIUA 1R16A 3RYIB 4HGYA 2XF8A 3F74A 3KZCA 3EZYA 4E5KA 2FA9A 1Q11A 3VV3A 1KVRA 3MT0A 5HOEA 4E5DA 1QIJA 2QF7A 5DIFA 4KIWA 1RBMA 3UJ3X 1GZSA 2GJSA 2W7TA 1HE1C 5EWFA 1RZUA 2Q2NA 3HUTA 2VNKA 4CMDA 1W9HA 4LHEA 2WJZB 3A1FA 1E2GA 3GW8A 4WJKB 1FS5A 1S8AA 4P7BA 4WERA 2GN2A 1H94A 4GHWA 3VSCA 5JS7A 1QE5A 3EASA 3R5HA 5CGZA 1I3QA 1EA5A 4Z4IA 1IBMH 4N5NA 4GWLA 2CXPA 2XIQA 3MVEA 5LP6A 4FWTA 1GVNB 3LX5A 4NATA 1Q7TA 3C6MA 4PRLA 3TTSA 2FZKA 5KYUB 3GG9A 2DWOA 5HFJA 5DGXA 1W0KA 2PXAA 5AM3A 1NVUQ 4OY3A 1NE7A 4G1MB 2DOKA 4QHYA 2CNKA 3DWIA 4UEWA 1O95A 3SYMA 3AONB 4IO1A 3ORSA 3S29A 1Q12A 4GP6A 3R09A 4XQ0A 4LBYA 3VU0A 1A9XB 4DR6H 5C5DA 5ECGC 2VAXA 2FW1A 3F97A 4DYHA 2RDIA 2V0NA 1DAEA 3BA1A 3BB1A 4D9KA 5L53A 3B20A 4HDCA 1I7QB 2H7CA 1K5HA 1IJBA 4GVLA 4QUDA 5E9WA 3V32A 4QM6A 3G6XA 4OHRA 4DCUA 4WHXA 3F4KA 2AJTA 5KVSA 4EY6A 4G1CA 4KUEA 2IDKA 4HVLA 2RC6A 1NM5C 1UBKS 3GVCA 4QBIA 1I6KA 2IZ0A 4C4PA 2AV6A 1CRPA 1MVLA 2X3FA 3VO8A 1O5OA 2B92A 4HQKA 5EZSA 4FOPA 4PX2A 2G1JA 3MINA 1Y5NA 1Z34A 4CG1A 4D96A 1QWOA 1DKNA 3PXCX 3TSOA 1MEEA 2V7PA 5CFOA 1D1SA 2GK6A 1T15A 4D9EA 3U0BA 3GRKA 2H06A 3ZCSA 4ALJA 3I30X 3WE7A 4BDSA 3U3KA 1P2FA 4GWKA 4CJXA 5BVGA 5ESXA 3E9NA 4B3TH 1O9BA 1UM8A 2XCIA 3AUUA 1MW9X 2HK9A 3DFUA 3FSRA 2QTVA 5B6JA 4R31A 3IOCA 1NFRA 2GJAA 3HB1A 4P83A 1CX9B 5CDUA 2UXBB 2PYDA 5J58A 4O7WA 4JVMA 3M4NA 5FWDA 3DKRA 2LCFA 5ENDA 3EQ2A 3QEMA 3WRWA 2PBFA 2AYZA 2N3ZA 2C61A 4G0XA 3U4CA 2CJYA 3KHRA 2VNHA 2RGBA 4AECA 4EECA 2WYOA 5HYVA 3Q7IA 2WE8A 5T64A 5A04A 4RO0A 2ZBFA 4PHCA 2YV1A 1R4MB 3OHPA 4OGFA 5IT9A 4MZXA 3PNQA 1EDDA 4QGGA 4YBZB 1R8SA 4DIOA 5F9MA 5L3QA 1LWOA 1A9OA 4V0QA 5KB3A 2J7PD 2F7SA 4XR9A 1E4VA 1JR4A 4HAXA 1EWKA 5G0TA 4RORA 5JIBA 2AFIE 2IYLD 3V6LA 4EGQA 4FCTA 3S8YA 1F48A 2ZRDA 3IIEA 4RZ2A 2LCIA 3P9QA 5EMKA 3VO2A 4KGDA 5HW0A 5EDWA 2Z4SA 1C3VA 5DOVA 4DAAA 1KYZA 3JR7A 2OLSA 3RU7A 5AW5A 4H3KB 3VJMA 4XFJA 1YR3A 3EH2A 3I12A 4YB8B 3ZE1B 3PGJA 4BFSA 1FYXA 3E8SA 3VR3D 3ZV5A 1DG9A 1I2BA 3HACA 1FUEA 1M7BA 2UUAB 1U1FA 4IMIB 1CEQA 3PX3A 4Y2HA 5FPKA 1E5LA 2FI1A 3KYCA 2HW8A 2AZXA 4E5SA 1N5KA 3EIFA 2VUTA 2AEMA 1ZGAA 4G1VA 4ASUA 1N1EA 3PPXA 3O3MB 4P82A 4YC7A 4DZRA 4ZT7A 2JGMA 1JT2A 5E7IA 1NLYA 2CW5A 5H3LA 1DZ3A 2VSFA 3ED1A 3I28A 4PLGA 2XB8A 4Q3OA 5I6DA 3R9WA 1HE8B 1KO1A 4GXRA 4Q0MA 4WI1A 5DMXA 1HOXA 1KQOA 1TX4B 2JVIA 3AZQA 3SGIA 1EAMA 2C2RA 3CSUA 1MEJA 3KL4A 2C7BA 5F35A 2Z2KA 5JWOA 1Y7IA 3BREA 1PJAA 2H63A 4X8HA 5B6IA 1EMDA 2GHRA 4Y18A 2NPFA 1R0KA 3W2GA 2D0PB 2XQFA 3GPCA 4RNCA 4F2GA 4O7RA 3KXDA 3KZVA 4GOXA 4XGKA 1KC3A 1UBJS 3FZGA 3N2GA 5A03A 2VATA 3BSFA 1YF3A 3R9IA 2HSJA 4JUZA 4Y2QA 5C18A 1I1QB 1NR1A 3HI6A 3N7AA 2R751 1GGHA 1Y80A 3QE3A 3QTBA 3TLZA 3WRXA 2PRKA 4IOJA 3GO4A 4EFLA 4MLDA 4OQLA 4ED8A 1E2EA 1TC1A 2F3PA 2YXEA 3TTUA 4YJ3F 3IQFA 4P3NA 2HGXA 1UKYA 4K86A 4Q7EA 2AGPA 2V96A 3QUAA 4DPLA 1HNWB 1KAMA 3GIDA 2IQIA 3L8GA 3ZZNA 3UZBA 5B4VA 4D42A 5C8DA 1O58A 2WAQA 4QFCA 3OU2A 1N6PA 2NO1A 2VXOA 4GRDA 2TRSB 2OCBA 4GRIA 3TZBA 4CTKA 4ZO8A 4Q4HB 2WIFA 1R12A 1V7ZA 2QDXA 3M6XA 3D3WA 4PZ0A 2R6HA 3RC1A 1YVPA 2BR3A 1ADCA 2WMNB 4DHWA 1SB9A 2AZMA 1XRMA 3NR2A 2TS1A 3UGKA 2HN9A 2VP3A 4NZNA 4ARVA 4R8SA 3VZRA 3CC8A 1BDJA 1TUIA 3A3OA 4MVWA 1NTOA 4WXRA 4BE7B 4B40A 5LB2A 3WQBA 3W1VA 3Q88A 1H5NA 2NGRA 2Z43A 5C1OA 2F3RA 1NLUA 2DR0A 3DCNA 5HCUA 3QKRA 4JX9A 1N1MA 2XMRA 5FNZA 2R4TA 1J07A 3WNVA 1H6BA 3PQEA 4TLCA 3H04A 5BRJA 2PZKA 1HT0A 4LBVA 4MVJI 1UBUS 3LOUA 4REQB 3A9SA 4LX0A 1PK8A 1CZOA 1HETA 2CMDA 3HKBB 4WOCA 1DLIA 1XSEA 3UT0A 1MJNA 3DA8A 5JYDA 4BX9A 2EFJA 1Y3FE 5CYOA 5B53A 3IJRA 4DCGA 4MDFA 4PWQA 2EU8A 1N6KA 1DC6A 3JTMA 3MRVA 2O0HA 1VPTA 1GCOA 3KCQA 3PR5B 4IDPA 4EHJA 4QG3A 1VJ1A 1AKEA 1V26A 4IDNA 3A6PC 1N5LA 3NBFA 2GM3A 1IPHA 3CINA 3KZXA 3LUKA 4QLBA 1QBGA 1RM0A 4TKUA 3N6RA 5DTIA 3W7AA 4YCLA 3OF5A 5CCBA 2R79A 2XKKA 2PFGA 3HE3A 4P22A 3UJBA 4K0KB 2XZOA 1TC2A 1XTQA 2OWEA 5BUZA 3ZNPA 4R9RA 4IGIA 3K8QA 4LZPA 5FJIA 5DSZA 2EG9A 3KAPA 2W6JD 4UDXX 3U4QB 2PQ2A 3FM9A 3G88A 4EFDA 5KX5A 1ZOLA 4PSVA 3VSDA 1O6CA 4DVGA 2FZCA 2WIGA 3QEJA 5EZQA 5TV2A 3B1YA 2R4UA 3CU5A 3DZKA 2Z3VA 4FYIA 4GYYA 4RHTA 1PFYA 3AF5A 4WKNA 4KQJA 4Y0NA 5EY5B 3IEPA 1ZJWA 5JH7F 1WB4A 3GEHA 3H2BA 1R0CA 4M1MA 4AYBA 2I67A 2BDUA 3TOXA 5LJIA 1U7PA 3UMGA 1SOMA 5IM5A 5ANRB 2NU8A 2QVXX 3NC1C 5TB5A 2H1IA 2AFHB 4DV7B 2A0XA 1N4DA 5EWEA 3ZE9A 3IE1A 1YA6A 5I7RA 3MR6A 2AG0A 3D8SA 3MA0A 4U2FA 5LZ7A 3TXAA 3DXZA 3AEUB 4RSGA 1K83A 1OXUA 4H16A 1JGTA 3HJUA 4CM4A 2GJ4A 1F06A 4NONA 5FD6A 4KPUA 1KI7A 5SV2A 2DT8A 4FI3F 5I7VA 3ZVNA 3F1KA 2VDVE 4KPFC 4LXQA 3AXTA 4I5EA 3RVNA 1TT7A 4ZCQA 4C0QC 2X42A 3INYA 4DF3A 3CZ4A 2CDNA 3L0ZA 4HDSB 3IUNA 4YRPA 4KEAA 6ADHA 4F4HA 2A1UA 3PICA 3QVTA 4ZVLA 3L8CA 3GUYA 4J4HA 4CQMD 4DLRA 4Q05A 4CKCB 4KPYA 5D3KA 5B57C 3OPYB 1NJ2A 3IGFA 1KYXA 4Q9KA 2F8TA 2O9JA 4G2NA 1TKAA 5GVSA 4E88A 4KRYA 3PDUA 4RUCA 4C21A 3QKSA 2DSNA 2XVMA 4B3BA 1MX3A 2R0QC 3LUPA 4FYVA 4DMMA 2GD0A 3KJFA 3HBFA 3N8HA 4WZBA 1UXIA 4J0DA 4XD7D 4X00A 4F5YA 3FRHA 2LIVA 3ELWA 3JQEA 1NXSA 3R0QA 3ROPA 1ND5A 1XQYA 5IBQA 5IH3A 3FVVA 2H0QA 1J20A 1J7JA 4HNVA 2LR0A 3HI4A 1GZ6A 5E25A 1EVZA 3M1YA 4YIKA 4DM3A 1G17A 3W4JA 4XWTA 4LJ4A 1HZZC 1CZLA 1LBEA 3PJFA 4NCKA 1M72A 4PC3A 4PTZA 2JPDA 3H3XA 3OSPA 2J4DA 1ZK1A 1CUXA 2C0PA 4TMFA 1COWD 1ISSA 6CHYA 1WQ3A 1Z2NX 4O4IF 3DLPX 4D9MA 2QXTA 3D4OA 2X76A 3Q11A 4G8DA 4R2WA 4D4JA 5IYBG 3ZHUA 3H4MA 5FDFA 5LQCA 1LNQA 2GWRA 5F52A 3OJLA 2B2NA 3KZOA 1V35A 4MGEA 3U62A 5I7FA 5B1DA 3SLKA 5CT4A 3U40A 5KWIA 2HIXA 1QC5A 3IILA 1Y5LA 4H1HA 5AUNB 4LTMA 2IRWA 4M1OA 3HCBA 1DO2A 3K1YA 3LRPA 3QUSA 4QOSA 4MB2A 4EM6A 3U13A 1ACLA 1G5FA 5C3EG 1O97D 3A4MA 4GYWA 5GGYA 1JHOA 3RTBA 3ZWWA 1K0FA 3KKKA 4IM7A 2WSSD 5B1HA 1TM7E 1KNQA 1NN5A 3Q10A 4INJA 1S0UA 1Q1GA 3TY9A 2DUMA 2GJ9A 4BO8A 2G36A 2PUHA 4YRJA 4C06A 4W8GA 4JBGA 1ZIOA 4YNBA 5D7BA 5JUMA 2H1FA 5JMOA 3FTFA 4EQ5A 1PJZA 2Y71A 2R7MA 3E0QA 1PUJA 3QMPA 1RJ9A 2UVUA 1RWNA 3GJ3A 3K0BA 4YFVA 3UK6A 2IS2A 2Q4BA 4O7LA 1WQ1R 1HDXA 3OY7A 4TTVA 1MV5A 5L3RA 4DMKA 1J2TA 2AMFA 1IBRA 3SZGA 1RR6A 3E7FA 1LSOA 3LWBA 1A2QA 3PB3A 4J7CA 4IH4A 4P0TA 3F7NA 4EBBA 1FFXB 3HOZG 3DE1X 3NLLA 4QOFA 5KHLB 2G63A 3SEQA 1EFRA 3QE9Y 1OYYA 1INLA 4JFAA 4F12A 2F43A 3CEMA 4PZAA 4QYIB 2PSDA 1ABBA 2FETA 5AJYA 4H7JA 5AVKA 3WIEA 2IPOA 1KH2A 2V5UA 5H5JA 3RVMA 1XPRA 3HOWG 4J1QA 4P7KA 2WSLA 1R0ZA 3BFXA 3CEHA 3EXFA 1P1JA 1TF7A 1O1YA 3FCCA 4HNRA 3U48A 3UMYA 3QSGA 1MV8A 4O3FA 4A92A 3Q2OA 4BNDB 4CW7A 4D9JA 2OZLB 3HJGA 3QENA 3GJ7A 4MYCA 1OSNA 4NZOA 1IIBA 4U7HA 4X63A 5I7WA 1OOEA 3DEAA 4GVPA 1XCMA 2IPAB 4XUEA 4ECQA 2P9ZA 4MIYA 5I8PA 1N2CB 1GQSA 1YC2A 2E87A 4RIGA 1IOWA 3T9BA 3FYSA 4L3VA 1FY2A 2PKCA 2QT1A 2YS6A 1H0RA 1TGVA 1TEVA 2KS6A 2DE0X 2HDHA 5KFPA 2ZBRA 4M9SA 2OP1A 4RA9B 1YZVA 2HF2A 1ESMA 1QBKC 2PIAA 2Q6OA 4PWYA 5K2MA 4RDCA 4WVLA 1B8NA 1JXOA 1X39A 3WQRA 2E1PA 3D2LA 1Z5GA 1J8MF 2VAWA 1QK4A 4IQ4A 4XGIA 3SHVA 1ZK2A 1L8AA 3OURA 3OKCA 5H9WA 2VWQA 2R7ZG 4R40A 4EPRA 2VC2B 3A3NA 1VHJA 2A92A 4PZLA 1V39A 3NVMB 5BR8H 2B34A 1ORDA 3VNBA 1ACMA 4HVAA 2J3HA 2XKJE 1NG1A 3WBJA 1PBTA 3ONNA 2GUWA 1VHDA 2B1RA 3DFFA 4HDAA 4C0AC 4DUGD 3WIBA 2PX0A 3AIOA 3T5HA 2ZRAA 3O8LA 1PWYE 3TGWA 3VTFA 3U4QA 1DZIA 3BFVA 3EB9A 4FC6A 4P3XA 5LP6B 3G0CA 2X1MA 2Y05A 1P3JA 4DSNA 1FP4A 1Q20A 4RMHA 3KALA 2R1UA 1ZXBA 2RGYA 3AY0A 4BKPA 1XTUA 3DVSX 3E22B 4UATA 2PMZE 4UW9A 3SBDA 3WB9A 5BSWA 5LNK1 1HR0H 3DQQA 3HABA 2HH9A 2CDRA 3EPRA 3O6VA 2E6KA 1JTEA 3QEOA 4DV5H 2NU8B 4M0FA 4N1AA 1E98A 5SICE 2AFHE 4YCBA 1KOJA 3NANA 2PH3A 3KB1A 4JEMA 1C3JA 1EXMA 4KAFA 3RBVA 3RVKA 5AK4A 4US2R 2DIKA 3ZBPA 2B9VA 2IYFA 3E9CA 3W2TA 4X20B 4B6JA 4BV3A 4E2XA 1A8IA 4U7FA 3HO1A 1RTKA 1DO8A 3FLBA 5F9FA 4ZVMA 2CXSA 3AR3A 3REQA 1JXAA 4OIMA 2OHXA 4P33A 4YDSA 2C1ZA 4X93A 1H2BA 4C2AA 4L8VA 5CFZA 2FPUA 3HKEB 4FGZA 4YCCA 1TKBA 2H08A 2HPAA 4C0KA 5EINA 2Q1UA 1XF9A 5GJWC 3DTYA 3WRXC 2FR8A 4V1CI 4HBZA 2WTUA 4JYPA 5G0SA 1SUWA 3C8ZA 1W36D 4UU7A 4LGMA 2GOYA 2J1LA 5BYJA 1IATA 4DA8A 1TAQA 5JVLA 1UC4B 1GSAA 2XMCA 3HA2A 3ICCA 3OQ1A 4IIVA 2MYNA 2R6AA 4GBGA 4MJXA 4RKRA 4B4UA 1POXA 4ILKA 3WKAA 1SAYA 2VHUA 1HG0A 6AT1A 3NPAA 3N8GA 5F77A 3ECCA 2V5VA 4DRXB 4FWBA 1SUBA 3QKSB 1OBCA 4FFDA 3UMJA 4JP5A 5IG2A 3EK2A 4C20A 4K7JA 1MFZA 1NMZA 1ZK0A 1Z8DA 2HWYA 1FK8A 3LUDA 3QWBA 1EDEA 4QGFA 2X9QA 3MXOA 4MMXB 2F2TA 3FRJA 4X1OA 2KE5A 5IU6A 1G4UR 2PLAA 2WLSA 2VQDA 1IMJA 1RS0A 1VLVA 1ZD4A 2H3HA 2JCVA 2LKDA 2JHGA 1NZJA 2ERXA 4KYUA 3W5JA 2V6JA 2W2XA 1CBUA 5DH9A 2IJGX 3L4BA 1MRNA 4EEXA 1U1CA 2CNUA 2GCOA 2Q5QA 4J7UA 4RUKA 4K0KH 2J6HA 1WMAA 3JQ7A 4MAAA 3HYSA 1GTG1 4TUYA 3VU9A 1I5OA 4PNPA 1DBRA 3MCAA 4ZZ0A 2Q5FA 621PA 2GILA 4AN4A 1ISGA 4ZYVA 3R3UA 1DKMA 3GTQA 1ATZA 2OBNA 2OMEA 4Y1GA 5BSGA 1S8FA 1SKYB 5JQWA 1NI5A 2XC9A 3K1TA 3OVMA 2OO3A 1BOOA 1JH9A 2I34A 4MGYR 3GRVA 1E3IA 5CX4A 3TZHA 2NO0A 1RXYA 4GMXA 5L7TA 2YZLA 1RC1A 1YQ9A 2WQ7A 1JN0A 2E49A 1E2JA 4RTNA 4YCDA 4P38A 4G26A 1L7QA 3AEQA 1FRFS 2H8KA 3PC3A 1RSZA 1AQJA 5F33A 4NSNA 2AJBA 1R4ZA 5IAGA 1I7LA 4O3RA 1VKOA 4AJIA 4CODB 3HUFA 3HJBA 2WWHA 1G9SA 4TS9A 5D2CA 3WYFA 3DAYA 4OX9H 4V03A 3R1IA 2HHJA 4A27A 3GAFA 4P0PB 1LX7A 2ZU6A 2J9RA 3ISVA 4GPD1 4FDAA 5JSKA 3CKKA 3F9IA 1Z6YA 1XAGA 5B37A 1XUOA 4RU1A 1GG2A 2IK8A 3LZCA 4LK3A 4MQEB 2QHXA 3ZE8A 4BVFA 4C0XA 3I5YA 5FPSA 3TRIA 1II0A 4P7FA 4XARA 4D44A 1IYEA 2FMTA 2CNVA 2GVNA 3NP9A 4QOJA 4Q8FA 3FWPA 1V1RA 1Y8AA 1GNQA 4WLNA 5ALSA 2FGJA 4YREA 3LX4A 1FTGA 3ELYA 5ALEA 4GLLA 4MYTA 5DB4A 4U5QA 4Q1FA 4GQBA 2NSJA 4IEFB 1CUJA 3AZPA 1HRDA 3C1TA 3CX8A 3IAS1 4ZOLF 3KXPA 1NSYA 5ARCA 5JXHA 1EFLA 2OO5C 3RARA 1OKKA 3KVNA 4KKVA 2FR1A 3SC3A 4QQNA 3OQMA 4QGBA 1W35A 5CNKA 3OOEA 1PKEA 3SR0A 2C2HA 1Q0LA 4PXSA 2Y0BA 4PNHA 2MSDB 4UAGA 1BVHA 3ZWYA 4TV9F 1TZBA 3IQWA 3X1WA 3ZK8A 3ZZUA 1O96B 3RGXA 5TQVA 4ZVOA 5C37A 3D6NB 4RD1A 2EQAA 4REQA 4MQ4A 1N2CA 3L6EA 1QV9A 4GX2A 3JYLA 3VPDA 2ZVQX 3DVQX 4RWZA 4XYMA 3D3WB 1SOVA 4PFKA 4ERNA 1V43A 4U63A 2YZMA 3ZJVA 4P4UA 3P9ZA 4AMZA 3U3MA 4WW0A 3NTQA 2V4UA 2IDMA 4F6RB 3IHKA 3RUDA 4L51A 1Z4NA 1FW8A 4EPXA 4JXZA 2HWKA 1DMSA 1MB2A 4G9BA 3E9ZA 2HUNA 3GGDA 1YDHA 4IICA 4Z0NA 2QQEA 3IIJA 3TW4A 3UATA 4Y6LA 4QDKA 2BISA 4HF7A 3IQZA 1ZLXA 4L08A 1BHO1 3HNRA 3TQCA 2NP7A 3T7AA 3ZQKA 1EJBA 1Z5ZA 1AQNA 3AT1A 2GEUA 1OE0A 1VP3A 3GP5A 4HLDA 4W5OA 2IPXA 4QXMA 4R1SA 4ZANA 4MYRA 3M3DA 3G2NA 3QEAZ 2HI0A 4TMZA 1XWFA 2Y1FA 3K9BA 4ITVA 1G16A 1CQJA 3K8OE 2YBEA 2BJWA 1PUXA 3G5UA 2AJLI 1KZ6A 1LY1A 2WG2A 1C9YA 3CPSA 4FIDA 5G0UA 5U9CA 3Q9SA 4GIBA 1GZUA 4OX9B 1JG1A 1RM5A 4XIGS 2RC5A 5T3YA 3NTXA 5HS6A 4YTEA 1LTKA 4Z4HA 3SNKA 4YMLA 3C3MA 4G24A 5FLYA 4KIGA 5B58T 3LMLA 1M6YA 4W1PA 3KSMA 3QE0A 3Q8LA 1YS9A 1EIZA 1D5CA 3VI4B 5LMUB 3PHJA 3ENVA 1NJGA 1R9GA 1TZKA 2EZTA 3BJMA 4I3GA 1K8QA 4TXNA 3BDAA 3ZHOA 4AKTA 1YRYE 4RVNA 4ZVRA 4E12A 1KQGA 4FFOA 5C52B 1EP1B 3IAEA 5LZ5A 1XJ0A 1NBMA 5DI3A 1ZA1A 3N5KA 3OQIB 3L9XA 5AWFC 1I10A 3UAYA 5DNDA 3UMSA 3BT7A 3C4QA 2PJZA 5CFMA 4BJ6A 5C44G 1N9GA 2RAFA 4R98A 1G55A 1D09A 4ZT3A 2OEPA 1LDNA 2X22A 3AM1A 1DRVA 1Q16A 2J9ZB 3KUKA 4RY0A 5D6NA 3TQHA 3ND9A 2AR0A 3AR6A 5G0WA 2KSQA 3VO9A 5B3LA 2Q8NA 3GZ4A 5FPYA 4LJKA 2Q0QA 1XZBA 3S3TA 1O9HA 3UJ6A 5ES4B 3LHSA 3O8DA 3B9RA 3BCSA 5AK0A 5K3BA 2QVYX 2YYAA 2W37A 3AUKA 3DVRX 1C8VB 3T3HA 4D79A 5AW2A 3VR4H 2QAGA 4YUAA 1MA0A 4D9GA 1OC4A 2YXBA 1LLFA 4DL4A 1DEOA 3H42B 3PNMA 3WHIA 1G20A 4NFSA 1J21A 3AIMA 3D5EA 4TLAA 4NBWA 1ORTA 3TVTA 4WLFA 1TLLA 2QD3A 3EFEA 3OWHA 1JXLA 2N46A 4IIXA 1SXPA 2I2DA 4DCJA 5HUQA 3A3PA 3BJIC 3P71T 3SQWA 3AX6A 1ADJA 1KK3A 3MC1A 5EE9A 5A7FA 5C8ZA 3GAMA 1L5ZA 4FONA 3BJYA 3GFOA 5PNTA 3ZU6A 1P29A 3NEPX 1N0UA 5FI5A 4ZZIA 4FS8A 4IUCS 3TIGA 2IXBA 3AY3A 3EWIA 4UTZA 5ALQA 2JAHA 2Q6VA 3TTVA 3W8FA 2HDKA 2JG3A 2O7QA 4BAGA 1QSGA 5DLQC 3AVUA 1GL6A 1LB1B 1ARZA 1RVV1 5CM2Z 1MVNA 2FSHA 2X0SA 3BERA 1P44A 3C48A 3NCTA 5J4YA 2ISSD 1JAXA 1DE0A 3L5KA 1P3DA 4Z2YA 1OIWA 3UCXA 1B2RA 3I0ZA 4GM4A 1Y1LA 2WFAA 3VISA 3H2HA 1TCVA 4MGKR 3N0TA 4CF5A 4NXMH 1AZSC 2H2FA 4O84A 2RGUA 3VR5A 4Q18A 1L9KA 3ODPA 4EGSA 3C7DB 4EYQA 2WDPA 3PO3G 1YS7A 5TSDA 2QTHA 3OCWA 5AVYA 2I65A 4ZRDA 3ZW7A 3RBAA 4GPEA 3THWA 1JKXA 3UJ9A 3HB9A 3PQ4A 1QIFA 4OJTA 5K9ZA 2QVLA 1NW4A 2F1OA 2GCEA 1RWVA 4JFRA 3ZDEA 1R27A 4OPMA 2J0VA 1HNNA 1CP2A 1N6LA 1VYHA 1ZOPA 2WIKA 2QRMA 5BWXA 1GPAA 1CUVA 2HD4A 4XM0A 5DDIP 5J3JA 3ZQJA 2Q6IA 5ALZA 2PZEA 1A7AA 2VPIA 2PMFA 5H02A 5P8WA 3WYEA 2AOWA 4C7VA 3X2SA 1CY4A 3DE4X 1OWNA 4IGAA 1NI3A 3LJKA 1OFIA 3UHJA 3RLFA 5BN4A 1JG4A 4E4RA 3VYRB 2QZ4A 3EDQA 2OFFA 1YJAA 3FB4A 5KAPA 2Y1KA 4E21A 2GK3A 2JLSA 4QFBA 4CDMA 3CGWA 3PF8A 1QAMA 4D8VA 3QLVC 1WZIA 2BHLA 3IP5A 4MSUA 4BAZA 1QH9A 4PVCA 4CMKA 4YUZA 4PN3A 3O0DA 4FTWA 5CE8A 3CR7A 3I73A 1JJVA 5CNIA 5JCPA 1NT4A 3MB8A 4O81A 1E2MA 1KETA 2EW8A 3DOJA 7GPBA 5EN4A 5A3JA 3EPHA 3H5TA 4MV3A 3GIPA 4Z51A 1U2SA 1XVLA 1HTWA 2PKXA 2UZ1A 2X9VA 3R8CA 3EBLA 2XQIA 2W57A 1IZ8A 1K63A 1W76A 1I8TA 2MWMA 3F9CA 2Y0CA 1XR3A 2PZGA 4L07A 1TK9A 3K9GA 3P94A 2WDTA 1TQ8A 4EF5A 3GLIB 3PGA1 3E3LA 2XTMA 1TO6A 2A9OA 2BAGA 2X0JA 1WPQA 4H4CA 5ADUS 5IANA 5KQPA 1W1IA 3BWVA 2B20A 1YVDA 4U9UA 2FSGA 3BDVA 4IIUA 1BW9B 4ZOCA 2FPRA 1CR1A 3VR3A 1LBHA 3CRQA 4NAVA 3B89A 2O5RA 1XZFA 3T7EA 2ZE8A 1DJOA 2B63A 4LJ5A 2QTRA 3FCOA 2PIDA 3TBHA 4IZOA 1IONA 2OCGA 3S4YA 4H1VA 5H0IA 1EDBA 3KXIA 2O23A 4W9NA 5F5NA 2WD9A 2XMZA 3EQ6A 3GUHA 4HDNA 4ASUD 3EIEA 4L7QA 4JLSA 3EWAA 4NJMA 1JMKC 4WUTA 3KEOA 3EXFB 3PQFA 4OP2A 2JKVA 4I2VA 2HIHA 3KOUA 4M89A 1C1DA 3SOPA 2SCUA 3NW9A 5AHXA 3FIUA 3WGGA 3ZX4A 5K0CA 1YR7A 3MEQA 4Q19A 3DHNA 4QYTA 2FFQA 2CW7A 3CPJB 2GM5A 2UU9B 5GZ6A 3ESXA 2Z98A 1T2AA 4NNOA 4OUKX 1J5PA 5DV9A 2ZUEA 3B6EA 3HEAA 2R4QA 1YIOA 5CNJA 2ZU0C 3WXBA 5FI1B 1GDHA 3JQFA 2JIZD 4DL6A 1ML4A 1E58A 1N7HA 3QX7A 5LQKA 2ID4A 3DMYA 4A2WA 3INNA 1ABFA 2B36A 5I9MA 4B2LA 3QHQA 4EA7A 5CDFE 4QBGB 3LDUA 3L01A 4I5GA 4X1KB 3U3XA 2ZJBA 4E46A 1JXQA 3A1DA 4B3SB 4HAYA 4I5FA 1OQAA 2YOGA 3J81k 2VG8A 4YEDA 5AW9A 3KVOA 4ZIRB 1YCFA 4UBKA 1K92A 4Y6QA 1M2HA 4IIEA 1MBZA 4DNOA 5JISA 1Z6GA 2AGQA 4EGJA 2XUPA 4RPGA 3TIVA 4TTPA 1F17A 2GNPA 1U9ZA 2CHQA 4GPAA 2Y68A 1X38A 1XRRA 3B2QA 3HKEA 3LY8A 4PGHA 3VV2A 2WF9A 3UTDA 3GJXB 2QV0A 2QRVB 3BGDA 5K0SA 3IPRA 1HNZB 1DEHA 3P9XA 1N8TA 1THZA 5G02A 5B3KA 4TL9A 2RCYA 4BWFB 4IDQA 5IT5A 3C3XA 3MOSA 1PW5A 3L7MA 3QZ8A 1DJLA 2JKYA 3PNLA 4RD0A 3OE7D 1VSQA 2QTMA 2WZDA 4HDQB 3TFQA 3WK6A 4PLTA 5T3UA 4EKEA 4QPJC 4F4YA 1KEZA 2JH9A 1N36H 3QFTA 3V6MA 5K7SA 1NPTO 2JGDA 3AHJA 1I01A 1VG0B 1J5XA 2WU0A 5JAUA 2D2IA 2B2XA 1QRDA 4O33A 3L7AA 4MV0A 3DVLA 5JS8A 2G5GX 1R5JA 3C8DA 1E5DA 1HRKA 3G0IA 2ZRNA 1XDNA 4JV2A 1HT3A 3LCUA 3O3OB 3RO7A 3T34A 2BHNA 3H2KA 1DUVG 3DTVB 4E0BA 5DKFA 3TXYA 1HZZA 1S10A 4F4ZA 1NKVA 2G8NA 2HKIA 3PXAA 4IDDA 4QWAA 4OMCA 1UBSB 3VBEA 4ED0A 2IXFA 1E3WB 2B7LA 1UJMA 2BBSA 3P0HA 5D1OA 4XQ9A 2X77A 3SJZA 2GETA 1DFGA 4PZ8A 3KPWA 3Q0IA 4CR8A 2HNAA 5BV0A 4J0FA 3G2QA 1XEWX 3KTAB 4TTJA 3LCJA 2HA2A 2XODA 2G9VA 3GJXC 1VPDA 2DPJA 1DQZA 2GD1O 2Z2XA 4HGRA 4BATA 4AZ0A 5BN1A 4BFVA 1L0BA 3DV0B 5IFLA 1WHTB 2C3OA 1PIWA 4F2HA 3EXEA 1X1EA 4HY3A 2CLFB 3GI1A 3KZKA 2FN7A 4WY2A 3EAGA 4YAFA 4MUXA 2B4KA 4NPHA 1AV6A 4IR9A 1OFTA 4KGXA 3SKXA 4DNXA 2XCPA 2NZXA 1JI3A 1X8XA 1YUMA 4KG7A 4MWSA 3M81A 1T1JA 3ML1A 1V6CA 4S1OA 3T94A 5COAA 2F8MA 3WFZA 5ES3A 4XRGA 4YJKA 1MTZA 3S24A 4JLUA 4BFUA 2AOUB 4RW0A 3OE1A 5EI5A 5IWCA 3K0FA 3AH8A 3I01A 5EJFA 4XYGA 4FBUA 2O2SA 4Y1EA 4RU9A 4DL9A 3U7FB 2DBQA 1T8WA 2FPKA 3I9V6 3QEKA 1XK7A 3KYDB 1E7MA 2CNOA 3CKLA 3I2FA 4EQ6B 2C28A 2W4MA 2R97A 2WHPB 2QQ0A 1RE0A 4NX2A 4GW3A 4CIDA 3HR4A 2GYYA 2FPMA 1P77A 4DLXA 4RVCA 4EEKA 4X9XA 2UDPA 3AF3A 3FKJA 3AU8A 1OR8A 5KNCH 1YTUA 2F8LA 3EMVA 4LYGA 4C0WA 1HNZH 3AERB 1GG5A 5K3WA 1Z22A 2BZ0A 4U0JA 5HGXA 2GNOA 1VKNA 2A3RA 1QHHB 3ZY4A 1CEXA 2HF7A 1XMSA 4U2CA 1XHEA 5JE8A 3CUTA 3DHEA 5LL6b 1G5HA 2O6HA 3LI2A 5EHNA 1FFWA 1OA1A 4Z0TA 4CQMB 1ZRMA 3EX7C 4FVTA 1B04A 4ZYLA 5I4CA 1IOLA 1U2GA 1SOUA 1G7SA 5FBLB 5EYPA 1MO4A 1L1EA 4UDOA 2N9UA 4UE6A 3MPUA 1VBNA 1HTTA 3HXOA 1C0EA 2R8HA 1Z4QA 4S1WA 4WASA 2YFKA 3USZA 5ICMA 1KMHA 1RLOA 3STWA 1DGQA 2ZFUA 4LECA 1SY7A 1CQWA 3IQHX 4FLFA 5KFZA 3K0EA 4EUSA 2APJA 2RBKA 4EG1A 1OH6A 2VQ3A 3K8ZA 3I2IA 1SHKA 4D4GA 2ZDGA 3DTGA 4HEJA 4JNCA 1DAHA 2HA7A 2G06A 1SPXA 2BCEA 4DR1B 1I2DA 2GTIA 4CM1A 3B2NA 1A3GA 4DAEA 1O2DA 4B4DA 4MQFA 4XCVA 5JSHA 1NPYA 3LPNA 3IBTA 2EWMA 3TMKA 4M9UA 3UJHA 1JR6A 3B1FA 3AKCA 3ZDYB 3U44B 2CXOA 3H1EA 4TWRA 4F6RA 3ZKWA 3RAJA 1W47A 4FK8A 1VKZA 2LVBA 2Q29A 1UK7A 3H8SA 2ANCA 1PDVA 4NJMB 4WKBA 2IA6A 2QOEA 4PYJA 4H31A 5KYGA 4O8CA 4BXOA 3TW7A 4RXTA 2BFWA 2RD2A 3AV0B 1OX5A 2VTBB 3FSGD 1T0PA 3BAZA 1Y1SA 2WVHA 4JLMA 1ELOA 1OGIA 4LBWA 1JFVA 1REQB 4UHJA 3LF1A 1WUIS 3F6RA 3AGQA 2C7OA 4OOFA 4ENRA 4D8XA 3QF4A 1W9MA 4UAUA 4BECA 3ESAA 3PFBA 4G1FA 4JOSA 4LYYA 1IZZA 2VHXA 2CN1A 2V45A 1E69A 2QR2A 4R9NA 1D3AA 2Y6UA 2YZ7A 3ZLVA 1UKEA 5DT2A 2NMVA 3IMGA 4QIWE 2BGTA 1V16B 4ZQIA 3NNSA 1I7PA 4R6XA 4ZAZA 5I7AA 4YRQA 1CR6A 1QHEA 3NPMA 4AY3A 3PA8A 3NGXA 3P45A 4DCTA 4ZK6A 3ZDCA 4U3JB 2PT9A 4W7HA 2FOIA 3H2JA 1R66A 3I01M 4JT9A 2DABA 5DG7A 1BX0A 2EJCA 5ALFA 2BN4A 3WNBA 4CL3A 5J23A 4LPSA 3IPCA 1DIKA 1O0CA 4DGSA 1FJXA 4ED9A 5FJJA 4NZPA 3NAZA 2Q28A 3C97A 4J0JA 2GN4A 4OLHA 4ATNA 5LDDC 2JCSA 1BDMA 3NH9A 1YK0A 2PX5A 1PJ2A 3O7WA 4B0OA 2NAPA 2I1WA 2QLTA 2ZPUA 1EFRD 3RHSA 3M9MB 4PZ9A 4AUKA 1RQLA 3OPNA 3VC2A 4YR7A 5TQJA 4N76A 4IWXA 4KQMA 1F51E 5DCYA 3I3SR 4G5FA 3MLAA 1GPH1 4QIWA 1J9GA 5LA6F 3ZTWA 5BV2P 1XVAA 2RE8A 3ZX5A 1D6NA 4G5XA 5TDHA 5G4KB 3HXLA 1ZGGA 4IVQA 4PYKA 4YAWA 1KY4A 4N5MA 3SYTA 4GUAA 1EWYA 1M7JA 2QN9A 4N47A 5AD1A 2E4UA 1YCHA 3FHCB 1UKVY 421PA 4R0VA 1WXWA 2X3YA 3Q6NA 1Y9AA 1CTQA 2WVGA 1MT3A 2R1ZA 4XX0B 1TYDE 2CB0A 5FAXA 1Y8RA 4A2BA 4W99A 1VI6A 2PZFA 4MWGA 1F4PA 4FMCB 4OJMX 5BWBA 4YMUA 4O02B 1XZEA 3PNYA 4EG0A 3R41A 3WWHA 3EG9B 1WL8A 3OLWA 3WSWA 4UBMA 3RS4A 3CB2A 1E5TA 5JS1A 3IOYA 5KOHA 3JYHA 1LJ8A 3TX6A 4ER5A 4I99A 4I8IA 4MV5A 3WRVA 3TSAA 4XCQA 2OZEA 3G79A 2FN9A 4ALLA 2O20A 4DKXA 2AKEA 3LQFA 2D6FA 5JSZB 5K3FB 4REOA 4QU5A 5GGXA 3LO8A 2E6UX 1CFZA 2PS3A 1KIMA 2QV7A 2HDOA 3C5VA 3M2PA 3N3AC 5DTJA 1HTBA 2O3UA 2QAGB 1W0CA 4HQOA 5AKXA 1HORA 5DEIA 1MJ5A 5JVDB 3KKLA 2HVQA 1G20B 1Q14A 4A6DA 3GCXA 1V41E 4UNRA 2ZI7A 3MJTA 4MUBA 3AUJB 1JHMA 3QIAA 4CI0B 4CGZA 1AG9A 1RWBA 2CYBA 3HB5X 3AHDA 4GC5A 4J9LA 3NKLA 5A6SB 4IIJA 2IHUA 4YWHA 2DBRA 2PUCA 1NUPA 3VKUA 1JSCA 4YAEA 1UUFA 2BGLA 2UXDB 1JFLA 1YRBA 2C4WA 3RBDA 2I6QA 4RTRA 1Z26A 3QZ7A 1H4SA 2R7AA 2A33A 4KXVA 4TLBA 1FA9A 1MX5A 2D62A 1YCGA 4ESEA 2EQBA 1T9GR 2Z1MA 4YJDA 5IZCA 5KWVA 1YVRA 1QO0D 1JXMA 1SKBA 4DT1B 2CZGA 1GFWA 3JD1A 4BCCA 3L4BC 2R85A 1WW8A 3L7CA 4L28A 4YHHH 1KPHA 2PLWA 3EGCA 3H5VA 5E9QA 3JZAA 1EE2A 1U3TA 2BEWB 1FBNA 2ISCA 2NG1A 2NLOA 4G4SO 4H7KA 3V55A 4EATA 4GC9A 3ZJTA 3OHAA 5F5LA 2CF6A 4I9GA 1NQWA 3NUZA 1N1GA 1YVUA 4AX8A 1UMCA 3I72A 3JVEA 2WB4A 3SXUB 2M32A 5FD8A 4I6EA 2HCBA 1ONSA 3WNQA 1SKUA 2MMCA 3EIOA 4HDMA 4IDAA 1T6YA 3PUKA 1Z73A 2C7VA 4CMBA 3PW4A 2JAOA 3R6LA 1TYCA 3WK8A 1GKIA 2NV2B 3H1BA 2Y0EA 3CR8A 4R9SA 2HWXA 2WYWA 4LY0A 3AESB 3COZA 1M5UA 2CFTA 4JI1B 4A9AA 3VA7A 1EGMB 2IWHA 5IAEA 4B4OA 2FMUA 4D46A 4YACA 2ZI6A 1DINA 4HAZA 4Q1VA 1G6KA 3KETA 3AF4A 5EMNA 1JJIA 4R8KA 2QX6A 2ZSEA 3NHMA 3HB7A 1K2VN 3AFGA 3DAHA 2NU9B 1N5RA 2VSQA 3HH8A 4HAUA 4DVJA 4F4IA 3DMTA 3F7TA 3DBHA 1AQYA 3HFJA 5FAKA 5DBFA 5DYTA 3QW4B 2AI3A 1C7FA 2EL9A 4DV0B 4DQVA 1CY2A 3N2EA 3Q0EA 3C3WA 3CNEA 1GR0A 2X1LA 3ASVA 4IEEA 3F0TA 1RYMA 1JQEA 5P21A 5GJBA 3BZUA 2PAFA 3L0PA 4YS6A 1ZIDA 3TIFA 3L1KA 4E31A 3CM0A 4GR5A 2FUEA 1SVNA 2ZYVX 1JX6A 1JSXA 2QJOA 3KQVA 4IXWA 4RF4A 3Q3GE 5HF8A 3RVBA 4TT3D 4ZJZA 1I0IA 3BIFA 2RHTA 4U6NA 1P8JA 1FTSA 1O6FA 1XTTA 2Y2UA 4PXAA 1OFUX 2JIOA 4WTOA 4F85A 1T3SA 5JRDS 1ZHHA 4PSUA 3IA7A 4MWZA 4C29A 5EJAA 3P32A 4ZYZA 3IP9A 1VRVA 3BWBA 4QFMA 4ZCLA 1XN1A 2J08A 4AYXA 1X9IA 2VIIA 4QXRA 1I3NA 1N6HA 4KE8A 1P6XA 4Q3NA 1YHZA 2A3NA 2VPWA 1WSCA 2GCPA 4PO9A 2OG1A 3IN5A 3ROTA 4OI0A 3BIXA 3QQ5A 4I4TB 3BG5A 5DHRA 1JVSA 1RYZA 2HRRA 3BZBA 3TUIC 5LYJB 2ZYIA 2PUFA 4M53A 2PG3A 1IYZA 1RXEA 1ZCJA 3HLYA 4Z53A 4IRXA 1FSZA 2P5TB 3H6GA 4W8HA 5AI9A 2IL1A 5IAKA 3D4BA 3FW1A 5LB4A 2JH3A 1SKMA 1C3LA 1GHTA 3HBJA 4DR7H 4Y67A 3RIEA 4B87A 1ECCA 2JAUA 1PT8A 3WHPA 1KTIA 1DADA 3PKIA 1XZHA 1E32A 4ICIA 2YXPX 1DELA 4CKXA 1BDIA 3N43B 2B7CA 4A2QA 4GPBA 1WKCA 1D6SA 3AP3A 3TNJA 5T4HA 4C03A 4HPWA 4F91B 3EUWA 3DM5A 2FZVA 4DCOA 3ICOA 4FYHA 5CNMA 5IT0A 2PM8A 4TRRA 2MJLA 1R5BA 3E23A 4DLBA 1KOGA 2OUKA 2X4LA 2REQA 5HZMA 3HCNA 1GPMA 5CX1A 5AJZA 3CH7A 3F9RA 1Z6XA 2PFKA 4YAUA 1MJGM 4ZRNA 1XZJA 3G8DA 3C85A 1FLAA 4FUQA 1W5BA 4I1YA 4U9IS 3TW0A 2G6BA 5FOUA 4IGKA 1X42A 3RBEA 1FFDA 1M7HA 2FEAA 4ENSA 2OCLA 3D3QA 4CI9A 3WL4A 1YB7A 2FFBA 4MZDA 2EP8A 5C8XA 4L5CA 3TB6A 4L9AA 1KJ8A 3DEFA 3K16A 3IDSA 4R2KA 4RPHA 4JI7B 3DB2A 1KIFA 5L9XA 1V0JA 1WABA 3CEPB 1TUGA 4PG7A 5EWLA 1DO0A 2Q6LA 2P9EA 2CV0A 3OQVA 4OD0A 1YE5A 5KI6A 1NXTA 1F3OA 1YQWA 1G42A 1TEHA 1VE9A 2DM6A 2OFWA 1H8HD 2ZUCA 4HNUA 2AOTB 2YQZA 4ZAFA 5JDIA 1ISJA 1CDEA 2QJRA 3Q9NA 4FR0A 3QV2A 2W48A 2J6TA 2VDPB 3ABSB 4I08A 3V7UA 5BMOA 1VLQA 5FR9A 4DZZA 4WXEA 5KFBA 1QQTA 3T7CA 3V4LA 2HSWA 2ASLA 2IYAA 1VJDA 4HVTA 1ONNA 1W94A 2I3AA 3QNWA 2B82A 2QL9A 1RI2A 2R8EA 4QTUB 4W9MC 3ZWNA 3Q5DA 2CV1A 3LP8A 4TMXA 1F2DA 1A5AB 2C9YA 4U1RA 4W9NC 1CHNA 1OREA 2AG5A 1GQOA 3AETA 4KW7A 1NQ5A 1OLUB 2G9ZA 4QE3A 4ZPJA 5KWEA 5FX2A 1TZCA 2XZPA 2VBGA 3BJZA 4K40A 2ZI5A 5CCEA 2HJ9A 4JR2A 1Q1BA 4YWJA 3T7RA 3VYTB 2BGJA 2IY7A 2VNIA 3I52A 1RADA 1EFVB 3VSEA 3ZQ4A 1I3MA 1PV4A 2RGRA 4CG0A 4PG8A 3PDWA 3CG0A 3FJOA 3DDSA 4F3KA 1UNNC 4OKIA 1PJCA 1IXSB 4AZ3B 4HUQB 2G04A 2XIJA 4EO4A 4WOPA 1U3GA 2C04A 3LUAA 3D6MA 4UBNA 1K5PA 4CIYA 1SBIA 2ICAA 3NQ41 1SC6A 4QXQA 2IW1A 3A4NA 1VXOA 2Q0HA 2IEDA 1HEIA 3QU9A 3WB1A 4E22A 1WW2A 1KL7A 3H5RA 5E3IA 1IRIA 4GEGA 5AVOA 1KAEA 4AMBA 1OC2A 4NXNB 1T2VA 1NMQA 2P4EA 3B7GA 4JS0A 2ZCVA 2YYZA 5EWMA 3QTLA 3JSAA 4CE5A 1Q19A 4K88A 1RT9A 3I6MA 2GF9A 4LXGA 3WLKX 4F5WA 3DF9A 4DUYB 2A5JA 1GNLA 2AG1A 2ECOA 2PFSA 3DULA 3C7CB 3CX4A 4I9FA 4TTAA 4UE2A 3PTZA 5GJCA 5SZJA 4D41A 4ZTZB 1C50A 3MPOA 4R9UC 4LPKA 5GINE 2O2JA 4B3RB 1LS1A 2FUKA 4KNVA 4DGQA 1WXQA 2IU0A 5C8VA 7MHTA 5LCXA 1PX2A 3RJMA 3UJAA 4EITA 1NIJA 1C1YA 5DHTA 1Y4DE 4JSRA 4HQ0A 3T3MB 1PVOA 3JAKB 1KDRA 1R88A 2BEUB 1A27A 4YRBA 2O8BB 2GZ1A 1ECJA 4RNDB 2OD2A 3GD7A 2EERA 1UMBA 5AI8A 2ABWA 4HX9A 3SX2A 2G80A 3USCS 1NUHA 2ZWMA 5J9FA 1F20A 3CA8A 2JJ1D 3UB3A 2X7XA 1FDVA 3M4JA 2GBLA 1FDRA 2PMCA 1H9BA 3LWNA 4AW9A 1JKJB 1SBCA 4CM7A 3DHWC 2ZR8A 3K2BA 4ODIA 4UMFA 4C01A 1OX4B 4NE9A 4DIDA 2XGJA 3KHUA 4X7MA 4LDNA 2WNSA 4ZOLA 3JD4A 4UBIA 4O3SA 4PO8A 3U44A 1CJBA 1B8VA 2HF8A 2JHFA 3BAFA 3HZOA 2VOBA 1TIPA 2ZUSA 3QVGB 4P5PA 4WDQA 2EC5A 2FKLA 2XPCA 4CEHB 2JCGA 4UCOA 1Y7PA 2ZE5A 4HLUA 3MAGA 4LY9A 2JD2A 3RR2A 1JHZA 5JD5A 1JBKA 3BXOA 2HK6A 1PL7A 13PKA 1UDBA 5IM4F 1JEEA 3QI2A 3DG9A 5AVZA 5IT4A 1I5EA 2JFZA 1AB5A 3OG9A 3GYBA 3P9IA 1UPBA 4PX5A 1GRVA 2I62A 3UWDA 4OHOA 1RYRA 1GGEA 2HFKA 3RG8A 5FH9A 4X65H 1A8QA 4BO1A 4BO9A 2X40A 3DO6A 1UAAA 4GXNA 1NN0A 3TD9A 1V3TA 3JYNA 4Z4QA 4BCBA 2O3TA 4CN9A 1UOOA 5AVVA 4DJ5X 2OAQ1 1GNVA 3R7LA 3OMXA 4M8SA 3M4IA 3CF6R 1ICIA 1JWBB 3FJYA 4XJXA 3AM3A 1DEKA 3A10A 3UWKA 4PTYA 1E79A 3QWFA 4AURA 2C97A 3KR9A 4DY4A 2H4FA 3N74A 3TZEA 5LU8A 3VX3A 1GDDA 2CVHA 3ZW8A 4BXOB 5IYZF 3GY0A 2N1MA 3I2YX 1G4HA 2GEJA 3L18A 2CFOA 2VTBA 2G1PA 2V3CC 1SXGA 3JCZA 1LH0A 2A1TR 3CW8X 3IERA 1UJ6A 3JQ9A 3RHZA 3LX8A 3YASA 1GAXA 1QZ3A 2HCTA 1ZGCA 2XJ4A 2XRMA 3E81A 1ES9A 4MRNA 3QF4B 4MCHA 1V96A 2Y92A 1N5DA 4U4AA 1LPPA 1PZFA 1W88A 1TVKA 4Z54A 1VE3A 1GPJA 1LDMA 3HKDA 4HSEA 3GAZA 4HWGA 3I9V1 4TWJA 4R69A 2Q7OE 5DXFA 2CSXA 4HGQA 3K1AB 1GUAA 3WMRA 1YQTA 3ZKAA 5E6SB 2CNBA 1RKBA 4JB0A 1SCBA 2PS9A 3ONEA 3QKWA 3LKVA 3N0RA 4U3JA 4F3RA 3EC1A 5LA6A 3PU6A 4XVHA 4DDMA 2BZSA 3ESRA 3I92A 4YJ2F 3MSCA 1O97C 1F0NA 3EIQA 3Q85A 4DR2B 2ZSAA 1LSSA 3E4CA 3QPCA 4G1BA 3FA2A 4BX8A 2XYVA 3LL7A 1D4ZA 1U0EA 2IOYA 4KDFA 1AN7A 4NBSA 1OZAA 2ZAGA 1GCAA 3I9MA 3CZRA 3HFRA 5KFLA 2QZ9A 5A9SA 3V8QA 2VF4X 5K0LA 1WO8A 1N2SA 5U4QA 4WD3A 1CKOA 3BL6A 5FTMA 2FNAA 3VU3A 4A1FA 4AJNA 3ESCA 1Z36A 4DQ0A 5ALRA 2XWSA 3G8AA 5AK6A 3NIGB 1E2FA 2O2ZA 2ESRA 2D13A 4CF6A 3FOZA 4TZ0A 2QPLA 1EFPB 2YFYA 4IHKA 3K2EA 3S0JA 5IPFA 2VBFA 4FMBB 1NYQA 5FA8A 5LQMA 1AV7A 4O29A 1J00A 3I3OA 1FVXA 3O1IC 1R8JA 1XTVA 2R8OA 3UV3A 1XQVA 1CB7A 2R65A 3T1QA 3JALA 1QHGA 4KR2A 4Q03A 4URXR 4A5OA 4YR9A 2FUCA 1ADGA 1SN7A 2D5AA 2WKSA 4X61A 4PYIA 4XSGA 2P5YA 5BR8B 1TA9A 3F96A 3UAGA 1UJCA 5KNDH 4F11A 1FTQA 2OQ2A 2VTVA 2AU0A 4EHHA 5KFSA 5DCUA 3T7TA 2ZJ1A 5KFDA 2I99A 3OWOA 2VRWA 7YASA 2C3UA 2XE7A 1U63A 2OOSA 1K5GA 4HWSA 2EGGA 1FFAA 2PXCA 1M2KA 1FFGA 2B4TO 2JJ2D 3NDPA 2BKXA 4YASA 5FADA 1J56A 5DTRA 2OBXA 4KO8A 5HKKA 5DGHA 3L8FA 3RAXA 3NYWA 4JBWA 4OQZA 1IQ0A 3OQJA 5M3BA 3UJCA 2QP4A 4MKXA 2W6PA 1KI3A 4TS1A 1R8YA 4WH0A 4YRLA 5L51A 2D0DA 4BRWA 4K6OA 1MXHA 3GNLA 5ESWA 3WHLA 3IPLA 3L0BA 2C1EA 1PP4A 5CA1F 1Q77A 2CXRA 2EZ9A 2NTNA 1ZITA 3AYXB 3NC0C 2JEYA 1GNTA 3EDMA 3OJEA 2QX4A 1XFAA 4JWTA 3ZD9A 5A9RA 3VI3B 4WNCA 3SKYA 5HNEA 2IP1A 3JAKA 3JQ6A 3ZE6A 5TEVA 3H99A 4XVQA 4AULA 3KLPX 4ZQHA 2AHRA 4W5WA 4UNIA 1QKIA 3AU9A 2AB0A 4B32A 2M2IA 2NZUG 2VFAA 4KGVA 3TPFA 3TW8A 4EG8A 4A23A 2GN0A 3Q8RB 3FLAA 1HSOA 4E1VA 3T95A 3E3AA 5JR3A 1W5EA 4QLAA 4RM3A 5ITWA 1W96A 4Z1MD 1ET0A 3ANXA 5KPJA 1NV9A 2AX3A 2ZIGA 1X7WA 2QTZA 3PQ7A 1C9EA 4BNTA 2YXLA 4HZGA 3L84A 4I4NA 4TMTA 1MPTA 4JMPA 4DA6A 4DE5A 4RJKA 1XRSB 3EZ2A 1HYEA 4UEKA 3OFKA 1IWPB 2BFCB 2WU3A 2IW3A 4M9ZA 5F78A 5A06A 3VDQA 2AS0A 4HYYA 4L72A 3K6SB 3NWOA 1TRKA 1T43A 2VRBA 4OEHA 1U2QA 3VPSA 1XT6A 3TI9A 1SNYA 3GXBA 4CTMA 5FUMA 3AM4A 4MUHA 1AGPA 4AG3A 4JYMA 5BNZA 4KFCA 2VPXA 3PC8C 3X2EA 1HI9A 3GC6A 2CWWA 1AKWA 3ILVA 1DBPA 2G7MC 1M34A 4KE7A 6REQA 3R3WA 2VA2A 4EIWA 3SMQA 1G21B 1JA0A 2ZQZA 3EUFA 4UEJA 4GLWA 2FWMX 4MAFA 3P19A 4YAJA 1DIAA 4X1YB 4AJLA 1NG9A 3L05A 3PYXA 2ZTMA 1NHWA 3CH5A 3OIGA 4XTCS 1PWHA 4JJGA 4N12A 3Q8KA 2NPIA 3TDNA 2A9FA 1M74A 2X14A 3TEMA 3UZOA 4IIHA 4P1ZA 4NYMQ 2DFNA 3DZGA 4RLQA 1JJ7A 5CLGA 1M2GA 2OG2A 2WTAA 2B30A 5DM70 3WISA 2LDXA 3SX4A 1G3UA 1IB0A 4W4TA 1ZEMA 4D99A 2GQ0A 2EFYA 1ISIA 1KO7A 3P52A 3AILA 2O0MA 4ROTA 3ZV6A 5H83A 1Z68A 2R7ZA 2FFRA 2RK4A 5IZCC 4LDPA 3EAQA 4N39A 5LZ4A 1P7ZA 1VLJA 5BWRA 4JAVC 4C89A 3FH0A 3F3KA 4BNKA 2VPZA 3CBQA 2XVXA 5DI9A 1GU1A 5CB0A 3VR1A 3DH0A 3DE2X 4L50A 3OZVA 2G4VA 3WXMA 2OCYC 1XPUA 1L4GA 1SR8A 2VNSA 3BL5A 4NBUA 5D5PA 5FUWA 2CNDA 3DMGA 3AVVA 2GK4A 4HQLA 4IS2A 1MRZA 2WJ6A 3WWDA 1Q2XA 1T3ZA 4OLAA 4C3VA 3PJDA 5AKJA 5DNAA 2Q9BA 4C4ZA 2IOFK 1MCZA 1JEQB 1XALA 4TWBA 3PCRB 4DDHA 4XWWA 1DJQA 1YQXA 2CK3D 2QQGA 1RIFA 5B64A 1OCEA 1T2CA 2YVAA 3AF6A 3ZY2A 4ESVA 3L5OA 1T9AA 2JH8A 4HQNA 4L85A 5HTOA 2D1QA 1K8YB 1G8KA 2C07A 1A5BB 1BE1A 2X41A 3OQIA 2UZ3A 1TAGA 5IXYA 4OA8A 2QU7A 4XPZA 1A4RA 3S2FA 3JV7A 4Y9RA 1KAQA 1TJNA 3CN9A 1Q2UA 3TBKA 4CC6A 1N3IA 3D2BA 4YY3H 3KWMA 1BCRA 4LYHA 3KPUA 4OXNA 5EZ6B 5JCOA 1UAYA 3EBPA 4AKIA 3AC0A 4TM5A 1UFKA 1OXBB 2BTQA 2R3SA 5JSYA 1XNRB 1PG0A 5BWMA 1C0IA 1HKUA 3DTTA 3ZVKA 1IY9A 2FH5B 4Q7QA 1FU4A 3ONVA 3ZJ4A 4HAOA 3VOBA 1SGWA 2ZB3A 1IFXA 1VKHA 1XTPA 3QXXA 4X45A 4D9HA 3IQDB 1UF9A 3DNPA 1YQQA 4DYDA 2FLPA 4YMTA 2ZJ0A 1EQAA 3GGSA 2QSUA 1RPNA 1X3SA 4JGBA 4D9IA 2VP2A 2AFVA 3WLFA 1C4XA 3R0ZA 5FBKA 5JNLA 2I6GA 3REGA 3KXYT 1TVEA 3NVDA 2PN1A 1KORA 1VE7A 3D5QA 3DBOB 3KCNA 4TXMA 3ZCXA 2IA5A 1Q1NA 3FPBA 2VWHA 4X6XA 1ZH2A 3FNBA 3PZPA 3GTLA 1CUHA 1SO8A 5AICA 1I94H 1VMKA 2J5QA 1CERA 2V6FA 4HGOA 1J1ZA 1HEUA 1XCJA 2H57A 3H9BA 1UDAA 2CJWA 2O8VA 4OHPA 3WJ7A 4B6EA 3HCOA 3QKUA 3NTOA 2Y4RA 1QFYA 1VTKA 1WCWA 2WJIA 3BWMA 3DTVD 1IJKA 4OGWA 4RCYA 1G5PA 4Y0VA 5L3ZA 1KHHA 1FPMA 5BMVF 4X64H 1JDJA 2EARA 1A4UA 2VUSA 2UYOA 3D8HA 3OIFA 2Y2VA 3X1YA 5AM2A 2DPMA 3JWPA 2IYEA 3KLOA 4B75A 3P9NA 1Y3AA 1MENA 4G0VA 4I5DA 2FMIA 4G36A 5EWMB 3RF7A 4INZA 1XMVA 1TMGE 1Z74A 3AETB 4EZBA 1F12A 1R1DA 2JEIA 2HT6A 2X2EA 3TSWA 4AC9A 4JQCA 4C2BA 2JASA 4DC1A 2GZ3A 1LPAB 4F3NA 5JZSA 4FQ5A 1QQAA 2J46A 1E89A 1FYEA 3D4NA 4NCXA 1Y6ZA 5I60A 5SZHB 221PA 3S2GA 2XE8A 1K97A 4WNYA 4YMSA 3VR2A 4ETNA 4BMXA 4ZGWA 4D25A 3CLSD 1P73A 5E3HA 2Y0PA 3TLXA 4OJQA 5JXGA 1X7XB 2YHBA 2H54A 1KT8A 1LFAA 3IOEA 1VL5A 2VDLB 3WSVA 1VB3A 4JP8A 4BDTA 3KK0A 3NIWA 1UKAA 4V0MA 1NKTA 3R7WB 4BZXA 1VOTA 3RFUA 1NX6A 4B6OA 1BMFD 3JWJA 4LRQA 3B3QA 1K06A 1ULBA 1U5CA 3PS9A 2B9EA 4KN8A 3ZTYA 4L73A 3NXKA 3B85A 2LW7A 3M6FA 4PBTA 5KKNB 2C3PA 2GBCA 3R23A 1MB3A 2YWBA 2PGXA 3LVQE 3PRKE 5J5VA 5CDFA 4F7DA 4LIPD 4JMLA 5KDOA 4BO3A 1JFRA 1A9QA 3KOZA 3A9RA 5C1IA 1SXJB 3RUCA 3FUTA 4DXHA 1TO2E 1HFEL 3WLJA 2A9KA 4EHAA