3DOJA

Structure of glyoxylate reductase 1 from arabidopsis (atglyr1)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
292
structure length
292
Chain Sequence
GSHMMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase-like protein
publication title Cytosolic NADPH-dependent Glyoxylate Reductase from Arabidopsis: Crystal Structure and Kinetic Characterization of Active Site Mutants
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 119
structure length 292
sequence length 292
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dojA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dojA01
2DTDA 1LUAA 3PTZA 1Y9EA 1ZKMA 1ISMA 3H9JA 3ONEA 2QYTA 5KNLA 1N9GA 4GWGA 1DDOA 2B5VA 3U4IA 2OP1A 1GEGA 3RBVA 5JC8A 1NP3A 2GGSA 4D42A 2J8ZA 1MFPA 3BHMA 3HQ4O 1TA4A 4IJUA 4RPGA 2FR0A 1PU2A 4FFPA 2JAPA 1HYEA 1WDLA 1IPFA 5CDYA 3QVOA 4HFMA 4CLHA 1F12A 2BFAA 3UOGA 4YJGB 2H63A 1OZAA 4J90A 4J2HA 3BTOA 4EUEA 1G1AA 3FTPA 3OQBA 4LMRA 1C1XA 3JYLA 3C24A 1HEUA 4J6FA 1BHSA 3SEFA 2X8LA 3I83A 2FPIA 3VH3A 3WR5A 1YL5A 2C07A 4E13A 1LTHR 2GN8A 3BIOA 1T2CA 3GDOA 3CE6A 4HY3A 1Y6JA 5ICSA 4GSLA 4DYDA 3M2PA 3G3EA 1TB4A 3BAZA 3DBVO 1OBFO 4H16A 4IDGA 3C85A 2JCXA 4EYEA 2YFQA 1E6UA 1R4MA 5DBIA 4CM5A 1NBOA 3GZNA 4XB2A 5C37A 5KOIA 4EW6A 1JWBB 1ENOA 4YA6A 4D3FA 1I3KA 4Y6PA 1I2CA 5FI5A 4C4OA 5CEJA 3OFSA 5C5IA 2VZ8A 3NUGA 2D3TA 4QT0A 5GY7A 1N7HA 4OHUA 1FDUA 1YXMA 5DCUA 1C3VA 1W73A 1T2DA 2EV9A 4PLTA 1EDZA 3S2IA 5JDCC 3KB6A 2HKIA 4P4LA 1WDMA 1MP0A 2CF5A 1T26A 2EP5A 2PD3A 4YAJA 2NVUB 4BHTA 2Q99A 3FCOA 1SB8A 1DHTA 1EMDA 1NPTO 3D3WA 3DFUA 2GZ2A 4O0LA 4DIOA 2PTGA 4W99A 4RVSA 1CWUA 2YY7A 4CMIB 4DQUA 3EMKA 1HL3A 2F00A 4BO8A 5JXWA 1FF9A 1BXKA 1LBEA 1OC4A 2YV1A 4BV9A 1GV1A 1PR3A 3LT0A 3ZWOA 4RPHA 5A03A 5JCJD 1F06A 1GZ6A 1HZZA 3AFMA 1V9LA 1T4BA 2G17A 4RF4A 1J4AA 2HO5A 3VZQA 3AOEC 3LT1A 3KBOA 4L8VA 1IE3A 3DR3A 1BXGB 2GDZA 2AMFA 3TOZA 1CQJA 1LJ8A 2HU2A 4FD3A 4Y98A 3ANLA 3QVSA 2A94A 4WEQA 4GX1A 4TZKA 1A9ZA 5I7VA 1UAYA 4Q3DA 4PG4A 4FBGA 4PLGA 2Q1SA 3GQVA 2GLXA 1H0KA 1ZEMA 4CMKA 2IXAA 4E5YA 2B36A 3T4EA 3TJRA 1P3DA 1VRWA 5CEEA 2JL1A 5B1YA 5CDTA 3MWDB 4XWYA 3G1UA 5CPBA 5BT9A 4M86A 3WDSA 3OQ1A 1C0LA 1AGNA 1KOLA 4IMRA 4PGFA 4FJ2A 1KVUA 4R3WA 4ZGWA 3RU9A 1ZUD1 3OJEA 2QHXA 1YB4A 3L6OO 3GVHA 2PGJA 5TS3A 3JD0A 4E3ZA 3ZHYA 2HQ1A 5DBFA 5CDGA 1YQGA 3GGOA 1NXQA 4NFSA 3AM3A 2GZ1A 4BS9A 2GD1O 1MV8A 4CLOB 3E1KA 2VQ3A 4B8ZA 4CV2A 4MINA 4BNZA 2EJVA 4OYRA 3FI9A 1O94A 2A35A 4CLXA 1U4SA 3L6EA 2WSBA 4BNGA 2ZQZA 1DB3A 2H1SA 4K26A 4BVAA 3EVNA 8ADHA 3WXBA 1ISIA 3NX4A 1EE2A 1LXCA 2X22A 2JCYA 4FOOA 2XAAA 3HG7A 1CRWG 3HADA 5CHEA 1DPGA 1SO8A 2O3UA 2Q45A 1H94A 4OOFA 3ZI0A 4KWHA 1DRWA 4CM7A 1PGNA 4BIIA 4BO3A 1ID1A 2HMVA 4DRYA 1IHXA 2BFMA 3F1KA 1JVBA 3UXYA 3U62A 4A27A 1NAIA 5C3MA 2FRDA 5LDHA 1Y5MA 3TQHA 2X9NA 4R9RA 2IYOA 1Y5RA 3GFBA 4U6SA 9LDTA 4HXYA 5K9ZA 3K5PA 4J7UA 4Z9FA 3ZW9A 1GCUA 4DTIA 1Q1NA 2EW8A 2C0CA 1AHHA 4A5OA 1U5CA 1KY5A 2BMAA 1ZK4A 3KEOA 1FDWA 1P1IA 4D41A 4NJMB 3I9KA 1DAPA 2G82A 5ENDA 5FEUA 3DBHA 1EE9A 1M66A 5I9MA 5EN4A 2EWMA 4MVJF 2AHRA 3UAGA 1LLUA 5FF9A 1HLPA 3BTSA 2PH5A 2UAGA 1NVMB 3KYDA 3VDRA 2B0JA 4BNIA 4ZJUA 4BO4A 3ZV5A 4JGBA 3JQ7A 1I01A 3DTTA 4ZU3A 5EIOA 1EVIA 1QYVA 3SC4A 4D3DA 5BR7A 3E5RA 1LDBA 1UXJA 5G0WA 5EPOA 3NTQA 3UN1A 3ZWNA 5L7WA 5IXYA 5HBRA 2C2XA 4ALMA 2VWQA 2O2YA 5KJ6A 3K8ZA 3I1JA 7ADHA 4I9UA 1GTMA 1PJCA 3QQPA 2VT3A 3JQAB 3OHSX 4WOKA 2P5YA 4MP3A 5IN4A 3WBFA 2IEBA 4Y67A 3VH2A 5T8KC 4JJGA 2EKLA 5H81A 4B79A 3K2BA 4IGFA 5JS6A 5JMWA 3AWDA 1GUZA 4Z0HO 4K6CA 2GRAA 3JQEA 4OH1A 4TVOA 2J5RA 1KEUA 1T25A 1VKNA 2GO1A 4EDFA 3QWAA 1QR6A 4IM7A 4ZHSA 1KBZA 3WTCA 2HK7A 5KJ1A 4MVJG 1ZVMA 5HS6A 3DFZA 3UHAA 2P9EA 2VWPA 3I52A 3S1LA 4AJNA 3ZV6A 2WTBA 4CLOA 4IZIA 2E4AA 4NMHA 3R3JA 3C8MA 5T6BA 5I7EA 1Q0QA 1I24A 2B69A 3GNSA 2RHCA 1C1DA 3JQDA 4IQ8A 2YJZA 1YOVB 2D8AA 2PNFA 4Q3EA 3FNEA 4O5OA 1K6JA 4LRTB 2V6BA 3F1LA 1I33A 1QP8A 4AJ4A 3UCXA 1JVSA 5AVOA 1T2FA 5G0VA 1TVEA 2AW5A 3DZIA 3CINA 4BUCA 1P31A 1UXHA 4JXKA 5IN5A 1SC6A 3PJEA 4II2A 1MG0A 1UZLA 3ZW8A 1KETA 4MVJH 3VKVA 3RUHA 3EGOA 1N9GB 1UZNA 3I5MA 3MOIA 1GZ4A 2Y1DA 4KWIA 2ZB8A 4FIZA 5LCXA 5ILOA 1P0FA 4RVFA 1JQBA 3K31A 4HV4A 4JBIA 4B7UA 4XQEA 2BGKA 4UEOA 3FBGA 2IYPA 2OUIA 3KHUA 3FRJA 4NR0A 1EZ4A 4UEKA 4CUZA 2OORA 4PFJA 2VNAA 2X4GA 2R00A 3B1JA 1DIAA 5TQVA 4IUYA 1GAEO 4IDBA 5L3ZA 4B3JA 4CMCA 4EJMA 1PWXA 3A28A 2DBVO 3CEAA 3A9WA 1XQ1A 5JO9A 3ZNPA 1FDTA 2DC1A 1H2HA 1WNTA 4W9NC 4XYGA 1A72A 4KOAA 5JYDA 1X7HA 4E31A 1NASA 2VTEA 3MWEB 1EUZA 1YRLA 3GUCA 1HLDA 1Q7BA 4DQXA 5IDWA 5DT9A 2HLPA 2PK3A 3TN7A 3GFGA 1K6IA 2ZB7A 2E48A 5CAEA 1PQPA 1SAYA 2Q2VA 2Y1CA 1YDWA 3KO8A 4L9RA 3DBHB 2CMDA 2QRJA 2NVBA 2BI8A 3UUWA 3TDKA 4XYLA 4L76A 1E3IA 1Z7EA 2GUGA 5DCYA 5C7LO 3COSA 4YACA 1YQXA 3RJ5A 2Y68A 4IIVA 4JROA 2YQ4A 3LC7O 1LQUA 3NDRA 2A4KA 3CTVA 2FP4A 3OIDA 2P9CA 3RUDA 4CMEA 1LLDA 4RQUA 3G49A 4KUEA 4ZRNA 2ZCVA 1ZK2A 3IC5A 4TRNA 3KTDA 3ZHBA 1QLJA 3RASA 4GQAA 2HRZA 4TRJA 4IIUA 2AE2A 4WNIA 2Q1UA 2POQX 1U28A 2VRCA 5CFZA 1FXSA 3GC6A 2Q3EA 1LC3A 4DLAA 2E37A 3WMXA 4PCVA 1NPYA 2VT2A 3WLEA 2NTNA 1HSOA 3D64A 3BA1A 4OGWA 2NADA 4Q3AA 5A5FA 2X1HA 4OAQA 5JSFA 3PEFA 3LT4A 4BMNA 3RD5A 2BELA 3D4OA 1ZMTA 4TQGA 5KVSA 4PLHA 3I4CA 1EQUA 1WVGA 3INRA 3KM0A 4CL3A 1ISGA 1NWHA 1BDMA 1U3UA 4E2YA 1R16A 4FW8A 3H9GA 3U4HA 1CEQA 4B7CA 4ND2A 1RYDA 3VTZA 4TROA 3VC7A 4J9VA 5DCWA 1UP7A 5TGDA 1G0NA 4IY1A 2UVDA 3HFSA 1W0CA 5IDQA 3ZU4A 3I9LA 1U3WA 1JKIA 2FOIA 4JP2A 4C7KA 1G6KA 1QYXA 1YOVA 3AUAA 1LSSA 4F46A 4N18A 3ZU5A 3EVTA 4P38A 3WFIA 4W82A 4I5DA 3W4KA 3KRTA 1D7OA 2JD2A 2CSUA 1B0AA 4ID9A 4O59O 4B8WA 1DJNA 5ICMA 4GX5A 3JQ6A 1XQ6A 2ZYAA 3W4JA 4R51A 3MTJA 2VYND 4GGPA 5L7YA 3C1AA 4GLOA 4R1NA 1SBYA 1M67A 4B4VA 4XZ3A 3MOGA 3RUAA 4CMAA 3FPLA 3DHYA 1UR5A 4YEDA 1BW9B 3OEYA 1E7YA 1ULSA 1I2ZA 1XELA 1S7CA 2P9GA 4YVFA 2EHDA 5BSHA 2JJYA 1OOEA 3OEWA 4QXMA 3RC2A 3PXXA 2C82A 4H15A 4RZHA 5TX7A 3S2GA 5EL0A 5ILGA 5IZ4A 3JQ9A 3JD1A 4RLSA 3L07A 3JYQA 2UDPA 4FFMA 4MVJI 4P4NA 1NAHA 4ND5A 4GBJA 1I5RA 1Q0HA 5ENVA 4A2CA 1PL7A 4YXFA 1Z75A 4E2XA 4EUHA 2ZATA 2DT5A 1HE5A 4Z9YA 1BVRA 2DFDA 5IZCA 5G0TA 2C5AA 3DBRB 2X9GA 4BNHA 1RPNA 3GLQA 5I9LA 5HTOA 4Z3KA 4JJIA 2X58A 5KVCA 1WWKA 1HE2A 1XLTA 1ML3A 1PQUA 4RQTA 3VZSA 1E3WB 2ZJ0A 4R16A 1E3LA 1PSDA 1A4IA 1JN0A 2V6FA 3NT5A 3VH4A 3DBLA 4S1VA 1R12A 5F21A 4D44A 3LVFO 4UVDA 4EITA 3C7AA 2JFFA 4EEZA 4YJFA 1UXKA 3QA9A 4BKOA 1EEHA 3AI2A 2IZ1A 4I5GA 1DSSG 1A7KA 3MZ0A 3H3JA 2C20A 3HE3A 1WW8A 3JD3A 1YB1A 3IKVA 3KVOA 5COQA 1P1FA 1GUFA 4IJKA 2EKQA 3GZ4A 5U9CA 3PFFA 1DOHA 4XGKA 4XQ9A 3ST7A 3W8EA 1YBAA 1KS9A 4BNWA 4F6CA 1FDVA 1E92A 1H6AA 3WFJA 3DZJA 1PTJA 4YR9A 3VDQA 4YCAA 1NM5A 3PQDA 5JDIC 1JKJA 1GV0A 5C7IO 2AQ8A 1QMGA 4YTEA 3TL3A 4WNCA 3AUUA 5KJEA 4DVJA 2X5JO 3ROKA 4ALJA 2HMWA 2OHXA 4ALLA 4I08A 1CJCA 1HDCA 3DMYA 5T64A 5TJ9A 2OXIA 3WTBA 1K0UA 3OM9A 5L95A 4LN1A 1FJHA 4EGFA 5ITWA 4CM3A 1LDYA 1Y9AA 3O8QA 1EUCA 3K9QO 1U5AA 1U3TA 1E7RA 2YYYA 1ZSYA 3P5SA 2D5CA 4INAA 4WK6A 2ZYDA 3BMCB 5THKA 5TJHA 4KDFA 1G0OA 3DONA 4CMEC 1HDXA 2EXXA 1XCBA 1I10A 2V7PA 4AICA 3A4VA 1YBMA 3S2FA 2B37A 2WYWA 1WDKA 1E0DA 1GPJA 2XOXA 4IXWA 4Q39A 1BWSA 4RJTA 2Q2WA 3WOHA 1FDSA 3CMCO 4CM6A 4IGEA 1I30A 4Y8VA 2WD7B 3RIHA 3F47A 2OP0A 3W1VA 3FBTA 2O50A 1K89A 2YV3A 3JYPA 4AJ1A 1LLQA 3KUXA 4ONEA 3RSHA 3VH1A 2DKNA 3I23A 3LLSA 2YUTA 3TRIA 1A4UA 1OI7A 2D5AA 3INTA 4FGSA 3GUYA 1SNYA 3INGA 3KEQA 4XDYA 4IJWA 1L7EA 1YDEA 3L6DA 2CFCA 1U8FO 2JHFA 1VPDA 4GSKA 4L74A 4OMUA 5BNTA 4M55A 3RKUA 1U7TA 2OGUA 2ZJ1A 4D45A 3PHIA 5JCJA 3GDFA 3OJLA 2BFOA 5IFLA 1PJSA 3I6QA 1X15A 1W8DA 1YL6A 1IYZA 4FJ0A 1LX6A 3W6UA 3ASVA 3UVEA 5TIIA 1N5DA 1OC2A 1KIFA 1WP4A 1VM6A 3UW3A 4WCFC 3BYZA 1B26A 3GPDG 3M1AA 3PJFA 4CR6A 3L9XA 4CL8A 4URFA 3K73O 3QIVA 1M76A 3RROA 1K3TA 2I3AA 1I3LA 3DBLB 2HDHA 2EF1A 1Y8QA 2PKQO 2AA3A 4IDDA 1GQYA 4MKRA 3RUFA 3KYCB 4YJFB 3PWKA 1RM3A 3NJ8A 4HNGA 3D5QA 3JSAA 2P2SA 3ADOA 2P91A 3OMLA 1GYRA 4LRSB 2VUUA 1P1KA 2VRBA 5IDYA 1UJMA 4BO5A 5IG2A 3SC6A 4OXNA 4DL9A 2LDXA 3I9NA 3ROPA 1N92A 1X0VA 1LNQA 4LCEA 1PJQA 2D2IA 3BZUA 4YWJA 2OZPA 3HUDA 4MKXA 2FWMX 4IMPA 4B4OA 3N7UA 1VJTA 3WIDA 1KERA 4EJ6A 1UP6A 4RPKA 1IL0A 3RFXA 3WQSB 5G4KA 2ZKLA 3D4NA 3FTNA 3JV7A 1BTOA 3BMOA 4TMFA 1U1IA 4B4WA 1YVEI 4U6QA 3GAFA 4AJOA 3TL2A 2JFGA 5CP8A 3PI7A 5AXDA 3E9QA 4GAEA 4BGEA 1RJWA 3PFWO 1PL8A 1R4MB 3VOSA 4IS2A 5AQ1A 3LK7A 1U9JA 5ES3A 1ORRA 3WG9A 3P2YA 3PVZA 4YB8A 3ZNNA 3G1TA 2FPGA 3H9QA 1GL3A 1IPEA 2FMUA 1A7AA 1HKUA 1IY8A 2QIOA 3KSUA 2VYNA 5JY6A 1K6XA 4CJXA 5JLAA 4IXTA 3E5MA 4R5MA 3SLGA 3LC1O 3GHYA 1JDJA 1BVUA 1PZGA 1EVJA 4QX6A 1VC2A 1YGYA 4BKPA 4OO3A 1RWBA 1LRKA 1W6UA 3EUWA 5IXSA 1UDCA 2EERA 4ZQHA 2CVZA 4QEDA 4ZQFA 2I5PO 1DRVA 4CUKA 1EK6A 4RORA 4HFJA 3HDHA 5F1KA 4R3NA 1TEHA 1P1JA 5CG1A 1Z73A 2IODA 1NYTA 1LC0A 1T4DA 1GY8A 4YQZA 2B4RO 3ICCA 3NV9A 1XU9A 4IINA 3V1TC 4E2ZA 4BKQA 4PLFA 4FB5A 4FJ1A 1HDGO 3S8MA 4MIYA 5DULA 4BNNA 1O89A 4ROSA 4ZN6A 1E1KA 1LSOA 5HM8A 1E3EA 1C0PA 3ZCXA 1UXIA 2D59A 4DIFA 4E2WA 2O3QA 1E5QA 5DDIP 1Z7BA 5I9NA 2TMGA 1XU7A 4AJIA 5JPIA 3AOGA 4YPOA 3MJSA 3E18A 3ZU2A 2GN9A 1PGQA 3C1OA 3R1IA 3RAJA 4WKGA 1R4NB 1IZ9A 3R3SA 4NU6A 4BNUA 4MP6A 1YJ8A 4CLDA 4WLEA 4DPKA 2PY6A 3AY6A 3OA2A 1IOLA 2VHVA 4E5PA 3PYXA 3BHJA 1NQOA 5H82A 2QW8A 5MGBA 3C3XA 1GR0A 1X1EA 1HDZA 3L0DA 1LDMA 2A9FA 2C54A 1DC6A 3HSKA 4HUJA 5F5LA 4WCFB 3F4BA 3IMFA 3AI3A 4NZ9A 2CD9A 2I76A 4QTZA 3Q11A 1P0CA 4JN6B 4QQRA 5U4QA 4G5HA 2B5WA 4N5NA 4R1UA 4RPLA 3L9WA 1S6YA 3QVTA 4CM8B 1ADFA 4NI5A 3DBRA 2E6UX 5A4DA 1TI7A 3PPIA 1AUPA 4XYBA 2Y66A 3P7MA 3RC1A 1E7SA 4PLCA 3VPHA 1V3TA 3DAGA 1LI4A 1PJBA 4RO0A 1PJ2A 3M2TA 5HA5A 3PK0A 3AK4A 4GMGA 4IDEA 4L0QA 2IDZA 1BG6A 4A26A 1QLHA 2X7HA 1HE4A 3OJ0A 4RF3A 3B6ZA 4PVCA 3DOJA 3ZWVA 2YQ5A 4FDAA 2TMDA 1NR1A 2O3RA 3SLKA 1HZJA 2Y1GA 2VCYA 2P5UA 3EHEA 3H9EO 4UVIA 3T4XA 5CEFA 3PLNA 3Q0EA 3QV1A 4PVDA 1QSGA 2EIHA 5IJZA 1JW9B 2NWQA 4IDAA 4NJMA 1XIVA 5GMOA 4S3MA 4OOEA 4WJZA 3HN7A 3NGLA 4H7PA 4HKTA 1BSVA 1DIRA 1B8PA 1Y8RB 2NQ8A 2W2LD 3JQ7B 3JD4A 3UFXA 1SPXA 5T57A 2VHXA 3WB9A 5DOVA 4NH4A 4A0SA 1IHYA 3WLFA 4NQZA 3STHA 4J0EA 3GEGA 1R0SA 1V3UA 2XXJA 4BNXA 1ZBQA 4ZQBA 2HCTA 4M87A 1LQTA 1VL8A 3GZNB 1GADO 4PLVA 5CDUA 4AJLA 3U09A 1XGKA 2VTDA 3H8VA 4CR7A 3GK3A 1ENYA 3LQFA 4IBOA 4J91A 4O63O 5FFFA 1N2SA 3BMCA 3CPSA 1ONPA 2I66A 2WD8A 2YW9A 9LDBA 4IS3A 2NLOA 4WLNA 2ZTMA 3U49A 3GR6A 4E5NA 5C7OO 1JAXA 3BXXA 3K92A 3IKTA 4TVBA 1MX3A 3ICPA 3KSDO 3TF5A 3ULKA 3K6JA 1PJ3A 4J16A 4LMPA 4WLFA 1NQ5A 3V2HA 2Q2QA 1Z74A 2O4CA 3E48A 4K6FA 3WYEA 3Q1LA 3GOHA 4MVJM 3D1LA 3MJVA 3TWOA 1EVZA 1M6HA 2PLAA 4IDCA 1HE3A 1ZNQO 4NIMA 1E1LA 2W98A 4RVHA 4QFCA 4BV8A 4YRBA 3NAQA 5B4VA 2PKQP 3V8BA 4GPD1 1SEVA 2A92A 1J5PA 3JTMA 4D0SA 3TZ6A 4NBWA 4GWKA 3VPXA 2FZWA 1R6DA 1GEEA 1VSUA 1NVTA 3DOCA 1DIHA 1PZEA 3ZN2A 3DAFA 4NDNE 3GPIA 4OM8A 3WSWA 1C1DB 5A04A 3C7CB 4OSOA 4AJKA 3GN1A 3IL2A 1H6BA 1KVQA 2OBYA 1Q0LA 2O2SA 3B20A 4FC7A 3VPFA 4RF5A 2AG5A 2ZB4A 4RV9A 3HFGA 3RBXA 5A9TA 1DAOA 4IQGA 4GVLA 4DBZA 4DIBA 3A1NA 4Z9XA 2GN4A 3HDJA 3JQ8B 5CPFA 2B83A 1O5IA 3FNHA 3KOUA 4KTVE 4U5QA 2Z1MA 3V1YA 4D0RA 3NGXA 4XGIA 3WGZA 4WASA 5G4LA 2Q1TA 3VVCA 5A3VA 1TT5A 3IP3A 4D46A 2BI7A 2O7QA 2X23A 2J3HA 1CDOA 3U5TA 4NG5A 3BTUA 6LDHA 2J6IA 2DUWA 2ZK7A 3GAZA 5A9RA 4NJOA 1X14A 1GCOA 1ZJYA 5KVQA 1RM4A 3GT0A 1JKFA 2VHZA 4BNTA 4Z0TA 2IZZA 2DU8A 3TZCA 4PIVA 4RVGA 4UVEA 3S55A 5DNAA 4L4XA 3OIGA 4HBGA 3W6ZA 4M8SA 3ENKA 2I3GA 4ZQGA 1DC3A 3E8XA 4TRRA 4N5LA 4PZEA 2GPTA 3DHNA 2BRUA 1CF2O 5JO0A 4YT8A 5G4KB 1JA9A 3O4RA 3FR8A 4LSMA 1JAYA 1KEVA 3M6IA 2IZ0A 3A06A 3OJOA 2DPGA 3PWZA 3OJFA 4UAGA 5F5NA 4ITUA 1WZIA 3ZH2A 4BB6A 1PS9A 5ER9A 2NUAA 5L7TA 1ISHA 2CUKA 2PZLA 2X0RA 3PJDA 3KYDB 4NHEA 1E7QA 4E12A 1HT0A 3O9ZA 4IPTA 4CQLA 6ADHA 1H6CA 3LF2A 3FD8A 4DQVA 1GFSA 4Z6KA 3FN4A 3GMDA 3NT2A 1VJ1A 2NV6A 4MVJD 4RF2A 1YH3A 4BO7A 2ZCUA 4M54A 4IQ0A 4WUVA 3U0BA 4XD2A 2W8ZA 3WIEA 4NK5A 3ZHXA 3TFQA 3UCEA 4E0BA 1O9BA 1I3MA 2QX7A 5F1PA 4J1SA 3VZPA 4J2OA 4H3VA 2IXBA 4KTTE 1E77A 3SX2A 2YHIB 3W8FA 4ALNA 2Z5LA 1ONNA 4J9UE 1YKFA 2YFHA 1D3AA 4J1NA 2ZTUA 3WSVA 5G0UA 3PGXA 4PLWA 2I67A 1AXGA 2B35A 3F46A 4TZTA 5BNFA 3DEYX 4J4BA 1XYGA 1H2BA 2I65A 5BNIA 4JJFA 4BOYA 4BNJA 3AU9A 4FGWA 2WE7A 3ABIA 4YQYA 1DRUA 4EEXA 1F14A 4DGSA 2O3SA 3PP8A 4GLLA 2PZKA 3F3SA 1AE1A 2BGMA 4ESOA 2X0NA 3I9MA 3WGYA 4CM1A 4BNKA 4CPDA 1GU7A 1KVSA 2VZ0A 4NBRA 1B14A 1R0KA 5J23A 3NTOA 1CERA 2NTVA 2PZMA 3H7AA 2JAHA 1X0XA 4XIYA 4A03A 5JNLA 3H5RA 3PHGA 4WCDA 3FWNA 4JBHA 4OIMA 4MKZA 3GRPA 1MA0A 2AE1A 4BMSA 5EJ2A 1WLYA 4J43A 3GEMA 3C1TA 3OICA 3WGOA 5K6AA 3DMTA 3HDQA 2VHWA 3SJUA 1H5QA 4LISA 5TC4A 2VRCD 4KZPA 4DMMA 1DO8A 3G0OA 1T2EA 4JX8A 2PFGA 5A1TA 1WPQA 4XJSA 1UUFA 1U8XX 1DEHA 1HETA 1K2WA 4ALIA 4KMSA 3PHJA 2RH8A 1XG5A 3H9UA 3NT4A 3GGGA 4YT2A 5BQFA 3GNTA 1GD1O 2J5KA 4UVHA 1D1SA 1PX0A 2P4HX 1EBUA 2RIRA 4LVCA 3JCZA 1ZXBA 2DBRA 2P4QA 5DBGA 3JQAD 7MDHA 2FSSA 4Q9NA 4MIEA 3V5NA 3W8DA 5JMPA 5JW6A 2GZ3A 4DREA 3ZNQA 2D4AA 3IUSA 4BMVA 4JBGA 4JK3A 1HYGA 3CZMA 4OQYA 4D3SA 2B4QA 3H6KA 1V35A 3VAZA 2W2KB 4CQLB 1XSEA 3WGTA 4J4HA 3KYBA 3KETA 2RCYA 5IF3A 3AFNA 4AFNA 1B7GO 1VE9A 1ISFA 2QYSA 4GX2A 2W4QA 3EY4A 3QVXA 1Z82A 4GKVA 4FFRA 4JIGA 2JHGA 4AJEA 3LYLA 3RUCA 3IJRA 2W2KA 2DFVA 5L4SA 4FFLA 3U4DA 2IEDA 4BO2A 2OMEA 3ZHZA 3JYNA 1MFZA 2NSDA 1YQDA 1NFFA 3IOYA 3T7EA 4ND1A 4YAIA 1N1EA 2G76A 4K1LA 5TT1A 3WNQA 5GZ1A 1EBFA 5JFOA 1PZFA 4WPGA 4CLRB 1U7HA 4AVYA 4R1SA 2CF6A 3TNLA 1GQ2A 4XRGA 3GVCA 1GYPA 4AG3A 1Y8RA 5TSDA 3DTYA 1PGPA 1F8GA 4NBUA 2C7GA 2YZ7A 3PYMA 3U4CA 2EG9A 3BMQA 4TKLA 1BMDA 3GNQA 2X6TA 3JQAA 1ONOA 2CDBA 3N58A 4RZIA 1DFGA 5HRUA 3RJ9A 4EBFA 4G2NA 4R1TA 4FOSA 4PLZA 3WMWA 3WGGA 2HK9A 4CQMB 1UAGA 1KEPA 2CVOA 3M1LA 5K0ZA 3D3WB 5LDGA 1QV6A 3ITKA 4RVDA 1WZEA 1N1GA 4U0JA 5TT0A 4ZICA 2AEFA 4RVUA 4A73A 3CIFA 1NHWA 3ITDA 4MDHA 2Z1NA 3O26A 4U7WA 1H9AA 4F45A 1ZH8A 1DLJA 1RM5A 1BDBA 5JBIA 1VLLA 3FPCA 2O23A 5KVVA 4W9NA 3RWBA 1N8KA 4R01A 1PWZA 3ZWYA 2GCGA 3Q9NA 2CDCA 1TT7A 1O6ZA 1X1TA 4YT5A 1EDOA 3LU1A 4XQGA 3V1UA 1I3NA 4BO9A 2D1YA 2PD6A 1ZXLA 4OXKA 2PR2A 5FI3A 1FK8A 4FPXA 4KP7A 4DLLA 2O4UX 3AY7A 3DZFA 3I3OA 5KJFA 2AEJA 3OH8A 3RC7A 3MCVA 3NKLA 5EERA 1LDEA 4N7RA 1Q2XA 2PH3A 1DJQA 2J5QA 1HWYA 4E33A 5FWNA 2HSDA 2WD7A 1C14A 5IZCC 1Q7CA 5CG2A 4KUGA 3WWYA 2X0JA 4U0KA 1SZJG 1PS8A 1YO6A 5IAAA 1LU9A 4RLHA 3VPGA 3K2EA 4UVGA 3PDJA 2W90A 1ZK0A 2YDXA 3JQ8A 4LCJA 1NFRA 3UKOA 5TLSA 3TSCA 2VWGA 3I9OA 4OKIA 3H3FA 3MEQA 1TT5B 5KWEA 2CY0A 1GYQA 1X7GA 2HUNA 3GVIA 3D7LA 1QYWA 1AN9A 4XDZA 1BW9A 5JAQA 1HXHA 2FR1A 4QO7A 1NTOA 1LLCA 2HMTA 2BHLA 2DUUA 3N74A 2EP7A 4OKNA 3B1FA 1W4ZA 1E7MA 2HMUA 5TRTA 2I99A 4YDRA 1VI2A 1ENPA 3DAPA 2OO5A 3DC2A 1ZSNA 3AUSA 2BGLA 1HDRA 1GZ3A 1KYQA 3OIFA 2BKAA 3D0OA 4P8RA 2PV7A 4HX5A 1CIVA 1JLLA 3QRWA 5B12A 1Y81A 5LC1A 4CLEA 3X2EA 1T1RA 4MPDA 4QO8A 1ADBA 3V2UA 2XF8A 4MJLA 4HFNA 5L4NA 3QW2A 1LRJA 3WQQA 3H65A 4R69A 5MDHA 2FY8A 3CMMA 4W6ZA 5DP1A 4J0FA 2WMDA 1NQTA 4FSHA 1J6UA 3DZGA 1BRMA 3FF4A 1D8AA 4QUKA 3BMQB 5A05A 4E5KA 2ILTA 4NBVA 1EFKA 1F8FA 1PIWA 1UXGA 3PQEA 3GG2A 1WAMA 2Y1FA 4I1IA 3TPCA 4CMHA 4DPLA 4CUJA 1IULA 1KEWA 4EJ0A 1HYHA 3PLRA 1I8TA 1PQWA 1OAAA 2W2LA 4XYMA 4I8XA 3HDYA 1RKXA 4N54A 1WXDA 1OMOA 3RBZA 4RDIA 4D43A 1EK5A 1LSUA 3ORFA 2NACA 2C5EA 4OL9A 4NK4A 3QP9A 3UCFA 3ZWXA 4W7IA 1I0ZA 2J3IA 4ALKA 1E3SA 4FQ8A 3LSYA 4XQCA 4YJHA 1B8VA 4HP8A 4CMIA 2VHYA 2WEKA 3ADPA 4CMBA 3CKYA 1KC1A 3WS7A 3WJ7A 4D79A 3NDJA 3L4SO 2BF7A 4BL5A 3ZU3A 2UUOA 2ZTVA 4F6LA 2Y0EA 2D0IA 1SMKA 2VWHA 4M49A 5EQDA 5I8ZA 4CM4A 5FYDA 4BKRA 3ZV3A 1HRDA 4Y6SA 2NU8A 1VL0A 4MIOA 3UICA 4J1QA 3B70A 1QYDA 4DWVA 3LDHA 1QORA 2ZQYA 1MGOA 3HN2A 2BLLA 3FNFA 1YJQA 4JCOA 3IAHA 5AYVA 4Q3BA 4YBZA 2Q46A 1HF3A 3RQSA 5G0SA 5JDIA 2Y0DA 4JNKA 4DXHA 3BTVA 5L4LA 4QECA 1L7DA 4XGNA 2FPPA 4IJVA 1ZIDA 2G5CA 2HK8A 1SB9A 4JLWA 1YWGO 1E6EA 3LZ6A 3ZWCA 1MLDA 4E6PA 2GF2A 2JKVA 3GG9A 5A5EA 1DIGA 1U2DA 5GZ3A 3AM5A 4AJJA 3HB5X 1QG6A 3GA0A 2E82A 3EW7A 3QHAA 2VYVD 4Y6RA 2YHUA 4FFOA 2NU6A 1PEDA 4R9SA 3Q3CA 3GF4A 3KLPX 1YE3A 1D1TA 3OQ6A 2DVMA 1VSVA 4O1MA 2YDYA 4U8GA 2NU7A 4TRMA 1UZMA 1PS0A 5K6AC 3R0IA 1UH5A 3GN2A 4RCVA 2BD0A 2DTEA 5JC1A 1PZHA 3ONDA 3ZV4A 3JQGA 5AOVA 4MVJP 1PGOA 4W4TA 3WYCA 3NRCA 5A02A 5JAIA 1R15A 3O38A 1MB4A 4UUNA 1Y8QB 1QXSA 4AJHA 4NNJA 2X5KO 4YAGA 5JE8A 4PRLA 4J49A 3WGIA 3TZKA 1DBVO 3ONFA 1DFHA 4I5EA 4B3IA 4YT4A 4WLUA 1KY4A 4GL4A 1EVYA 4LVUA 4AJ2A 1NHGA 2AEMA 4PRKA 4O6VA 1M2WA 2C29D 3QJ5A 3UH1A 4JQCA 4LK3A 2AG8A 1E1MA 5F1OA 2EEZA 4L4SA 4BGUA 3ASUA 4CMJA 5JY1A 3PWSA 4M89A 1I2BA 1Y7TA 3PRJA 2ET6A 4PG6A 2HRBA 4CLRA 4FCCA 3G79A 3P2OA 3ZZNA 1YS4A 4UUMA 1E3WA 3HWRA 5KKAA 2DBZA 4AL4A 3DHEA 4XEHA 4J1TA 4Q3NA 4BNFA 3AUTA 2DPHA 1N7GA 1NVGA 4KQXA 4HADA 4BGVA 1O8CA 3C7DB 1H6DA 2UYYA 1VL6A 4RL6A 2DTXA 1PJ4A 2VOEA 3O03A 4MVJE 4MO2A 4ZRMA 5L51A 4PLPA 3R6DA 3AI1A 1NFQA 3PDUA 1GUYA 1ZEJA 3OECA 2R2GA 3WQRA 1TLTA 2Z95A 3IJPA 3KV3O 5A9SB 4LW8A 1QRRA 5BSGA 1PJTA 1MUUA 1YL7A 3F9IA 3VHRA 4I5FA 4RDHA 4TWRA 4YAKA 1F0YA 3K96A 2Q4EA 2NU9A 3QWBA 5DF1A 3KZVA 3SVTA 3QSGA 5DP2A 5U1PA 1FMCA 2HJSA 1F17A 2RH4A 3VKUA 4F3YA 3MJTA 3QLJA 4W7HA 3EDMA 1U4OA 2YV2A 4NU5A 1LEHA 4GGOA 1KVTA 1ZCJA 2HAEA 1LA2A 1PR9A 3ETDA 4RGBA 3ZWPA 2Y1OA 1NNUA 1YB5A 1Z6ZA 3K30A 3W4IA 4YRAA 3JD2A 1E7WA 4C7JA 1ZSVA 2DM6A 3DXFA 3HHPA 4FFNA 3WBBA 3ETEA 2HMSA 4CM9D 2EGHA 1IUKA 2NVWA 1K5HA 1SOWA 5EINA 4J7XA 1P1HA 1O95A 3FHLA 2CNBA 3DL2A 1J0XO 1C0IA 5AXBA 5A3JA 3WX0A 4G81A 3FR7A 1RM0A 2VUTA 2Q50A 4AJPA 3IUPA 3Q9UA 3RVDA 5L53A 3MTGA 4P22A 1AHIA 2O3TA 1R4NA 1HSZA 2PWZA 3GDGA 4XRRA 2J3JA 4D7AA 5T67A 4CODB 1VKOA 1RYEA 4BNVA 1IB6A 3TOXA 1A5ZA 3BMNB 3KLMX 3E9NA 3F4LA 1CYDA 1NR7A 4UUPA 1EUDA 1PJLA 3WYBA 2O7SA 5I8WA 4CR8A 4UULA 4E30A 3GVXA 1XEAA 3QWFA 3S2EA 1YBVA 1B3RA 2X9VA 3PZBA 1DLIA 2JCVA 3GVPA 4QFDA 4TKMA 2OOSA 1ZK1A 3ROMA 2SCUA 3RI3A 1EQ2A 3PJGA 4WCFA 1GDHA 1O0SA 1KC3A 5BSEA 3PGJA 1HDYA 3KYCA 4X54A 3JYOA 5DZSA 4PLYA 4Z0PA 3ZNOA 4OSPA 3PHLA 5ADHA 2GSDA 4MOWA 1NQAO 3VVBA 3GRKA 1R37A 3GY0A 3JQGB 4XIJA 4CM8A 1VJ0A 3JQBC 3ZWAA 4LGVA 1GQQA 4LSWA 1D4FA 4OJNA 1Z45A 1QV7A 2I6TA 3DMTC 3ZWWA 3FSRA 4RPJA 2G0TA 4IDFA 3ZWMA 3E03A 4EI2A 3CZRA 3EK2A 4YAEA 2PZJA 4E4YA 2VYVA 3D3EA 4DBVO 5GZ6A 4DPMA 2CDAA 4NFYA 3SJ7A 4BB5A 1C0KA 4BNMA 1E3JA 1SOVA 3NTRA 1ISJA 3ZWBA 4B3HA 5JAMA 1ZK3A 1TXGA 3VTFA 4J7CA 4Y9DA 4XX0A 3TZQA 4IZHA 2QQ5A 4BQPA 1C1XB 1LDGA 1M6WA 3Q6IA 3GH3A 3CTMA 4Q3CA 4DUPA 4BO0A 5AXAA 3OBBA 5A9SA 5KTKA 2GN6A 3FNGA 3RUIA 4UEJA 1DXYA 5KKCA 2C2YA 2Q1WA 3DDNA 2CZCA 3RFVA 4BNLA 5EMHA 2OFPA 3DO5A 2ZTLA 1MXFA 3B1KA 1JTVA 3QWIA 2H9IA 2VZ9A 1ZO8A 3EYWA 3D4PA 4L75A 3IQDB 2X0IA 3CSDA 4GH5A 1B2LA 3AU8A 2G1UA 3LF1A 3RFTA 3I6IA 4FR5A 2R6JA 4UREA 4YJHB 4ZQEA 2UV8A 4K28A 3H4VA 4YRDA 2JD0A 1P33A 4FS3A 4KDEA 3CXRA 1PGJA 1CQIA 3JQCA 3KSZO 3U3XA 3D5TA 2Q4BA 3Q2KA 3EAGA 3PYLA 4E5MA 1V8BA 4N5MA 4P4GA 3UGKA 3P19A 2GR9A 2WYVA 5JDCA 1HTBA 2ZB3A 5I7SA 2IE0A 3MJ4A 4CM4B 2NVUA 4ND4A 2XPCA 4NBTA 5T8KA 3IP1A 1AXEA 3E9MA 3L77A 4HWKA 1P45A 1X7DA 2GASA 1XDWA 1ENZA 3H5NA 2F1KA 3O8QB 1U2GA 5T5QA 2FR8A 5CDSA 3PIDA 1B8UA 3AJRA 3AM4A 3PIIA 5JAZA 1MXHA 4HFRA 4CV1A 4GVXA 4OQZA 1JWAB 4L73A 3WICA 4GI2A 4L4RA 4WEOA 2ZYGA 5COBA 1ZMOA 4J3FA 2PKRA 4CV0A 2B4TO 3WGQA 2XXBA 3BMNA 2AQIA 1P9LA 2FZEA 2C59A 4PG7A 2VNSA 3H5AA 4R41A 1M75A 1U3VA 1A71A 3HJAA 4CMGA 3ZGYA 3RUEA 4DLBA 2QZ9A 1HDOA 3LLVA 3FWZA 5ITVA 3SXPA 4ZD6A 2BH9A 4JP3A 3PHHA 3WGHA 3OSUA 5B37A 4PG5A 2GNAA 4XB1A 3WWZA 3I9JA 1UP4A 2FN7A 1XHLA 4FC6A 4E32A 2EKPA 4XYEA 2PGDA 1DFIA 2V6MA 3JQ9C 4J4TA 4PZDA 1XR3A 1A9YA 2PD4A 2AQKA 3NEPX 2JD1A 3DZBA 4B4UA 1PL6A 2AQHA 3QE3A 1H93A 5KCZA 1H9BA 2DBQA 3EC7A 1T2AA 3PZRA 4R5HA 4XA8A 4R54A 2I9PA 4II3A 4NPCA 3E82A 1BGVA 3AW9A 5DN9A 4EUFA 4R4JA 5EESA 3TZHA 4GX0A 3PQFA 3LC2O 4UUOA 5L40A 2Y93A 2RAFA 3JQBA 3MJEA 3RU7A 1J49A 2DAPA 2NM0A 2HJRA 4BO6A 2EW2A 3F5QA 3DZKA 3ENNA 5HWSA 3RCBA 5F3RA 1I32A 2QG4A 5THQA 1ADCA 1DHRA 1MG5A 3L4BC 3IDSA 3QVWA 5L9AA 2Y0CA 2EGGA 1BXZA 3T7CA 2UUPA 1ULUA 1MC5A 3MJCA 4YJGA 5TF4A 5HS4A 4I9HA 4K9DA 3DQPA 1E6WA 5EQFA 1B16A 3I4FA 4HNHA 5BSFA 1OFGA 3GEDA 1T1SA 1WMBA 2LDBA 2CVQA 2Q49A 1YONA 5I7FA 5KIAA 5KJCA 1WMAA 1UDAA 2VOJA 4Z3DA 3U9LA 1XA0A 4PG8A 2WE8A 3ETGA 3LT2A 4YYZA 3HZZA 4WOJA 2WM3A 4GKBA 2RBEA 2V6GA 5B4UA 1SEPA 1DC4A 3ANMA 3NYWA 2QZZA 3DOOA 3NDIA 3AY3A 3VPSA 3IS3A 3V2GA 2JFHA 3BMOB 1R0LA 2BFPA 1IZ0A 5COAA 4FN4A 1NWCA 5L45A 1LDNA 4BO1A 3OF2A 1V6AA 2X5OA 3EZLA 1L1FA 1GPDG 1CETA 1UDBA 2NQTA 2QRLA 4G65A 5G2OA 2OBNA 3QY9A 4BNYA 2Y1EA 2NNLD 3ROQA 4A10A 1SCUA 4MVJA 4WGGA 1NX6A 3RKRA 3E6AA 4XR9A 4ZVVA 3ZDFA 3WJAA 2DQ4A 5AXCA 4DA9A 5IDXA 3TFOA 4OXYA 4E21A 4QSMA 1XKQA 1DIBA 4GMFA 4DYVA 1B15A 1EFLA 3JQFA 1P74A 2EJWA 1Q7GA 3AOEA 2FSVA 3ON5A 1B3BA 5A06A 3JQFC 5ER6A 4CQMD 1T24A 1XWFA 4R68A 3NJ4A 2DLDA 2H6EA 3OETA 4WLOA 4BKUA 3OP4A 4PN3A 1A27A 1KVRA 4BGIA 5H83A 3F5SA 4A7PA 5TNXA 4CQMA 3IIEA 2H5LA 4XR4A 1ZZEA 1ZFNA 4WECA 5DOZA 4XKJA 3RC9A 2WYUA 1BXGA 2J3KA 2ZIZA 3G17A 1P77A 3DWFA 3HNPA 2GERA 3CH6A 5JCXA 1ADGA 2O48X 1QKIA 2OL4A 2WJPA 4ZA2A 1V3VA 4YJDA 2O3JA 2C7VA 4WLVA 1R66A 3HB4X 4DMLA 8LDHA 2X86A 4I9NA 1E1NA 2AXQA 2Y05A 2YHIA 4WE3A 1QYCA 1NPDA 3QWHA 2RHRA 3UF0A 4M1QA 1P44A 3SBOA 4ILKA 2NTJA 2PGLA 3H2ZA 4XCVA 3GMSA 2QRKA 3ANNA 3BHIA 1MC4A 4MP8A 2IRWA 3DB2A 1DC5A 1ARZA 3F6YA 4CV3A 3VZRA 2V65A 1LRLA 3EZYA 3KXDA 4DC0A 4PZCA 1I36A 3Q2IA 4B7XA 1E5LA 2E49A 3L4BA 3GHHA 1X13A 4KQWA 4ND3A 4DC1A 1V0JA 3OA0A 1JU9A 2R00C 2WWRA 4KUHA 1P1RA 3WNVA 5JYEA 4CM9A 5B4TA 2Y99A 1LSJA 2P68A 3DZHA 4TSKA 3X2FA 2GYYA 4EZBA 1Y1PA 1ZW1A 2WDZA 2FHSA 2VN8A 2Y67A 3GGPA 4XJTA 3CUKA 3A14A 2PA3A 2VUSA 1ZJZA 4BQRA 4NFHA 3H2SA
chains in the Genus database with same CATH superfamily
3ZWQA 1W85B 1ZYUA 1NJ2A 1SUCA 2VJMA 4FYYA 4OMCA 3H9JA 3ONEA 1S8OA 1R9JA 2QYTA 5KNLA 1I80A 2PGOA 1NUUA 1X9GA 2B5VA 2JJ8A 3QU2A 1M2EA 5EMKA 1CLEA 1AG9A 1U9ZA 4BECA 1NR5A 5K8CA 4TMTA 1CS0A 2EFHB 2GEVA 2JZCA 4KBYA 3KB8A 2UZ1B 4CIYA 2GGSA 1AF7A 2XDYA 1Z12A 3CX3A 4NCNA 5AKIA 1EFVB 3HQ4O 5AKLA 1TA4A 3OU2A 3AEUA 3DCJA 3G1WA 2MJLA 2CB9A 3HBJA 1APBA 4OPMA 2H59A 4ZO6A 2JAPA 2JHCA 1HYEA 3AVXA 1WDLA 3OZIA 4IX1A 4EQ6B 3QVOA 4YPFA 3OLCX 3A10A 1TRHA 3QFRA 4HFMA 4KO2S 5DHUA 2PX3A 1RADA 3UOGA 5L3SB 2H63A 4DMFA 3E1SA 3ZVRA 4J90A 4TXJA 4NZYA 4EUEA 1G1AA 1VYVA 3FTPA 3P52A 1YRYE 3EZXA 1BHSA 1XTSA 3VH3A 1EFVA 2R3SA 3WR5A 4AY3A 1YL5A 3EPRA 3WGNA 1D1PA 2F67A 2C07A 1LTHR 1N7JA 1T9GS 1K1EA 2BGNA 3AERB 3ENZA 1SCKA 3BIOA 1T2CA 3VR5D 4D3ZA 1V5WA 3TDNA 4ZEVA 4BWFB 2PSEA 3BGSA 5AI6A 5H3HA 1Q6ZA 1TB4A 3U3MA 3GP8A 1P5RA 1KXJA 2C2MA 2REOA 3KQPA 1FFGA 2O8EA 5JJKA 3N76A 5DBIA 3QF7A 5IM5A 2FJUA 4C01A 3GZNA 1MEOA 2FWRA 5KOIA 9MHTA 2IDJA 5IMBA 4LJ4A 4EKDA 4JI0B 1T5HX 1GGVA 1VJCA 3TTTA 4D3FA 1PT6A 1P81A 3CH5A 5FI5A 1MX1A 5KSWB 3K9CA 2NZ8A 2W11A 3TSOA 2VZ8A 1SH7A 1D9XA 2AS0A 4OHUA 2VJYA 1Y42X 2C4UA 1Z15A 4URYR 5DCUA 1IM5A 1M1NB 1T2DA 3KU4A 4PLTA 1N34B 1G6OA 5SZKB 4D57A 1EDZA 5BSTA 3MRVA 3S2IA 4RK5A 2X8JB 4S35A 4KYTA 4JKOA 5GVSA 1WDMA 2CF5A 4YAJA 1VYTA 3QY0A 1RWKA 4BGDA 1KQFA 4BHTA 1EFHA 3A6FA 4A36A 2ODNA 3FCOA 1LK7A 1JS1X 1E98A 4GF5A 4KXVA 2XB9A 4G5GA 4GLFA 1NPTO 3LPDA 4V38A 4HPXB 4DIOA 2V6JA 1NVVR 3PU6A 2CJFA 2B9EA 2QD5A 3PC2A 3RRNA 5BQXA 5JXWA 1FF9A 5E6SA 1OC4A 2Z43A 2I54A 1GV1A 1TCVA 3LT0A 3NHKA 1R0WA 4NBNA 3ZWOA 5A03A 1AA6A 3STVA 1GZ6A 3HJFA 1T4BA 2JFXA 2Q1YA 3O2NA 3L8YA 1NN3A 3VZQA 3HUTA 5KTOA 3NTLA 1WPGA 5HTKA 3DT8A 4P7KA 3EEFA 1CUSA 4IEIA 2XOKA 3NHWA 4I19A 2AMFA 3QFSA 4KN6A 4X8MA 3L0PA 3KJHA 4BIMA 4JS0A 4F3CA 1LJ8A 1SU4A 2HU2A 3CH4B 4FD3A 1JX6A 2IIQA 3K2IA 3QVSA 4RD0A 2YCBA 2A94A 4PCUA 4WEQA 3RH0A 3C7KA 3HMQA 3HBFA 2O57A 1NMXA 1NJGA 4YASA 5CTAA 1XI2A 1FS4A 4PG4A 3QEKA 1E9VA 5AW6A 1SUWA 1XCOA 2WKQA 2ZBRA 4J0KA 4KN8A 5FCDA 3TPZA 2XUOA 5IKOA 1NLUA 3NTVA 4IG9A 4QGFA 2NV2B 2IXAA 3EVAA 4LEIA 4CMKA 1IJKA 3R6GA 1E2EA 1U8ZA 3I30X 5AJVB 3ZX5A 1V8PA 3NETA 1V1JA 2C58A 2H1CA 2I87A 3B13B 4X41A 2FXIA 3ESDA 3FCAA 2FLKA 5M04A 2FUCA 4XWYA 3W5BA 1XKXA 2QB5A 3QXJA 4Y7CA 3FYUB 4M86A 3WDSA 1E66A 3VO9A 1AGNA 1DRKA 3KZ1E 5CB6A 4IMRA 1Z8NA 1TZKA 1XTQA 4QE3A 1KXZA 2HHLA 1OIXA 4ZGWA 1HLGA 1W9HA 2FQYA 3EXHB 1B93A 4N5IX 1CUXA 2BFCA 2MSKA 4UTZA 3RB8A 2PGJA 5IKPA 3AKZA 3ZHYA 2HQ1A 4K8RB 4ZZ2A 3VR6H 1WXWA 3KKOA 2V7TA 3GGOA 2CV2A 5HILA 4CTOA 3E5HA 2RHHA 3F74A 1VLZA 4CKCB 2RHWA 2J6CA 2VPTA 4G9GA 1B8NA 1MJGA 1P62B 3HR7A 4BNZA 4FILA 2B4YA 1YHZA 2A35A 3FI9A 5EXSA 1VKJA 3UJPA 3E8MA 5EWLB 3TUZC 1DB3A 5K8UA 2YS7A 1BJKA 4JD5A 3T0FA 4G1VA 5J4LA 1BJTA 1CG6A 3EVNA 3FKSD 4EYQA 1KKMA 4DXAA 3T5DA 1L4FA 2I6SA 4OBXA 2D1TA 1OU4A 4UMVA 5TQ0B 4BLWA 2ZVJA 3NDBB 2O3UA 2Q45A 4F6RA 2R68A 4IVPA 3KWLA 2HA7A 1H1DA 2LKCA 3PC7A 4WY5A 3I01A 3ZI0A 1RC1A 4KK3A 2ZSFA 4YR7A 2IVFA 4CM7A 3V1KA 1RAHA 2E1RA 5CLIA 1MHPA 5EIBD 3FPJA 2VDWA 1JIJA 1ID1A 4G01B 2LE0A 3IR5A 2AMLA 2AR0A 1E2QA 4WCVA 1FMTA 4L95C 3ZYZA 1GLNA 3B9RA 3JATB 4PRYA 4BMYA 4D9CA 4MDEA 1VHTA 2GBLA 2R6R1 2O0KA 1N5JA 5C3MA 3K7EA 4QKQA 3RF7A 4LY9A 1EFPA 1Y5RA 3E1GA 4U6SA 9LDTA 5K9ZA 1KI6A 1U1EA 1MAAA 3ID6C 3K5PA 1GCUA 2D13A 5JALA 1Q1NA 3NCHA 5L40A 5F98A 3OPNA 1FNDA 2VIIA 4A5OA 1U5CA 3A25A 2Q6TA 1II0A 4EFKA 1B42A 1FDWA 2VNKA 4B2IA 5GTDA 2RHJA 3TIGA 4CNQA 3CR8A 3DBHA 3GD7A 1M66A 2BMDA 4YMHA 4FHEA 5LL6P 4MVJF 4MGIR 2AHRA 4CIAA 2B20A 2WT8A 1N2XA 3ILSA 2WK1A 5FF9A 5CCDA 1F2UB 4EHKA 1RP1A 4LKOA 4ZJUA 1TZCA 3A31A 2PAAA 3FRIA 3NIFB 1A9XA 4ZU3A 4BASA 2W2TA 2PCLA 3N2NA 1IONA 1Z6TA 4MRVA 2V1UA 1SC3A 1QYVA 3SC4A 4BRSA 1XCPA 4CHGA 3HH8A 1KZ9A 3QEBZ 3Q10A 1ZCAA 5G0WA 4AZ3A 5EPOA 5BMOA 4CG0A 4FW9A 3B6EA 3M1YA 5HBRA 1EFCA 2Q3BA 1MO5A 1N5IA 5IC4A 2V3VA 4KXXA 2VWQA 4V0RA 4BRWA 4KGVA 4UDXX 5T3YA 3T3EA 2G70A 2OWDA 5BVHB 1K98A 1UF9A 2BISA 2PKEA 2XT9A 5K3BA 4BMCA 2NO1A 4B76A 2ZWIA 3OIYA 4RWEA 3A05A 4XOUA 5GIOE 1MO4A 3CM0A 1TUIA 3CH7A 4MP3A 3WBFA 4YCMA 5IN4A 3UYKA 1VRVA 1AO3A 4WJKB 4DMCA 2Q5JA 4S04A 3QUCA 2HXYA 1GNQA 3K2BA 4HD8A 4GE0A 4UASA 5JS6A 2O2EA 2AKYA 3AWDA 3PUJA 4ITVA 1NV9A 3K1TA 1LB1B 4NH0A 4AB1A 2C5HA 4EATA 2PLNA 2P65A 1P6QA 4CHTA 1Z8HA 4TVOA 3F78A 1JSXA 3TRKA 3B6MA 4FCVA 3GLGE 2ZBDA 4XSGA 4YV7A 1G3UA 4IM7A 1KS2A 3T5GA 4LX8A 3WHLA 1NOKA 1YE5A 1ZVMA 3KKMA 2C7QA 2F8TA 1KOJA 3TLKA 4J76A 3S1LA 3VYVA 2FW1A 4DQKA 5NULA 3PJRA 1ZS9A 5JHHB 2R48A 3FW1A 4CLOA 3V8MA 1PFGA 3GNSA 4MICA 2E5WA 2GNOA 1T4MA 2RHCA 3AL2A 3QVLA 1UPUA 3UT0A 3JQDA 2I9KA 2YJZA 2XF2A 1YOVB 4MLZA 2PNFA 4IEEA 4PTYA 3HA7A 4L6IA 3GRAA 5HE9A 5KOJA 4LTDA 3MQFA 2JEYA 1SXJD 2ZEJA 4QXPA 2O2XA 4XWKA 2RI6A 4EKEA 1J8FA 3RV3A 4AJ4A 3UCXA 1L5MA 1WSWA 3FI0A 4I6EA 3AESB 5AVOA 1TVEA 3UAYA 4LDQA 4AM8A 5IP5A 2J09A 1F8YA 1JDNA 2PMCA 3A7EA 3CINA 3MD0A 4UAJA 1YS2X 3PJEA 3GMIA 1VG1A 4KKVA 4II2A 1K4YA 3TTSA 3RGGA 2GHIA 1ZM9A 2VPZA 1KETA 1XWIA 4MARA 3LDFA 3MOIA 4C3VA 1QGUB 1KQOA 1YAJA 1QG4A 1JHRA 1M2GA 3QJGA 4TYMA 5LCXA 4RTPA 4ZV9A 2OK8A 4P7JA 4HV4A 1JQBA 1JT2A 2BR4A 1JAZA 1MPXA 2RG7A 2XECA 4XQEA 5GGXA 2BGKA 2O8CA 1JXMA 2VHEA 4UEOA 3KHUA 4IOKA 4EL0A 3O4JA 1QCYA 5J58A 1UC8A 1DIAA 1MVNA 2F43A 2RG1A 4O4HB 2FPXA 4YUAA 3ACCA 5L3ZA 4B6RA 3UT5B 1KHTA 1O6BA 4YHHB 3M6XA 1EP1B 1H4VB 2DBVO 3M6FA 2QAGA 2XKJE 1T3TA 1FFAA 2O8CB 1OB2A 1XQ1A 2I2AA 1OGJA 1XAGA 4FXOA 3MMPA 5D7BA 5SY6A 4B6OA 1FDTA 3TLGA 4EAAA 2L42A 3LKZA 5ICEA 2HZ7A 1A72A 3QBEA 5C8YB 1O58A 3C7TA 2UYOA 1QK4A 1NONA 1RABA 1M9NA 4YIKA 3BE8A 2QSYA 2JI9A 1YNSA 2XNDD 5CIWA 3CRNA 3IEIA 4DWJA 1LS1A 5DRTA 2HLPA 2PK3A 3GCGA 4IHAA 4LBVA 4PPFA 4ESEA 2E4YA 5FLXA 4P0QB 3EQ8A 4Z1MD 4Q0MA 2OBLA 2XQGA 3ROEA 2ERCA 5LXTA 4UBOA 4ENPA 1Z5UA 5EE1A 4KR9A 1FLAA 2ODWA 3KU1A 4NECA 4TMKA 5K3SA 3RAEC 3DTVA 2CMDA 3UXEA 2FLVA 5KBYA 2QRJA 2R8XA 6REQB 4B3GA 5FNVA 3UUWA 3HBAA 3FTCA 5HIKA 5JTUA 1XTTA 4L76A 1QANA 4ZZIA 2OG1A 2GUGA 5HFAA 4QQKA 2PT6A 1M5TA 2IP4A 3UAZA 621PA 3MT8A 3COSA 2D0OB 4Q6BA 3M81A 1UK6A 4TS3A 4QBGB 1E4YA 1WTCA 1LQUA 1UMDB 2A4KA 3AIOA 2IQIA 3WJ1A 3LTNC 1KU0A 2P9CA 3TL6A 2R6DA 3RUDA 3N6VA 1TLLA 3FZGA 3S28A 1CUIA 2WFLB 1P72A 3O1HB 4LDPA 2BPOA 3O3MB 4ND6A 1Y98A 5C7YA 3IC5A 5AW0A 3KTDA 2ATIA 1L4EA 5CT6A 4KHZA 2D2VA 1U28A 4LYYA 3VSCA 2BM8A 4RS4A 1CR1A 1AO0A 4H4DA 1PW5A 1ZHOA 3MUFA 5HQJA 3MPOA 3L7KA 1N1MA 4GG1A 4BZXA 4DLAA 1NRWA 2X2PA 3B3JA 4OGWA 4RM3A 3BA1A 3I1IA 3HVIA 3UMSA 1H42A 3GJ4A 4W8HA 1T5LA 5LA6A 2X1HA 5K2MA 3I42A 1YRBA 4AO7A 5I7WA 1VBNA 2QX9A 2QXTA 1V5GA 4GOXA 1NM5C 2CJXA 3WI7A 2BELA 3B2QA 3D4OA 1YCGA 4TQGA 4EHDA 4GYYA 4M2LA 2UYQA 4K9NA 5K3DA 3IOEA 3INRA 3D6JA 5LZ5A 4QWWA 1R8JA 7AT1A 3HO1A 4D97A 5K01A 2C1ZA 1Q17A 2NSHA 3EXIA 4JWKA 3QLTA 2XHZA 4E2YA 3ASYA 3BC1A 5JZOA 3H9GA 4Q47A 4G23A 4LVNA 4JY7A 3OJWA 3VC7A 2PJRA 1OZGA 1YR1A 5DCWA 4PNZA 1UMBB 3I9LA 2FOIA 3LFHA 3P97A 4JP2A 3KTAB 4XAQA 2QAGC 4C7KA 3VUFA 4ACBA 1XXHE 3Q7PA 4JEUA 4KI0A 3ODPA 1J8DA 4KYIB 1LSSA 2ACEA 2ZRPA 3KVVA 4RETA 2P9TA 4HGQA 5JZBA 2A7XA 4ENTA 1GITA 4OHVA 1B00A 4KQKA 1S2IA 1QF6A 5BN1A 3JPYA 1M33A 3L49A 1F4VA 1B0AA 3H2KA 1T29A 4O59O 4B8WA 4BATA 2OXTA 2RAUA 1RI5A 1PL0A 3IUNA 4K6KA 4LTMA 4PBRA 1QH1B 5H4GA 1KO8A 5CRIA 3W4JA 3CWQA 3MTJA 4GGPA 5MN6A 2ZYWX 3UA3A 4OLAA 1J0DA 2EBFX 3FHTA 4R1NA 1SBYA 3MAJA 3PE4A 1VB3A 2C3PA 2I71A 3TIXB 4CCYA 1V16A 2PE5A 3A2KA 4CMAA 1JR3E 3BB4A 4ZARA 2DQYA 3A58B 3HRHA 1UR5A 2CCKA 2Q6OA 1L9XA 2Z5VA 3OFNA 4YAOA 3U4QB 1UWLA 2IEZA 4O08A 1FVHA 1NN0A 2QLJA 4YVFA 4BMDA 5K45A 4QXMA 4KREA 3WMEA 3RLIA 2I8LA 3NHSA 4LXYA 4RZHA 1LZLA 4LOJA 2JFZA 1NT4A 3N07A 1CY4A 1W94A 1Q3TA 3FPAA 4OHXA 4EK9A 1TCAA 2PXXA 4AYTA 2VG8A 1JNXX 3L07A 4MVJI 4NYJR 4RLSA 4UM7A 4EB6A 5BWNA 3FTFA 4OQXA 1CUWA 4WH0A 4YXFA 2D74A 1SU6A 4E2XA 2ZATA 4Y9TA 3LM8A 5HKBA 5IZCA 1O94D 3CR7A 4DEYA 4PY2A 1L7XA 3GLQA 4OGKA 3ZKAA 5HTOA 2O2HA 5HZKA 2X58A 1BXRB 1NKVA 3AR2A 2EZ8A 1ML3A 4YMGA 2PJUA 2FRXA 2N75A 2XA1A 1E2JA 1FPQA 4CU5A 4NONA 4ZVSA 2R6ZA 2ZUDA 1G8KA 3HGQA 3LO8A 3OMWA 3OLXA 3ANXA 3KJNA 4R16A 2VUHB 3IEPA 5GONF 4JI1B 1SZCA 3AF6A 2VJOA 3ZZTA 1GA6A 2XTAA 1PSDA 4OM7A 1JN0A 3KSMA 2ZRNA 3NT5A 2IYWA 3VH4A 4KU4A 4C87A 4EG7A 2Z3WA 1R12A 3QITA 4S1VA 1YVDA 1J8QA 4JI7B 1BXRA 1QHXA 4EITA 1L5GB 2Q8QA 5F7JA 1MIOB 1K06A 3CBQA 4HLUC 1MVLA 4PS1A 1PT5A 3QFCA 4F1WA 2BI4A 3L8CA 5HNKA 2L2QA 4WVLA 1XHEA 3ORSA 4MB6A 2C20A 3IAEA 3QPBA 1YB1A 1TZBA 4ARAA 1ZUWA 1VP9A 3QF4B 1JYEA 3W8EA 3ST7A 1COZA 1SKAA 1YBAA 4JGGA 4L4ZA 1FDVA 1C41A 1E92A 3G23A 1TF5A 2XE8A 1JTFA 5EJ6A 5KYWA 5CXSA 1K8YB 1NM5A 3GEHA 4M0PA 5B1IA 3KWJA 4G4JA 1RQRA 2AQ8A 4HMOA 3E35A 4MS4A 3RFFA 1ICEA 3TL3A 2C9ZA 5LQDA 1MRNA 2VJLA 2O54A 1ML4A 2H5EA 2P6MA 3ELUA 3IQIX 4EOGA 4ZVTA 1Y4UA 2POCA 1WHTB 2IPMA 2HMWA 2X5JO 3ROKA 2Z2XA 3VR6A 3ZLVA 3M34A 4FMCB 4I08A 5T4EA 2FB9A 1CJCA 3BDIA 2BEVB 3DMYA 3O8NA 3MT9A 1HE8B 3BXGA 4G5OA 3O4FA 2OXIA 4ZYYA 1K0UA 1UKEA 1ORDA 2GK4A 3GJXC 3OM9A 4HH1A 4TS1A 4WBXC 4D56A 4V0MA 4KMMA 1NNLA 2YIDA 2Z3VA 3PD0A 3L92A 4FGLA 5ITWA 2NPIA 4CM3A 2R4TA 5CA1F 1AUQA 2QTTA 3GT3A 5LN1A 2WNIA 4I1RA 2YYYA 3F96A 5AOAA 4INAA 4HDSB 4PSDA 4X1KB 5TXGA 1JFVA 5LMNB 1NBIA 3DSRA 5JVDF 3IBSA 5JROA 3PQCA 4UMFA 1V39A 2HPAA 2V7PA 3A4VA 1HBJA 3T7RA 1IXSB 3BUSA 3OAAD 1V45E 4LHYA 3MYYA 4F21A 1YBMA 5I51A 3S2FA 2YW2A 5TPZD 1V96A 4IXWA 3PNOA 4Q39A 3GCWA 3T5PA 1BWSA 1DJMA 4RJTA 5DI3B 2Q2WA 2WWHA 5DYTA 4B82A 4EH1A 5BN3A 4CM6A 4IGEA 3RIHA 3D0QA 2WD7B 1NNI1 2H9AA 2OP0A 3PNQA 2VA9A 1E9RA 3FBTA 2V45A 2GBLC 3UPUA 3DCNA 1TUBB 1MAHA 4HK4A 4AJ1A 3KUXA 4ONEA 2OYSA 2ZRLA 1I6LA 1G55A 4QPJC 5LUBA 2CNOA 1NDQA 3JWEA 1ZJJA 2DHRA 4WKPA 1KK2A 3INTA 4O25A 3OEHA 5DI3A 4KIUA 1SNYA 2WJWA 1XOIA 3DBIA 5ARBA 4TL9A 4PAMA 4AY6A 1YJAA 3I5XA 2OV6A 1Z3CA 5BV2P 3ROGA 3V8NA 4AWBA 4BQEA 5JV5A 3F5MA 4OMUA 2EJCA 4XM2A 4MQMA 1KU6A 2ZKIA 3MWYW 3QE4A 3PFHA 2WWWA 3BD9A 4IFEA 5JS1A 2CHEA 5TARA 4DV7B 1DXOA 5K20A 4UJ5A 4QHTA 1ZNZA 3L8GA 4HZUA 1A7UA 5CGZA 1TCCA 1W8DA 4IKOA 4LGMA 1D2GA 1QAQA 3W6UA 4XDGA 3CUEF 2I3BA 2HYIC 2YASA 1N5DA 5ECDA 3T7TA 1OWPA 4WCFC 3BYZA 4J9VA 1NYRA 5F2EA 1B26A 3GPDG 1U81A 2PRJA 3MMSA 2QK4A 4QJ4A 5AKKA 3WL5A 4L7QA 3TNYA 1SIWA 3MGAA 4I8DA 4US0R 1JIQA 2FK7A 1R0ZA 1SQSA 2VDQB 5D00A 1X42A 3R7BA 3L8ZA 3QIVA 3D59A 3RROA 3TTXA 2SCUB 3AVYA 2QM8A 5CVCA 2HDHA 2WJIA 1Y8QA 3RUFA 1WCYA 2AA3A 4ED9A 2YZNA 5LMCA 3K6SA 3UWSA 4GOND 4FMDF 2HHAA 5FL7A 2GN2A 1J39A 1R4ZA 3NJ8A 1QZZA 2BCJQ 4ZP1A 3D5QA 2ZRMA 5ICFA 3JSAA 1RZ3A 2P2SA 3OMLA 3RYFB 1NJFA 1P1BA 2XKAA 4QFBA 2Z2KA 3ZDYB 3O1JC 1VA5A 2AK2A 2DR3A 1F1JA 2VRBA 3CURA 3PICA 4XLZA 1USWA 2J1LA 3SHFA 4BO5A 5IG2A 2H16A 4OXNA 1A8HA 4I50B 5DX8A 1N6OA 3G5TA 3HY3A 1FXUA 1HH4A 2HTFA 1YZLA 2D2IA 2ILVA 3TQQA 3F8WA 2Z8ZA 4MKXA 3FDIA 2YV4A 4OQQA 5AHRA 2FWMX 4IMPA 3N7UA 1CQWA 5ELMA 1KERA 4JUIA 3WKAA 3MJHA 2QL5A 2Q21A 4R0VA 5CURA 2ECPA 3D1JA 4RKRA 4KXQA 5G4KA 2KBEA 4ROTA 2BSAA 4I50A 1A96A 3BMOA 3N0VA 4TMFA 1N6RA 1Q3KA 1U1IA 1YVEI 2QPTA 4C07A 3OZEA 4AJOA 4QUHA 2IU0A 3PI7A 5JNSA 3E9QA 4AG6A 3Q7IA 1YJXA 5C18A 3KFVA 4DG9A 4D1YA 1ECCA 3IR7A 2AN5A 1RE0A 2VHTA 2GM9A 3PFWO 4QUDA 3VOSA 4BFCA 2W6JA 4IS2A 2XUQA 3G5AA 4M1TA 2O5EA 2GDJA 3SD7A 3P2YA 2EL7A 4YB8A 3IUYA 3S0JA 1RXCA 3P2JA 2QD4A 2V7QA 1M8PA 2BZ1A 1PG0A 3CFYA 5D3QA 1N2CB 2FFAA 4QTYA 1GL3A 2FMUA 5JJIA 1OPXA 1IY8A 2QIOA 3LHSA 2QZJA 3BIXA 4I99A 4PF1A 1K6XA 3ZD9A 1IY1A 1UJ4A 1TJ4A 1E9AA 1KFBB 2AMVA 1D2EA 3R5HA 3CF6R 2OKGA 1ZU4A 2QTRA 3NUZA 4V0QA 3SLGA 4FTWA 5SYMA 4XARA 4TTSA 1JDJA 4Q7QA 2Z6VA 4Z4FA 2VZEA 4O2AB 1SVMA 3KAPA 3WMFA 4X91A 5D5QA 1EVJA 2X3FA 1E1CB 2IPAB 2CV0A 1KO1A 5BW8A 3HU2A 5LWQA 2O5CA 1F9AA 4OO3A 2C98A 1ULTA 3OE1A 4GEGA 3Q98A 2GK7A 2IW3A 3Q40A 1U2SA 2BHNA 2D1QA 1LF5A 1J2EA 1W25A 1ZD4A 4HB4A 4ZQHA 4DARA 5C81A 2CVZA 1FY2A 1TU4A 2SBTA 2O52A 2VEDA 1AV7A 4LI3X 4MW5A 2I5PO 3JVDA 4QXOA 4X90A 2QBYB 1EK6A 3LQYA 3ZQKA 2LWIA 5F1KA 4B9EA 2H2WA 4X6YA 4YV2A 5CG1A 4OYLA 2W9XA 3KQMA 1LC0A 1A2KC 3EIXA 2OFXA 1CR0A 2B4RO 1XU9A 1E8NA 4WQMA 4AI6A 3V1TC 4E2ZA 1ZM4A 4OXIA 1DJLA 3MNFA 4PLFA 4AKSA 2YHBA 1NBWB 2IKQA 2IXFA 2RK6A 4KR0A 3QBJA 4PQYA 4TQ9A 1U1GA 3S8MA 3RADC 4Z9AA 4RIIA 4BNNA 1D03A 4MUBA 5A2QA 5TE9A 3TBHA 2BUAA 1OXXK 2EX1A 1P5FA 1QQBA 4I1SA 1LSOA 2C7BA 2VKQA 4PC2A 5E0OA 5DDIP 1A9OA 1KI1A 1NVVQ 4O2RA 1PQ4A 4D9BA 3PKIA 2QRZA 2WF9A 5HSGA 5JD6A 1TPZA 2QTFA 2QVXX 1P5ZB 3O7MA 4HUQA 3IRUA 5EZ5A 3IFSA 1EXNA 4HS9A 2FEPA 3UWMA 1CJUC 2GN9A 2HJHA 3RAJA 4WKGA 3BXZA 4U02A 2HO4A 4LBWA 4KYUA 8MHTA 3M9LA 4BNUA 2XXAA 1XZEA 1EWQA 3QKIA 3TYXA 4PEVA 2JH9A 4M4SA 3PFBA 3C15C 1UJ2A 3W5JA 1KZHA 4E5PA 2EKZA 3PYXA 1FNSA 2CZGA 4EG3A 4A8JB 2L0XA 4R83A 3ESRA 1LDMA 2LKDA 4Q37A 4HUJA 4OJTA 4YUZA 3VNUA 4WCFB 1Y6RA 3GBVA 4NZ9A 3ZDAA 3SM9A 2VDPB 4QTZA 2I4IA 3Q11A 4F3KA 1P0CA 2ZT8A 2I6XA 4I14A 2B5WA 3HKBB 2R8RA 4LG1A 3FFAA 7REQA 2JLUA 1JHQA 1C30A 4RPLA 4BE7B 5LZ2A 3I2YX 4C0KA 5ALRA 5K09A 4CM8B 4J7AA 2JFNA 3LL4A 3SDSA 2CXSA 1E94E 1P2UA 5ALLA 2P75A 1Z17A 2DQZA 4QTUB 3U40A 3VPHA 2OGWA 3AR9A 1JR3A 3MD9A 3L41A 1JEOA 1LI4A 1PJBA 1QH8B 1WMDA 4RO0A 1PJ2A 4F4CA 4Z4IA 2ZSUA 2QTLA 5KTNA 2IC5A 3N8GA 2F3QA 2YWBA 1XUOA 2QY6A 2W6ID 4PX5A 4Z99A 2PXCA 1TA0A 1D0SA 3OQHA 4A26A 3B6ZA 5AVUA 4I4LA 4PVCA 3QKRA 5GOZA 1XMPA 2DFNA 1QH8A 2BF4A 1EM8B 3JATA 1XE3A 2C84A 3D0KA 4OL0A 3LCCA 4JLAA 3K0FA 3FGOA 2ODBA 3CW9A 4OA5A 4PPGA 2FH5B 2O3RA 4M7RA 1YKSA 1RJFA 1SPBS 2C97A 2Y1GA 3T4XA 2CXUA 3O8OA 5BURA 3ZDDA 1GZHB 1NMZA 1OX4A 2QE7A 3AIKA 5LOVA 2ZZKA 1CDDA 4GPTA 4D4IA 4EJ2A 1BC5A 4G4IA 421PA 3S8YA 1URPA 3GWZA 1KIMA 3E22B 4X9XA 5HYVA 1ZXXA 3GV0A 3JX9A 3HN7A 5BW5A 6GPBA 1GAQA 2CMGA 1I7SB 1MTZA 1QB7A 1SWWA 3QVMA 2VT6A 4OHKA 5TR9A 1C3JA 2W2LD 3JQ7B 2PS1A 3KZXA 1U5BA 1QK3A 3AEKA 3M82A 4HDCA 4Q6WA 2H2DA 5DX0A 5DOVA 5EJ9A 4NH4A 4A0SA 4B3FX 2V0NA 3COPA 4F3NA 3W5IA 1G3MA 5JXIA 1JV2B 1YI1A 4IZ6A 1OTYA 3W1EA 5IJWA 4HI0E 5MN5A 1ZBQA 4JI2B 2HCTA 3BQ9A 3DO8A 4XIIA 3UA4A 3C8DA 3GZNB 4GZ6A 4JBWA 1R8QA 3W9UA 4AJLA 3SBEA 1XGKA 3QQ5A 1DARA 1SY7A 4QYIA 1G20A 3SX4A 4O63O 4J91A 4AS2A 4YXWD 2IHTA 1DG3A 1OT5A 3CPSA 5JNVA 1QHEA 2I66A 4C2UA 2HA3A 2YW9A 4KL8S 1IJBA 1NJ5A 1UZAA 1QONA 2ZTMA 3IUEA 4IS3A 3U49A 5K0SA 3L0OA 3IPCA 4BVBA 1JAXA 3FYSA 1DBQA 3K92A 4PQGA 1MX3A 1XYVA 2A0KA 3G0BA 3KSDO 1W30A 4UJ3A 3TF5A 5FL7D 3S8EA 3H04A 1XDUA 4IOLA 1PJ3A 5BPHA 3WZMA 4KQIA 1VJRA 4D3XA 5CFQA 3V2HA 2CD7A 2Y76A 2V0GA 1V6SA 1B6TA 1E5XA 3HV0A 2CUZA 3D1LA 1EVZA 1M6HA 1RRPA 4OHYA 3LH5A 3KQWA 4B74A 1PUXA 3FE2A 2AZDA 2J33A 4FIDA 3ZOKA 1E1LA 1GA4A 1X7YA 1UDXA 3AKCA 2O5RA 2O8DB 1YFKA 4RW0A 4ZEOA 2Z2JA 3K1YA 2J85A 3ZY6A 2OFFA 4FDMA 3ESYA 4AS1A 1O5TA 3R9WA 5I8PA 1GPNA 4FEGA 4KQ9A 2JLWA 2DQSA 1E1YA 1LKZA 4CKEA 4M0UA 1PHPA 2DUNA 1JR4A 2F3TA 2OTCA 3QXGA 4FE3A 1THZA 2DH5A 1L8OA 1VFNA 3EGWA 3K72B 3TINA 3H75A 5DN6A 3EBPA 3P2EA 3P0IA 3ZGOA 4IZOA 3OF3A 4K9LA 1K7CA 1LLFA 2X1MA 3C4JA 4BBZA 4DCGA 1PTKA 2CWDA 2JI6A 5EGNA 4XUGB 5B55A 5K4GA 5KTSA 1Z4LA 3G7SA 1RC8A 1Y7IA 3D54D 2EDCA 2ZU0C 3C7CB 1U7WA 3AM1A 4AJKA 2GCEA 2PTHA 5JSHA 1QIHA 3GN1A 4FM9A 2A3NA 3CPJB 3GRYA 4XIGS 5KOJB 5ENDA 2AG5A 7GPBA 1DAOA 1G8PA 1R88A 1YDFA 3LUKA 4DBZA 4LWPA 3V4OA 2AJDA 5TS2A 2PN1A 1SUSA 2B1RA 3FNHA 3KOUA 5DK6A 4D0RA 3WGZA 3H8SA 2A78A 3NHMA 4PCAA 5G4LA 4RQBA 3SJCA 3BX1A 3FYTA 3ZQUA 2ZE5A 1G7RA 1NIPA 4DADA 2OXEA 4N12A 4ECEA 2JNWA 4BO3A 2HADA 5ALXA 2O7QA 4URWR 2UYGA 4P4UA 2AX3A 1CDOA 5EHNA 3SC2B 1W8IA 2J6IA 1REQB 1OXMA 2ZK7A 4UNNA 1PUJA 1OU0A 1W2WB 3Q8WA 4RKQA 3ZI4A 4C5BA 4AKHA 1HMYA 4BFXA 4MA0A 4MQ5A 4PRZA 5CU7A 1UFRA 1DJPA 3ER6A 2RHOA 1SRRA 3GEEA 5AR1A 3GQBB 2H1HA 3S2YA 1Z28A 5DEOA 2QM3A 3OE4A 4GIBA 1GRQA 3H2YA 2HSGA 3I37X 4PIVA 4NVRA 4M22A 1KI8A 4ZI7F 1JEEA 4RUKA 2HQBA 2ZYHA 3HV2A 1GGMA 1T6YA 4GPAA 4U2FA 5LNK6 3OIGA 3W6ZA 3ENKA 1EGHA 2I3GA 4PX3A 4N5LA 1M54A 4PZEA 3LL7A 5AJYA 4B0PA 1L3CA 1C0EA 1O9HA 2QTMA 1XVLA 4YT8A 1VLVA 2WD9A 4NMMA 4LSMA 3UQYS 1JG1A 3DVQX 1FX1A 1HT2E 1KEVA 3M6IA 4L51A 4P4SB 3SZUA 3WK8A 3COJA 3A06A 3PWZA 3VX4A 4MWOA 5FUYA 2EP8A 4H4EA 3FLEA 2WKSA 2OO7A 2HZBA 4TXHA 4L0MA 3V42A 5KNCD 2IPXA 1SWVA 4OU5A 1ISHA 2CUKA 2IYZA 2P2LA 2X0RA 3PJDA 3KYDB 4NHEA 4PO3X 4OBBA 3RSFA 3O9ZA 2AFIE 2FWBA 2J45A 3T4UA 5I9TA 1H6CA 3LF2A 2V8OA 2FZKA 1XMOB 1N36B 3FD8A 1JL3A 3PXBA 2R751 4KO1S 3DLPX 4EGAA 4F84A 4MGYR 4Z6KA 3K3PA 1YR7A 2O05A 3GMDA 3URKA 3VGPA 3PHBE 3R9XA 1P19A 4RF2A 3HM9A 3PGMA 3VA7A 3AUJB 3PXAA 4LECA 1KP9A 4XD2A 5DRYA 4EECA 1Q16A 1ZWLA 1OCEA 1B4DA 1WP9A 2D1FA 1TC1A 2GK6A 2I34A 3AEZA 3CLHA 4WVFA 4D8VA 4D82A 2CJPA 4AMBA 3I62A 3RJTA 2QX7A 1E0KA 1VMEA 3R9XB 4X71A 4YRLA 1CJKC 2ZRQA 3CKMA 3JVUA 4Q4CA 2FQQA 2FWJA 1OWLA 2A0UA 3HM2A 2ASVA 3QELA 4GHWA 4JQOA 4ZVRA 4F2GA 5CVTA 2FF5A 3AHFA 3L8DA 1NW3A 3ICVA 4ZZ3A 3O3NB 5EJIA 3K9WA 4AQDA 4R2XA 3W2GA 1XRSB 1R6UA 3F98A 4X93A 4HEQA 4NS4A 3OIUA 3DF7A 4CTJA 5EMJA 3VKHA 2I67A 1AXGA 2R1TA 1LTKA 2NSYA 4S2UA 4TZTA 5BNFA 3QTLA 1XYGA 4JJ4A 4IICA 1IIBA 3INNA 1PE0A 2UUAB 5T3UA 4C4RA 2P35A 5CNJA 5AMXA 3OI7A 3ADKA 5D84A 4QTXA 2WE7A 2WSSD 3HP1A 3AF4A 2NPFA 1DRUA 4LJ5A 3FWKA 3T52A 3OUZA 4EEXA 4DGSA 2O3SA 5JJCA 2PZKA 4KIJA 3A3PA 3WBKA 3MINA 1K8ZB 2BGMA 4PZ0A 1EI9A 1F60A 3U7GA 3FMVA 1EKXA 4U00A 1XEXB 4UE6A 4BNKA 5A62A 1GU7A 1KVSA 1M1YA 4F97A 1IG0A 4JP8A 2F1JA 1D6MA 2Y1KA 4UHBA 3QSYA 2DR2A 4XIYA 2JAHA 3EH1A 5DBHX 4PBTA 4A03A 1XROA 2VTKA 3H5RA 4K6MA 4DLWA 4HVLA 1NF3A 3Q7SA 1C50A 4U2GA 1UINA 1E79D 5TV2A 1E6MA 1UQTA 3LP8A 1D0IA 2VP2A 3N2EA 4J43A 3GEMA 3OLQA 4JHLA 5CUQA 5EJ2A 3WGOA 5K6AA 5K3EA 3DMTA 3OCZA 5KVAA 2Z2ZA 2Z4SA 4LISA 4BWVA 2VTBA 1NA5A 3RQIA 4NC9A 1SQ5A 1H8EA 3G0OA 4OY3A 1OFTA 2YMPA 4LYJA 4XVQA 5CITA 3C5CA 4C9BA 4POOA 1RJ9A 2R8BA 1Y3FE 1QRTA 1UWVA 4NCXA 4M9QA 4TZ6A 4ALIA 3GO4A 2RGDA 3D7KA 3IELA 3JASB 5E3IA 2XT6A 2JJ2D 2BHSA 3NHJA 4X8HA 3U1TA 1A9TA 5DNWA 3DNMA 3LJKA 2YBDA 3V9AA 2ZUFA 4ARZA 4C0BA 5BQFA 2HK6A 3GNTA 1D4OA 2J5KA 3ZGVA 4YLGA 1SK9A 4OVKA 2ZETA 4MRAA 2XCSB 1J0CA 1EBUA 2RIRA 4LVCA 4CIDA 4DLZA 3QLEA 2RGEA 3LLCA 3HCCA 3T3GA 1CUUA 3VPCA 4IHJA 2FSSA 2P6RA 1QAMA 5AM5A 4AZ0B 2DP4E 4MIEA 3AY0A 3W8DA 3AIIA 1ZD9A 5JW6A 3U16A 2PIDA 3ER9A 3AETA 2OQ2A 2G1KA 2ORED 4RC9A 2ZUWA 4JK3A 3CZMA 4B3BA 5E4YA 2X1VA 4EELA 2GHQA 2AD1A 2FCRA 2BFNA 2ZVPX 4M36A 2DOKA 5DVZA 2ZUTA 2L17A 3RO7A 3A9RA 4QAJA 4FGKA 5B30A 3WGTA 3GEBA 4J4HA 3TVDA 4DBLE 5EJGA 5HBGA 1X7ZA 1QTIA 4PWYA 5IF3A 2FF7A 2OLEA 4UNSA 3AFNA 4BVGA 1P80A 1B7GO 1VE9A 5TMEA 3FFWA 2YVQA 4X45A 2W4QA 4JIGA 4FFRA 4NV3A 4DJEC 3I3SR 1RCUA 4HMQA 4IIFA 4YCJA 1TGYA 2VPXA 3A70A 3GRVA 3L6CA 4FFLA 2OMEA 2G80A 3JYNA 3LCMA 1C3OA 2Z8XA 1NF2A 2MU1A 3HJTA 1O03A 1NFFA 2JJMA 3HCFA 3IOYA 1UDRA 2YVLA 4WZBA 2AXEA 1ZVQA 3GZTB 1SURA 4ND1A 1MO2A 4BLRA 2XHEA 4ENVA 3GXOA 1EBFA 1ZM2A 2GQ0A 3O91A 2H8GA 3A4MA 1R0YA 1V5FA 2CF6A 2EFDB 1ZISA 3G9QA 4G1CA 3GVCA 4Q9HA 3EZ7A 1GYPA 4U7JA 3STUA 3GYGA 1IFXA 4R2WA 5CVDA 3NPAA 4DA0A 2C7GA 1W5FA 2PUWA 2VUIB 2YZ7A 2WHPA 4OIFA 3WSTA 2PZEA 1FFSA 3UEOA 3AUKA 2W6QA 1E9EA 3OEHD 4D4HA 3P2KA 1OI4A 1FBNA 1BMDA 3GNLA 1W1UA 4OF4A 3SXJA 3KUDA 3CU5A 1M1NA 2ZAGA 4NYIR 4RZIA 3LUBA 3DAYA 3M83A 4YO7A 4TT3A 4Q18A 3RRMA 3TK1A 5HRUA 4EPVA 1RYBA 4BLOA 5BVHA 1I4OA 1P8JA 2Q8PA 1Z16A 3AHGA 5FOSA 3ZWVA 5KMGA 1W35A 4KKXB 4G2NA 4TN1A 2G71A 3FJ1A 3WMWA 3VVMA 3WGGA 2HK9A 3D4BA 1TO2E 5DWQA 3K4QA 1UAGA 2COEA 3ITKA 5EXTA 5B58C 3QX7A 5DW0A 3FWHA 2OAP1 3PDWA 4ZICA 1YBHA 4ZYUA 1GKIA 4L50A 1IQRA 1NHWA 3IOBA 3ES9A 4Y9RA 4U7WA 1M8GA 2BL4A 3G2LA 1H9AA 4RIHA 3BORA 4RZSA