3DW3X

Proteinase k by classical hanging drop method before high x ray dose on esrf id 14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw3X00
1SUCA 5ARBA 1ST2A 1Y3FE 4CG0A 5SICE 1AQNA 3PTLA 1CNMA 3A3PA 1Y33E 1SUEA 1V5IA 1P7WA 1WMDA 1OYOA 3BGOS 3DE7X 3DDZX 3DVSX 3LPCA 1P8JA 3F7OA 4OMCA 2PMWB 3EE6A 1C9MA 3SQOA 1SIOA 1NLUA 2PRKA 2Z30A 1Y4DE 2QTWB 1TECE 4NE7A 2Z58A 3DE3X 5K7SA 3A3NA 5FAXA 1KE1A 3VTAA 1T1EA 1Y9ZA 2Z57A 1ZVKA 3DE6X 3H42B 3GT3A 4HX2A 2G4VA 4MZDA 2HPZA 1GTG1 4WOCA 3WIVA 1SIBE 1SH7A 2PKCA 1KDZA 1YJCA 1SUBA 3EDYA 4K8RB 1S01A 1SN7A 4NE9A 1VSBA 3I30X 4H6VA 3LXUX 5ARCA 4Z2AA 2PYZA 4C3VA 1SVNA 1SBTA 1T1GA 3DE1X 3L1KA 5AVKA 1AVTA 1XF1A 1SCNE 2SECE 2ZWOA 3CNQS 1SIUA 2HD4A 4I0WB 3WQBA 3DW1X 1BH6A 3WHIA 4B5LA 2ZWPA 4WOBA 1AK9A 1GTJ1 1V6CA 1Y4AE 1Y3DE 2P4EA 1AV7A 1SUPA 5FBZA 2ST1A 5FFNA 2IY9A 3GT4A 1A2QA 3GCWA 4H6XA 3I34X 1GNVA 4LVNA 1S02A 2W2NA 2WWTA 3DWEX 3GCXA 4KG7A 1Y34E 2ID4A 1SPBS 3I2YX 2GKOA 3CO0S 3Q40A 1SCJA 1Q5PA 3DE5X 4FONA 4GI3A 2X8JA 1R6VA 3ZXYA 3DE4X 4ZARA 4HVLA 3TI7A 4KPGA 1WSDA 2PWAA 3SICE 1Y3CE 2SICE 1CSEE 3LPAA 1T1IA 5I9SA 1TM4E 2TECE 3HJRA 5ARDA 4M1ZA 1KE2A 1SCAA 5JXJA 2PQ2A 1SBIA 1EA7A 1C9JA 1BFKA 1GT91 5B1DA 1UBNA 1YJAA 2SBTA 1ST3A 3T41A 1PEKE 1SBNE 3PRKE 1KDYA 2Z56A 3F49S 3ZXXA 5B1EA 2W2OA 3QMPA 3VSBA 4J94A 2E1PA 2WUWE 1IAVA 1TM7E 1P7VA 1PTKA 2B6NA 3OSZA 1GCIA 1C9NA 1GA1A 3D43A 3WIUA 5JXHA 2Z2XA 1ZVJA 3BPSA 1KDVA 1BFUA 2Z2ZA 3BX1A 3LPDA 1JEAA 1GA6A 3AJ9A 3DE0X 3UNXA 1HT3A 3VHQA 3VV3A 2W2QA 4C3UA 5JXGA 2XRMA 2PWBA 3AFGA 1NDUA 1PFGA 1TM3E 1Y3BE 4YN3A 1BE8A 1SUAA 1TO2E 4CFYA 2ZRQA 4DZTA 1BE6A 1TMGE 4BWGA 1PJ8A 2X8JB 1R64A 3Q5GA 3TI9A 3I37X 3QTLA 4H6WA 3P5BA 1IC6A 1SCBA 1TO1E 1SCDA 3DVQX 4NMXB 4RYDA 3D9QX 3DE2X 1OT5A 1AF4A 1THMA 1YJBA 2W2PA 2XTJA 5AQEA 4JP8A 1AU9A 1SBHA 4OV6B 1DBIA 2SNIE 2IXTA 1MPTA 1S2NA 1Y48E 1R0RE 1SUDA 2W2MA 3DW3X 3F7MA 1EGQA 2V8BA 4OMDA 1YU6A 1TK2A 2WV7A 5CW1A 4DWWA 4ZOQI 3DYBA 1DUIA 3VV2A 1Y1KE 3AJ8A 3QFHA 1LW6E 4LVOA 2DUJA 1WMFA 4CFZA 1GA4A 2ID8A 3VYVA 2WUVA 3EIFA 1WVMA 2DQKA 4AKTA 4DJ5X 1TM5E 1NDQA 2Z2YA 1SBCA 3TECE 4AKSA 5AVJA 3DVRX 1BJRE 1TM1E 3A3OA 1OYVA 1GTL1 1SELA 1AH2A 1GNSA 1MEEA 4KB5A 5JMOA 2DP4E 5AMXA 1WMEA 5JXIA 1C3LA
chains in the Genus database with same CATH superfamily
1R88A 2ZB7A 1X2BA 1R4AA 2CMGA 4M60A 3TQSA 2AHOA 2QSJA 4WN9A 1RPJA 5HQ3A 1RJEA 1XNHA 2RGAA 5JSUA 3OE5A 4R83A 1VB5A 3RGGA 4Z4FA 3SX2A 3BKWA 3L93A 3CBQA 4ZQFA 3ZVRA 1RWVA 3LUHA 1PZMA 1ZCBA 4M49A 4YGXB 3QHQA 1BWPA 2VJAA 2VK1A 3SQXA 4NDAA 3FHJA 3ZYZA 2D74A 4HX2A 1OXSC 1G4AE 3TUIC 4JBGA 5I8ZA 2GN8A 3PR1A 4BNJA 4OGKA 5JE8A 1JDPA 1YDGA 2J1LA 1EESA 2VCEA 4P34A 1KZ1A 2LUOA 3VOBA 1IOVA 1LQTA 2W8ZA 1T26A 2X6TA 3FR8A 4QYXA 5COQA 3WLAA 5A0VA 2PZAA 1J21A 5ITVA 4PYLA 1Z0DA 4OHYA 2R0QC 4W7SA 3KV1A 5TDHA 1L6IA 2QGZA 3BK7A 4B3MB 3G6WA 1E7RA 4R1PA 1DKRA 1T2VA 5JJKA 2DTDA 5HF6A 2YYZA 1YCHA 2B30A 2ZSAA 3IHTA 4A73A 4B35A 1WXXA 4OM7A 3ZZMA 2H3HA 4IUCS 4ZGWA 3ZJ4A 5DASA 2O8BB 3MBKA 2QHXA 2YOHA 1ORVA 2J9RA 5IS2A 2UXBB 3AB3A 3H8VA 3ZIAA 3QE2A 2JIBA 4GP6A 1IZ7A 1QF7A 4XARA 4XWOA 4CCWA 4EJ2A 3UHOA 4QATA 3V8QA 3K35A 1IZ0A 1NXSA 4O5OA 5JXJA 1E2UA 3DLCA 3HLYA 1KU0A 4DG5A 1A4RA 2OFXA 3N70A 1VCIA 4Q37A 1NJ6A 2XQVA 1IY0A 1YJAA 3O4FA 3O84A 4PLGA 3ZE8A 3ZHTA 1MORA 3R1IA 4KWTA 2FQQA 2VJQA 4MR9A 1CYEA 1IJBA 3H11A 3LPNA 4XAQA 4P4UA 1JKJB 4UM5A 3FTFA 4Y8VA 3RUHA 1E63A 2GAOA 4OJKA 2JLBA 3A4TA 2BEUB 1ZM3A 2HH9A 3OZTA 5AR1A 2JLVA 1TYCA 2PZGA 1L5WA 3DMYA 4TKMA 5LQRA 1NQ5A 2QQ5A 2ZR9A 4A2CA 2QTNA 5KSPA 3DEIA 2FGKA 3DYVA 5BN1A 3NYWA 1VL2A 2PFSA 1TMGE 3D1JA 1WY7A 1R64A 3AYXB 4OHMA 4B2YA 4C5BA 5DYWA 4DR4B 5FWDA 5BW5A 1Y1RA 4D0LB 4CTKA 1AGRA 1Q95A 5KU1A 3DVQX 3ESDA 4PIPA 1JVSA 1JZTA 3W3AA 4NMXB 3VR6D 4EK9A 3Q88A 1JKMA 3IUJA 4GMGA 4QAJA 3WBKA 1Q3TA 1PW5A 2J07A 3PK0A 3UJHA 1L8LA 2C2BA 1M8JA 3L0IB 1V16B 3MM4A 1SM4A 4HJXA 2OK7A 1V6SA 5THXA 5JNTA 4DWWA 3JQAB 1JWLA 2P1DA 1DRVA 1CUUA 3JVUA 5EP1A 2ETXA 1LW6E 4BO1A 2DUJA 3K09A 4A8JA 4I55A 4NFSA 3SM3A 4DJ5X 4KLNA 2GTIA 4TS3A 3NZEA 1DKUA 3FUCA 3O5AA 2AX4A 4IIYA 3TAUA 1O6CA 4RVHA 4A27A 2H18A 1R6BX 3CRZA 4UDXX 5KTOA 1K75A 5CFLA 2BP7B 1PJZA 1KFKB 2VHJA 1Q0QA 4TLLB 4F97A 4MR8A 2EZTA 4MEBA 3G1UA 3ZZUA 1EFVA 3S1AA 4D5EA 4QWWA 3CEHA 2JJQA 2B61A 3H18A 1AQIA 2NSLA 3WQQA 1Y8RB 4E5MA 2R1VA 5HZMA 3LQ2A 4KXMA 4YCCA 1VRVA 4EHKA 3SHFA 2L2QA 1SWWA 4N6GA 5GIOE 1U4SA 3DFFA 4BAGA 2CXUA 3SPXA 3N7AA 3A3NA 1ZDMA 3UJDA 5CGZA 2MYTA 2C2XA 2BRUA 3I1JA 2EBWA 4I9NA 4JC5A 5DVZA 2ACKA 2CF6A 4X84A 1NP3A 2FSGA 3V7FA 4M0FA 1QLHA 5K0ZA 4IJVA 2WLSA 1E3SA 5AT1A 3SK0A 2NM0A 3BGSA 2DUNA 1ACJA 1Y7LA 5DEOA 1M5TA 1FMTA 2O0MA 4Y2XA 3PB3A 3N05A 2AK3A 4EW1A 5H8WA 4RTPA 1RBZA 4OQEA 5JNUA 1W2HA 1QCYA 2R1TA 3C1UA 3F8SA 4R4JA 3EAQA 4R5MA 5ALHA 1M6HA 1R9GA 2WF9A 5JPCA 1DNPA 1GQSA 2ZSEA 1HDCA 1DTEA 4R68A 2A0WA 4WVLA 2QTHA 4EKYA 4JJKA 5JD6A 4ROTA 3TIVA 1R3DA 4P5EA 1IDOA 4IGIA 2OV4A 4S1WA 2GEKA 1WCIA 3AFOA 1VCOA 2B34A 2JAWA 3KXDA 5JPIA 3DJYA 5AW3A 1KEWA 1XTJA 2WP8J 1I33A 2OPBA 3BGIA 1NKVA 3JY6A 3G2LA 4GECA 4P93A 4X20B 3SLGA 3EIHA 1QGOA 2NO7A 4QXPA 1PS9A 4KPYA 1C7QA 3WO1A 3SFVA 1FOEB 1CZRA 5MFZA 5FPQA 1JAZA 1VKNA 3QMWA 1UOQA 5I7EA 4UHKA 1F0YA 2VF4X 3H84A 2Y99A 5B1EA 1H9CA 3WWDA 1LWNA 1XLVA 2GPWA 4YREA 4FR0A 5AJTA 4TN5A 4WASA 3WGKA 2HI0A 5LP6A 5F12A 3ADPA 1EX9A 4F45A 1SVLA 1IUPA 2Q3CA 9ATCA 3NGLA 2V6GA 3QXHA 2OGWA 5F4ZA 1WP4A 4ZYYA 3SYNA 4PRLA 1OZFA 4X1IA 4X8MA 1Q0TA 4ENQA 2X19A 2VF5X 1P80A 5TT0A 2APJA 2NU9B 3QX7A 3ZWAA 1HA3A 5CDTA 5K4HA 2HQRA 1NW5A 1Z39A 1QV6A 4OI1A 2J67A 5ER9A 1HE5A 3CWZA 3I39X 2QRPA 1SCDA 4MWDA 4HUJA 5H9VA 5AVUA 2JGMA 2C1EA 3AUAA 5AVSA 1O9BA 3JVIA 4D79A 2NUPB 5FJIA 3ZGNA 3DR5A 1GKLA 5D1HA 2O7NA 3I4CA 2Q28A 2PGXA 4CLRA 3DMDA 4JP5A 2VF7A 1DXHA 3B6KA 1USGA 4L50A 2BONA 2V7BA 3WKAA 4EX6A 3T1OA 2PBZA 2YX1A 1CRLA 1X7DA 1JHOA 1G41A 1TEHA 2CNBA 1GQOA 3H2JA 2I4IA 5CFMA 3K0KA 2W6IA 3DV0A 3E15A 2H16A 1VJTA 4KHZA 4U2EA 3VTKA 4A1OA 1AZLA 2JFXA 2ZI3A 3QVWA 3T5CA 5ITZA 5JQGB 2Q0HA 4TWRA 7GPBA 4KFRA 4MIKA 1WQ3A 3AF4A 3IQEA 3E27A 1WXGA 3DDZX 3BGDA 2PBRA 4LC0A 1AS0A 3HU2A 4Y7DA 2PUEA 3I8XA 4OQ4A 3MQ2A 2MYPA 2WMOB 3UV7A 1G55A 3T38A 4K1XA 3HYLA 3K5IA 1BMDA 2FWIA 4YXFA 4H60A 4UNNA 3A4YA 1G2IA 2VDVE 1M3SA 2FRVA 4WCFC 2QNIA 3FCCA 4Q3AA 3DEYX 2X6RA 2ZJ8A 3OPYA 4C3VA 2P9HA 4IHJB 3DL2A 4K9RA 1M2KA 2GNPA 3MSCA 2O0KA 1EPUA 4IF6A 4DLAA 5LJIA 3IMGA 3IAS1 5LZ8A 4XIYA 1YZYA 2FUEA 5HUJA 2PA3A 1G5PA 3GVIA 5JALA 1PWEA 2A92A 1P6QA 4ZC8A 1ISMA 2FEAA 3V1NA 4FCVA 4HP8A 1XCGB 4V39A 1Y8ZA 1Z6PA 2JD2A 3UJ9A 2O59A 3NQ41 3CVOA 1QF6A 4LDAA 3AT1A 1SUSA 5AWFC 1YQGA 2FF7A 3R3SA 2ZT5A 5KMGB 4BLVA 1K6XA 1P9WA 2GN9A 2JJMA 2CXNA 3WWYA 2XCIA 2DR0A 4XIIA 4X63A 3TZQA 4FB5A 2R6GA 1UMDA 3D02A 5JARA 3I2FA 4R9UC 2OL4A 2P3LA 5J63A 4WFKA 1VXRA 2XKBA 3HWSA 2IUSA 4TQAA 5BQOA 3W6NA 2DJIA 1GEEA 1Q7BA 2DU8A 5BNFA 3SXPA 3UT0A 4WXPA 4V0LA 1W59A 3T3MB 5CT9A 3UXHA 2CVZA 3B12A 3RSHA 4MB0A 1J23A 1E4YA 2XXAA 4LNHA 3O6VA 2XA9A 1CCWA 3PEUA 4TVOA 2H7CA 5JXHA 4D4GA 1X8KA 1QDLB 5DHSA 3QXGA 4XWWA 3EZ2A 4QEKA 4DUGA 1I10A 2Q4BA 4KQXA 1JJ7A 4X6XA 4RDHA 3D6JA 3PHBE 4B4OA 1RRVA 1E8MA 3MAGA 5HZGA 1E64A 1H2HA 5HQTA 4A8JB 4D9FA 4YV2A 1X8LA 2E89A 2DBYA 2FX3A 2OBMA 4HRXA 4HH1A 5LQJA 1LV8A 1U8EA 3FUUA 3JASB 2OESA 2YYAA 4XX1A 1UBGA 2F00A 1AF4A 1TNDA 1W0KD 2C0PA 2YWCA 4HVTA 1C1XB 1EBBA 4O0LA 4W1QA 5DM4A 3QENA 1E1MA 1ZA2A 1W94A 4IM7A 1SUDA 3JRXA 3T7SA 3NNSA 4EGAA 4YRPA 4M2LA 1X1TA 2B5VA 1M34A 2UVPB 2EP8A 3E23A 1VHLA 4GLFA 4IRXA 1UM9B 4WK4B 1RKQA 4RGBA 1A82A 4EPTA 3DLAA 1M1YA 3ISJA 1JPVA 3GQBB 3G1WA 4OH7A 4X85A 3RBVA 3A6LA 4TKUB 1NYQA 4GOMD 4MRMB 3U1VA 2GNOA 1Z7GA 4NSNA 3WFIA 1ZH8A 1JTEA 5L40A 1H2EA 1IWPB 1J8QA 2HQOA 5BQPA 3ZCUA 4FMDB 4OAPA 3T8YA 1RAEA 1Y6RA 1Z68A 2Q7XA 1IJEA 3NALA 3R3WA 1AUOA 5IKEA 5K0CA 3N8KA 1J00A 2XEDA 1F3LA 1W96A 1X1RA 4I4LA 3SZRA 1XDGA 2D8MA 2QAGA 1X7HA 2EP7A 1DXQA 3DZHA 4PE5B 5ECYA 2VAVA 4BQEA 1SB9A 2RGGA 3UMGA 2RI6A 5AM1A 4HX9A 3V5NA 3JR3A 2AN1A 4YRTA 4BZPA 2XMRA 3GT3A 3EFOA 3DOJA 5K3SA 2CD9A 2FSFA 3FAKA 4FI3C 3TCKA 5G0TA 4XGNA 3DAHA 2ZUDA 4KDCA 1EBFA 4LOLA 2QNRA 5E9AA 2GT1A 3JQ6A 1Q0PA 1KH3A 1K8QA 5JCXA 3DW1X 4X20A 2DBVO 4B34A 3IR7A 4ZAVA 2NUTA 4NBWA 4BNYA 2PN1A 2POCA 4IR7A 4PZ9A 5A71A 1YS9A 1GZ3A 2AG6A 5CM2Z 4PYNA 3H2IA 3ZI4A 1RMYA 1OXUA 2HA2A 4DT1B 3M9XA 4QU5A 2YWDA 2ZKIA 2YDXA 5FAKA 4P84A 3B7GA 3UAVA 5LP6B 5IJ0A 2AXQA 5B7QA 3HDVA 6CHYA 1IPEA 3KAQA 4QM6A 1Q92A 3A6DA 5ALZA 2XY4A 2ZS8A 3HBAA 3LV8A 3TTVA 5JLAA 3F2IA 3QJ5A 2O8CB 5C5IA 1D07A 1NLMA 3CPSA 4WE3A 2RCNA 2BEJA 4FLFA 2YBEA 3EA0A 3T41A 3T7DA 4DCVA 1X7XA 4R51A 2RH9B 2O06A 3BJIC 3LX8A 3PENA 1E0SA 1EK6A 1Z4OA 1L5HA 3DLHA 5H81A 1NF2A 4YJDA 4K2AA 1KP3A 2JFVA 4HMQA 1GPNA 5KVAA 5JYEA 3GWGA 5B1HA 2HSDA 1M2VB 2R4QA 3LZDA 4CIVA 4PYKA 3WLQA 1OT3A 3EFEA 1XRMA 2WSSD 2Z4RA 1XLTC 4LFCB 1NV9A 3IKMB 1WTCA 2PMKA 4HWTA 1AHHA 3C3CA 4NABA 4YCBA 2YL2A 1DIAA 2FEPA 5FHQA 4JB3A 1TO2E 2GJ4A 4PPYA 4TMTA 3OTIA 3PWZA 4JR2A 4N47A 3CUKA 4G0WA 2ZGVA 3ZHCA 3NGXA 1PZFA 2YZNA 4Q3OA 2ZPAA 1YOVB 1A1SA 2GA8A 3AJRA 2QUHA 3KT6A 2RHHA 2YWXA 5HXAA 3C6QA 3AP1A 3OU2A 2AK2A 4UD6A 2M6LA 3ZW7A 3PFIA 4AKIA 3FFAA 4E15A 1FFDA 1C7EA 3FCSB 3DTNA 4M21A 2QLLA 3FNGA 4MNTA 4PTZA 4PYRA 3KSZO 1M6VB 3GJTA 5EHNA 2ONJA 1ZXXA 1FJXA 3LX5A 1O4VA 3DYBA 4WDRA 1RQNA 2JLQA 3V4LA 1VGVA 1MX9A 2UZ1A 2BAGA 4TT3A 1OBFO 2CHQA 1EFLA 1LRJA 4JI1B 1XK6A 4AJNA 2WVJA 2LE0A 1KL7A 2GBPA 4L4UA 4NMLA 1E3QA 4MICA 3UWSA 2TMYA 3GLFA 5L51A 2IXEA 2XUJA 4GLBA 3UBTA 1Z0UA 4LISA 4HRAA 2I6UA 3BQNB 3MFYA 2AWNA 4MDEA 2VUTA 3QM1A 4D4IA 2EP5A 1QYWA 1SOUA 2DHDA 4FZJA 2CDBA 3ZJUA 1E9RA 3RAJA 1V5WA 2ISSD 5DHUA 3WMXA 1USUA 1P7WA 2E4ZA 4R6WA 4GU5A 1QHXA 4P31A 4YQFA 2C4TA 1WSWA 4OSOA 2D7CA 3RTAA 1YS4A 3E5RA 3WK9A 1C0KA 4KAAA 1ODSA 4TV9B 1IXRC 3DE3X 1P9RA 1GT6A 4FFPA 5C8DA 3G5TA 1FDUA 2QM0A 4HFJA 4CKWA 1FS4A 1GV0A 2O7VA 2VHCA 2VF8A 4UDYX 3E2PA 3MJEA 1WZ2A 5EJ4A 3T3DA 1JR3A 1O6GA 3JWHA 3TFWA 2IEIA 2JGDA 1W93A 2NV6A 3DBRA 2PYDA 3NI2A 1IVYA 1SBTA 5HSGA 4HDAA 3QX3A 3INRA 4HS4A 3RANA 4RIHA 1TZ2A 4IIFA 2Y9MB 1OAKA 4L22A 2XRYA 1ILEA 2PFKA 1U0BB 4IINA 4B74A 3OLZA 1MB9A 3SOZA 4JBYA 1QNLA 1ZIYA 3O93A 3W06A 2YN2A 3B51X 4G56A 2IY7A 4PX3A 5EJFA 4NTZA 1CEYA 2QYOA 3JZFA 1ZUNA 4GOLD 1IN4A 2X0JA 3C3EA 3CLHA 3K7EA 1I80A 3H1PA 2ISQA 1WEKA 4Y0AA 3ORSA 2BTOA 3OTWA 2X2PA 2QY6A 2GVDC 4Q4HA 5GJWC 2QBYA 1UBOS 3QMMA 4G9BA 5BV8A 4XQ0A 4JKOA 5BYKA 1F6WA 3EIQA 3C97A 4ARAA 4MQFB 3AY3A 3K70B 1X9IA 2WQZA 2WZQA 2HHHB 4FLEA 5A0FA 1HQYE 2ZTLA 3DKKA 4D46A 4FN5A 1AK1A 2R62A 2W2OA 3P71T 3T5TA 3GIWA 4HG2A 3DOCA 3ONEA 4H9GA 5ALKA 2XUQA 5K8TA 1I2MA 1ODIA 2XADA 3KJQA 3NBAA 4U00A 4YO8A 4TWZA 3ZQ4A 1RW4A 2IOFK 1ZH0A 1PZGA 2WA2A 3L3BA 3VBEA 4BLUA 1P62B 4ZKEA 3WXMA 5KVSA 3ERCA 1E1NA 1NW4A 1ILWA 4CUJA 3RUCA 3QUBA 1NKTA 3I6QA 5FOSA 1NULA 3ZE7A 3VPBA 2M6SA 4MPRA 4I3HA 5KWJA 1TCCA 4MP3A 1O94D 2Q3JA 3B1JA 3B3QA 1EWKA 1G98A 4IWXA 1U3WA 2RGEA 4QTUB 5KYVA 1OF1A 1VG1A 2DSNA 2Y9PB 3TSOA 1I2BA 2YN0A 4Q3LA 3OT5A 4JX9A 3FOCA 2X1VA 2YMLA 3EC7A 2WWFA 3I9V6 2W2PA 3FPCA 2KQUA 4M46A 3K94A 3M1YA 1J1IA 4HKTA 4J0EA 2XUIA 2F1OA 1FMCA 3U40A 4HZUB 2I03A 3S29A 3K70C 4A7PA 1OTYA 1VP9A 3SBDA 2CXQA 4KQHA 1PK8A 3U7FB 2P0YA 3D3NA 1OGYA 3V1UA 2YOGA 1W5BA 2LW7A 4CIYA 1QAQA 5D5QA 5FOXA 3JQFA 3WNCA 5C8XA 3F96A 1V0JA 1BXKA 3HN2A 1FS6A 5CBPB 3AR9A 3M6MD 1XDWA 3LGXA 1ZLYA 2QTVB 3AVYA 3WL8A 3RFXA 1FXSA 1ULBA 4BFWA 2ZRCA 5EWJB 5P21A 4KUHA 4XVUA 5LQAA 4QUEA 5H68A 2AZDA 4PCUA 5FUWA 4B0PA 3CWQA 3T0GA 2P9CA 2V03A 4REMA 1MJGA 3AVVA 3G82C 2I2CA 2XUZA 4D0GA 1MQSA 5CXUA 4GPEA 4C2TA 1UT8A 1XFDA 3VUFA 2JGNA 2BR4A 1LQ2A 3VR3D 3T94A 1PNRA 5TARA 1NP6A 2JIPA 1K9VF 2EARA 3CUSA 5EA2A 3RJ9A 5IABA 5AKIA 2ENUA 3F6CA 5A7HA 5KEIA 3VO9A 4A6XA 2Q1UA 1VE9A 1VECA 2V54A 4CR7A 1QRTA 1VJRA 3ZX4A 2W48A 3UPTA 1VSBA 2B4TO 4MROA 3L1KA 4ESEA 2VDUE 4UBOA 4M86A 1JA0A 1UIMA 1X7WB 3WRYA 1XE3A 4EJ0A 4F71A 4YV7A 5BSEA 4R1LA 1OLXA 3WQBA 1UJBA 3LCJA 5GJCA 1UZMA 3EZ9A 1KTVA 1Z5WA 2AX3A 3HDQA 4V0KA 4KAXA 3UJNA 1TK3A 4KOEC 3Q9NA 3ISTA 3NBQA 3PNLA 4OLBA 2Q3BA 3V2GA 4BPRA 2IZZA 4OB8A 4UMDA 4Z9AA 2HT1A 1W2GA 4YJKA 1NBAA 4W5WA 5DN9A 1XHFA 1EUDB 2H7YA 2W0MA 3MZ0A 3T9BA 5JCPA 2GFQA 3CCFA 1BQ3A 1WOYA 2YCBA 1II0A 2IEBA 1AX9A 5DGHA 5F1OA 1ZN2A 2X1LA 5HGJA 4D1YA 3VR5H 1IBLB 5EQJB 4E51A 4ZANA 5I5EA 4KMRA 5AI6A 4JC4A 2P4QA 2PZJA 2Z5GA 4KI0A 1MHTA 4JEIA 4FW8A 1E0KA 3LKBA 1Z3IX 1ZO8A 2BHLA 3TQRA 5TIIA 5BSHA 2O3SA 2OXEA 1QFSA 2C2YA 4FOSA 2ZWAA 4D80A 3KQNA 3KXPA 1PEKE 1XPRA 3H3XA 1E7WA 1RWPA 3GJQA 1G8MA 3FCXA 1X38A 3IILA 4HCJA 3U7JA 3WX0A 1A7JA 5AVOA 2AUNA 2VQ3A 1C2YA 4DHWA 4G0NA 4XR4A 3U39A 3SDBA 3VC7A 4BBJA 1CS4C 1J24A 2HJVA 3PXUA 4HLCA 4RMNA 3DA8A 3UFBA 3NWPA 2ZM6B 4QD3A 2JHCA 1CQWA 2VPYA 4JAVC 4QYIA 1U8XX 3Q10A 4PR3A 4ZVKA 2C94A 1FNMA 1IM5A 1SXJA 4PNHA 2EW8A 1DC4A 5H3HA 3S5UA 2I5PO 4KNYA 3JTMA 1V1JA 1U8CB 3K2BA 4PF1A 1ONOA 4YB8A 4F5WA 3DAPA 2H4HA 5E1MA 3CLTC 4HAZA 1JE0A 1UZUA 3JAWB 2C59A 3E7FA 1TGVA 3P32A 4I4TF 4RENA 1PJ8A 1VRCA 3NEJA 3WLPA 3GUCA 3ZOKA 3SZLA 4LK3A 3V3KA 1W4RA 1H2ZA 4KACA 1LLCA 2R86A 3LWNA 1M72A 2XQJA 2P5UA 3KQVA 1FPMA 5KQRA 2PZKA 3S6JA 4ZICA 3AIIA 5LLDA 4MS1B 5FOUA 2IXTA 1U5BA 2H6EA 2O8EB 2JCBA 1KIAA 2J3IA 2WKQA 2WV7A 2C0QA 2ZSIA 1RD4A 3AF3A 2OBXA 3COVA 4JVOA 1S96A 4PX9A 5IW8A 5TQ2B 2OECA 3SQLA 1JMVA 4DA0A 2GZAA 5HMMA 5BNIA 1DARA 3KYDA 3IVXA 4UZFA 3FHLA 4CODB 2VS1A 3SJ7A 1ZUWA 3A7EA 2J48A 3QKIA 2I67A 5FL7A 4EPRA 3EXHA 1ZJWA 1LS1A 5MN6A 1V43A 5KTTA 2HXSA 4DXAA 1QORA 1SC1A 5A6SA 3CT6A 2ICAA 3E0XA 1HPLA 3A31A 2H0QA 3IXQA 4AWAA 1BN6A 1F06A 4KB5A 2PKRA 5T8KC 2NUAB 4F2PA 3DUWA 1HF3A 1QH8A 2AT1A 2IOYA 4G9EA 5IAJA 4HUTA 1NI4B 1USWA 1Q22A 1SUCA 2QYSA 2O8NA 3O3MB 1XKQA 3FKJA 2OBYA 1FDSA 4TTRA 4D02A 2PEYA 2XTMA 3IB6A 5HDBB 3KV3O 1BAPA 4MCIA 5DULA 2VK4A 3AI2A 1CP2A 2ZVDA 2FZKA 1KJWA 1FS5A 2BFPA 3O73A 1TC1A 4C76A 2O8FB 1ZQ9A 2WAXA 4U7HA 1D5WA 2J9FA 2QGFA 3L0DA 2E18A 4HGNA 1OFGA 2C96A 4BC0A 2RK4A 4DLSA 2WTMA 3EDYA 1EX7A 2I99A 1N2SA 1TF7A 4UM9D 4UHDA 3PYLA 4TTQA 1X77A 1KZHA 5EYPA 2GLUA 2Q7OE 3BHJA 5F3DA 5JMTA 1O3YA 1J90A 4KSBA 4YRIA 4YMHA 4U2GA 4D74A 3H4VA 3O2JA 4HAVA 4K9QA 4LIPD 5LQSA 3WIEA 4AS1A 2AS0A 2AW5A 1B0AA 2P2NA 2CLLB 4RK7A 3DZDA 4Q7QA 1YVEI 4YCJA 4BO6A 1ZNWA 3B6IA 1M8PA 4HLUA 4G26A 3DLPX 2GJKA 1ISSA 1CHDA 1N5JA 3Q3HA 4GWKA 3NANA 4IEEA 5I5GA 2X9VA 5BVGA 1IXZA 1MEJA 4OHKA 1ENPA 3H9QA 1J8VA 4PFJA 3HYTA 5H02A 1IBCA 2Q4DA 1W6RA 1Z08A 4LJKA 4UE2A 4G67A 4OG2A 6ABPA 3DE4X 3A6GA 1KRWA 4U7JA 3TF5A 4KRYA 1NOIA 3H86A 3MELA 1JBKA 4HN9A 4M1ZA 2H06A 2QUKA 2X3FA 4N3CA 1YJ8A 1YL7A 3AF5A 4BQRA 2C95A 2ZIXA 3ETCA 1RSZA 3LCUA 4EG1A 3LC7O 3DEFA 1U0JA 1AKRA 3ONVA 4M4SA 4LGYA 5AK6A 3TM5A 4JEMA 4Z2YA 1TTTA 3C48A 4YUVA 4QRIA 1UKYA 1JLLA 3K8ZA 4FEAA 3G0BA 3F7NA 3PUJA 4X1OA 2A9VA 3BMNA 4RD2A 3DHNA 1K68A 4O08A 3R7AA 3E35A 5LYYA 1N8SA 5AIAA 3VNSA 5E3JA 3MGKA 4PEVA 5AXBA 3M6UA 4Y2RA 1HTBA 1VSQA 2FN7A 3W5SA 2G40A 3JVDA 1MIHA 4P3KA 7MDHA 3HB4X 1KI6A 2XNHA 1QV9A 1X80A 2WSBA 3AY0A 5JO9A 1V7QA 5IJ0B 4O25A 1NNEA 4Z9BA 2Y0PA 3MEQA 5CBPA 2EWVA 3DMHA 4Y6SA 4E7PA 2J6BA 4ZOAA 3G85A 4XLLA 4F93B 1G8AA 4CF7A 3UAYA 2JIZD 3PC8A 1ODFA 4C6TB 1TKCA 4C0QC 4L0QA 3DZJA 5BR1A 3VH3A 2CFRA 4C0KA 4D9HA 3E0QA 4BNDB 3R0XA 1WHTB 2B98A 2FWMX 1UEXC 2HF7A 3E53A 3ER6A 3Q8LA 2C04A 3IAFA 3X0DA 3TIFA 1FP1D 2HPVA 2XWJI 1E99A 1RJ9B 1R8YA 5LKRA 8LDHA 1GQRA 4ECEA 1XEWX 1FFSA 1T10A 1K7CA 1JSXA 1PYGA 4F0JA 1HQKA 1P0CA 4RQTA 1MW8X 1OFTA 1BMTA 1K6MA 1BWQA 4G0PA 1WXDA 4L8FA 4LNAA 2FMFA 1RTKA 4YAOA 1EFCA 4NAUA 4O5AA 1ZW1A 1ECFA 4LWPA 4M0CA 5DH9A 1L5NA 2BHSA 4WAUA 4C89A 2IEYA 3SFTA 3WYDA 2F8TA 1V9SA 3O8OA 4I9HA 4CDRA 3N1UA 1RYMA 4IV8A 3KEGA 1GPH1 3WS7A 3OE7A 4X44A 1UFOA 5I7AA 4BP3A 1FFGA 3ANNA 3CRRA 3KVYA 1KZGB 3L01A 4BQSA 1H9BA 3CF0A 3LGSA 4Y1RB 5FI3A 5IHXA 4RH1A 4QNRA 1U7HA 1VHQA 1VFPA 3TQHA 1E3JA 1U0RA 4CM6A 5T3YA 3C3BA 4GPTA 1GVNB 2P9ZA 2QRKA 3NDPA 2O3UA 4ENWA 5DEIA 1S2IA 2KHZA 1NI5A 3QOWA 2P2SA 4OREX 4ZDJA 1A71A 3PTZA 4ZJPA 1KJQA 4P5DA 5GONA 4GIBA 2FPKA 2G77B 2OCYC 5A02A 5DWDA 4XB2A 2VPTA 5I7WA 4NNPA 1GTJ1 3CEPB 4BZXA 4CMIB 4PG7A 1J97A 1RXYA 2IGTA 2VH2A 2ST1A 4DEXA 5IF3A 2IDKA 3ZLBA 5J4HA 3HR4A 1J25A 5SY6A 3BBLA 4CL0A 2WB4A 3EVZA 4HQ0A 1JE1A 2C20A 5JEEA 5ALFA 1IXSB 3NC1C 4LG1A 1Q84A 2NVOA 5AOBA 3B38A 4YI3A 4QEZA 1OFUA 5BVHB 1M67A 4OTZA 4ZAWA 3PEEA 1U8FO 2JGIA 4POOA 3BDVA 1AXEA 4HLDA 1TO6A 3SP1A 1T5TA 4O2AA 3R9WA 1JUDA 1ULSA 4E5KA 2J4DA 4FCTA 4KO1S 3I6IA 1ETUA 3NWBA 1V35A 3C8UA 1PV4A 4RVDA 3P20A 1GGKA 2EEZA 2QQFA 4H7JA 4LHZA 4URZR 3ZDXB 4DAEA 5CDFE 5KBYA 5L4NA 2HF2A 5KIAA 1NVFA 4V0MA 5FCDA 3V4OA 1QO0A 3VU3A 3K0FA 3CF2A 3K1ZA 2A5LA 4JUBA 2RJOA 4MV7A 4Q1CA 2IIQA 4X1YB 1ZUNB 2P67A 5BOSB 2IU0A 1NPTO 4QLAA 2WYUA 2G4LA 1H5QA 1QOPB 1QDEA 3JQ9C 2P4UA 3C98A 2Q6VA 2CBXA 4M1QA 4N3NA 3GHHA 1VSUA 3UT5A 2WHYA 1XJCA 5D3QA 1RI4A 4PSUA 3ZLJA 4TV9F 5FI5A 4LFBB 1THMA 3T06B 1V8DA 1KP9A 4EHHA 4IHJF 1D1QA 1SB8A 3ZLVA 2ZB8A 1Y6FA 3ZWOA 2C1XA 1I4WA 1DV2A 1WZNA 2GNAA 2Y1WA 3E9YA 3FLEA 3OZRA 4B7CA 1LEHA 5F1KA 1UMKA 2G5TA 1ZRMA 2H07A 3FKSD 3L49A 4YO7A 1GR0A 3UOAB 4BWVA 2B9VA 5BMVA 3C3PA 2QZPA 2W6PA 4P7BA 2ECPA 3HSSA 5HTKA 1JEQA 2YXDA 1TTHA 3AIMA 4Z4GA 4BMDA 4MOWA 5BSRA 4NECA 4MJLA 1N7GA 3M4NA 1TM1E 2WM8A 3I09A 1NRJB 3JQBA 2QSYA 1TMKA 1ECGA 1GU7A 3ICPA 1GUDA 4KQMA 5C7IO 5CB4F 5BSWA 3CPHA 2FPRA 1V3QE 3LMKA 2I4OA 3ETHA 4I5IA 3ZZTA 4CF4A 5B58C 5IUNC 1XZHA 1TEVA 5ADHA 5CFPA 3G0HA 4NESA 4D8UA 1ZISA 5CVEA 3OZUA 5B1DA 3K9BA 2P8SA 1XROA 2ZROA 4YIKA 1EJBA 1XCMA 3NIWA 4GI2A 4K3UA 4CEHB 2YQZA 3A6KA 2BEVB 3O0DA 1EP9A 3DE6X 2Y3IA 1B16A 1Z45A 1HE1C 2YXBA 4TS9A 1SIBE 1XZLA 3TNFA 4CIDA 2P78A 2Y6VA 2RIRA 1U3UA 4I6GA 1DWOA 5CHEA 5LCXA 3RC9A 1E79A 5LM3A 2SECE 3LLUA 2WK1A 4ARSA 4H7PA 1KKLA 4CMAA 2FX5A 2JH9A 2N3ZA 2GARA 2WE7A 2VT3A 2OUIA 1MXFA 1VA5A 1YB5A 1SZDA 2X5NA 4FE7A 4BRWA 4ZEMA 1TZMA 4TMYA 4B73A 2AC7A 2CL6X 3I5XA 1DUSA 1SZJG 1XNGA 4JLUA 4D9JA 2BGWA 3SI7A 1XBTA 3PVZA 3C6YA 3ZUPA 1NBHA 1G20E 4FKMA 1MX1A 2BFNA 4D3SA 1T4DA 3SDSA 2GD2A 3KXLA 1GPLA 5M29A 1ZZEA 1QS0B 1XRQA 4HK4A 4ZO8A 4QXMA 2BEKA 4XW2A 2GD0A 4KPUB 4J49A 2QN9A 3HKCB 4KWHA 3QFSA 4X7PA 5JVDA 1U2EA 3ZOZA 5JBNA 3W3AH 4RQBA 5CGQB 4XTRA 3I72A 4IDDA 1KYQA 4WCFB 4K6MA 4L08A 1IPFA 1SIWA 1A9XB 1P2BA 1SU8A 1JG4A 3DOIA 5HILA 2NV2B 5DRTA 5JFTA 1AKYA 1HE4A 1MAUA 3FLMA 4CKBA 2XJ4A 2P1ZA 4R8RA 4FE4A 4I8DA 5EOVA 3UUWA 1IG3A 3HEAA 1EE9A 2E37A 4GE3A 4OK5A 3JQ8B 3WBBA 5EP4A 4Z99A 1W9HA 4WW0A 4FGJA 1OAOC 3LPDA 5EMKA 5EZYB 3WL3A 5CA0B 1BRTA 4HT3B 1CF9A 2H63A 3IIIA 5BR4A 1TQ8A 3IQXA 1PTJC 3MC1A 3QTBA 3M33A 3HGQA 4IOJA 3EZNA 4NPAA 4RGYA 1SUAA 5LZ5A 4CWAA 4LXUA 1EFDN 1L4BA 5CCEA 2Z2IA 4FYVA 2P91A 2HA7A 1I2CA 1T8SA 2AKYA 2P2GA 1H0KA 2XCLA 2RKOA 2HLHA 1U99A 2IPLA 1G6OA 2R6HA 3D9QX 1KGDA 4FYJA 4I4CA 5F52A 1XI2A 1X1EA 2WOOA 2A35A 3WI7A 3IIJA 4TYNA 3L7BA 2E5WA 2D8AA 1M0TA 2ZRLA 4XCVA 3EGWA 4PQRA 3CX6A 3BRWA 3R3ZA 3L46A 1F14A 2QTLA 4ER3A 3FTEA 3B8HA 2EFYA 1U9JA 2ZI5A 1T5DX 1D1TA 3OOYA 2MSCB 2X4IA 3EW9A 5JPDA 2BDTA 5CK4A 3LC0A 4HEA1 1GARA 3FDIA 2A58A 3RJZA 3NRCA 5JADA 2JFWA 1OYVA 2LDXA 3MLEA 3MQ4A 4D96A 1QPZA 2O4CA 2X7XA 3NO4A 3AP2A 3WNVA 4WECA 2F59A 3V4SA 1JR6A 1QHIA 3FBTA 5HZHA 3B6MA 3NW9A 1UJ2A 2VP2A 1ZNYA 3PQFA 4O4LA 1EVJA 3GFRA 5ALRA 3EA5A 3WGNA 1NFQA 3OURA 4HADA 2RKBA 4RTQA 3IV7A 4XIJA 2YMMA 3DJFA 2DCMA 1R5OA 1QVRA 4NCIA 1LI5A 3IYLW 4AG6A 4IICA 1QG4A 2V5UA 2FEXA 5I3CA 1RHUA 1OZHA 2XV1A 3H2SA 2NTVA 2P40A 1EUCA 3AVPA 1HI9A 1X6VA 3MBIA 3PZBA 3TRHA 2YFKA 1Y9ZA 2ZREA 2MR6A 1MVLA 4HWSA 4V0OA 5IPFA 4DV7B 4M1WA 5JNWA 3CX4A 3HWRA 2OD9A 1O97C 2H5LA 4V0RA 2FMKA 1R0CA 4MUYA 1A2KC 2HA6A 4Q1DA 4QOHA 4D3ZA 1BXZA 1YOVA 4I2VA 2H1IA 2WWGA 5KYWB 5LOVB 5MN5A 4ZEOA 4IIXA 4C87A 5F73A 3L7NA 2WIGA 1MTOA 3D1LA 1K2WA 4ODIA 1FUYB 1TIKA 5DGCA 1H1LA 4WOBA 4A2PA 5ICMA 4JGBA 3Q7IA 4FT2A 2EFJA 4P33A 2QX8A 1R50A 2UVQA 4AKGA 5JS1A 3KDPA 2GPSA 2VNSA 1AO0A 2PO7A 3N2NA 3QF4B 3SIWA 3X1ZA 1Y1LA 3HDTA 4EFNA 1IY9A 3ZD9A 4NE2A 5ADWA 4FOOA 4GL2A 4H1TA 3NS7A 4KXVA 4MHSA 1DEHA 1PUXA 1QO7A 2Q9AA 1ZC3A 2ZYHA 5EJEA 4DUYB 1PT7A 2HK7A 5TJHA 1OOEA 2C4WA 3RU3A 2BKEA 4M83A 1EVEA 1OIWA 3H6GA 2J87A 2WVHA 4J6FA 4HFRA 2FMHA 4CR6A 3TKYA 1IEWA 2F9MA 4F7DA 3D8UA 4JJ4A 2BWJA 4YJFB 3OZBA 1MXHA 3NHAA 3D6FA 4C4AA 1JJBA 1AKQA 1EWVA 4OQDA 5BWNA 3DG9A 1BH2A 4J4BA 1COZA 3VZSA 3V33A 3L8CA 4JZKA 3RRZA 1ML3A 3HLKA 2MSDB 2FRXA 3KEOA 4F21A 3H11B 4OYRA 4BMNA 2K7FA 1XX6A 2HXYA 5D5PA 4AO6A 1OH5A 4JELA 4MX8A 4E88A 4W7IA 3GVXA 1N25A 3M6FA 3W9SA 1P4SA 3KJHA 4MUGA 2X42A 2RH5A 3NUGA 4R2HA 1FXWF 2NZ8A 3BRWD 2Y67A 4MKZA 2A33A 3GUUA 5IANA 3BJZA 2A84A 2QRQA 3QV2A 5AW0A 5BUCA 2ZRKA 1KC1A 1KQOA 1H0HA 2ODBA 1KWKA 4EYKA 2DMRA 1N9GA 1VJCA 1AB6A 1E4EA 1IC6A 2NACA 4UVDA 3I58A 5MF6A 4F46A 1R2QA 5F7OA 1RI5A 4FDVA 4JP8A 3JRNA 4DLKA 2ZSJA 3R5JA 1WZEA 2EDAA 4XOIA 3ZDYB 2A94A 4CJXA 3Q40A 5L4LA 2PGJA 2X5OA 1H6AA 4XWKA 4RMIA 4NBVA 1P6UA 2IZ1A 5NLLA 4N7MA 5I4CA 2VJMB 3VPDA 4L8GA 4G1UC 2HK9A 5C34B 1UZNA 1Z6AA 4L73A 3OIYA 4G8BA 3B1YA 1I01A 3COJA 4UPEA 4P0QB 3PNVA 4M38A 1L7EA 4UDOA 3RREA 1TL7C 4M9UA 1QK4A 4LV6A 4QQFA 3TW0A 1LBIA 1NONA 5K0NA 1LBEA 3M2TA 5I4IA 2DP4E 3RDPA 1LC0A 3BXEA 3F90A 5KI6A 1KI6B 2J6CA 2B4AA 1Y89A 6NULA 1K7SN 2LP4Y 3F8TA 1KFCB 1KK0A 3SHTA 4OMCA 2BMJA 3O1LA 1C5KA 1F0NA 5DGIA 4NL4H 4FWTA 1L7VC 1MA3A 3R76A 1P77A 4QO7A 2UV8A 5ALXA 3S44A 1A8QA 5IWCA 4CQMD 2WUGA 4B09A 1D6MA 4ZI7F 1PN3A 3ZDQA 3MK31 2FUCA 4BQNA 4U3JB 1JFFB 4ZHSA 4LVUA 3N3AC 4MYUA 4OHFA 4WOJA 2PX4A 4Z86A 2JGAA 1AVTA 1JYEA 2CJFA 3L7OA 1XEWY 1FQJA 3H2HA 4G07A 4J7UA 5JCJA 4N01A 5IM4F 1QS0A 2GI4A 2I65A 3L77A 4KEAA 1TU4A 4JJGA 4C4RA 3CR7A 5F21A 4F04A 3UC5A 1L5RA 2O6HA 3FUXA 1M1XB 2PMFA 3LDFA 1T5IA 2D2EA 1JDVA 4BVFA 1UINA 1C4XA 2HOQA 3V4RA 1MAAA 1O0BA 1A95A 4KG7A 4DC0A 4PGFA 4BP8A 1MNQA 1Q44A 2EU8A 1E6UA 3FSGD 4IDAA 1QWSA 2WI8A 3DMPA 3G5MA 4WXHA 1FL9A 3ZU4A 2RGNC 3HBLA 1JHQA 1KEEA 1BU5A 3NEPX 4F5EA 1G5FA 2AG5A 3O3CA 4CL8A 1A4UA 4Z0TA 1ULTA 2OHXA 5ANRB 2PQ2A 2JAOA 4KN6A 2A1UA 2WWHA 4WZBE 1KYWA 2EKZA 3CFYA 1Q21A 1SBNE 4HY3A 2E7ZA 1QKIA 3PF8A 2BDUA 1T6XA 3F1KA 1EHIA 5K0BA 3JZIA 1BDMA 1WVGA 2C5EA 2HJRA 4OX9B 4KR0A 1FY2A 1OHHA 3WIUA 3EQ2A 4DCMA 1FTSA 3BPSA 3HPRA 2WA1A 3NXKA 5LB2A 4EOGA 1JEAA 4A2QA 4X8HA 1WLSA 1RZUA 1KJIA 1EI9A 2R8EA 4JUDX 4HNTA 3LUJA 2DWUA 5AD1A 3VVCA 4J16A 3U4GA 5EIBD 2ZWVA 2IXGA 1XPOA 1QYCA 3UB2A 4KWEA 4GZ5A 4FIZA 5BQ5A 1Q15A 5LP6F 2I4LA 3NFYA 1UP7A 2WD7B 1VBFA 2HXGA 4CM3A 2HL6A 4MV6A 4MYCA 5LQMA 4CXMA 2FP3A 3D7LA 3LQQA 3PICA 4UTXA 4IJUA 5JSQA 3DBLB 1JPJA 3WRXA 1F38A 5IRCD 2KJQA 2Z3VA 3ZE9A 3I8SA 1EFRD 4HTAA 1QGUB 2X4GA 5DYGA 3DW3X 1P2DA 3UTDA 4NFYA 2V0NA 1B8OA 1C3VA 2IHZA 3ENVA 3OT4A 3I4LA 5TGTA 4CM4B 3HNRA 1MRZA 4GI7A 1ISFA 2XZTA 3K9QO 2J59A 3PPWA 3V6LA 4QPPA 1YA6A 3TLAA 4G24A 1T2EA 3K9LA 2C98A 2NQTA 4CLRB 3D0KA 3DNPA 4G0VA 3G2NA 5LNK1 1PJ3A 1PDOA 1A9PA 1CP3A 1XAHA 3NB0A 4OY3A 4D7AA 3TPZA 4RO0A 2JCGA 1WMEA 2OO7A 2D13A 2XE8A 5BOSA 1CDDA 2EYQA 4WXEA 5IARA 5TNXA 3SIXA 3HADA 2QV0A 3MXTA 2VFAA 3CRW1 1E96A 3H5WA 4FR2A 4GKVA 1VFNA 5C9ZA 3GY0A 3T5BA 3Q9SA 4RTSA 1H8ED 4KIJA 1M5UA 3LIIA 2CLOB 4Q1BA 4QHSA 3CE9A 3O4IA 3T54A 3D6TB 3UH1A 4NOKA 4BYMA 2W9XA 5AUPB 1JJVA 3NX4A 1U3TA 1NL3A 3FPAA 4XYEA 5F2NA 2RE8A 1XPUA 3ND7A 1NUPA 2BW0A 2Y1CA 3P2MA 3ST7A 1G4UR 1H2WA 4GI5A 2R2AA 4PC3A 4B3TB 1U0SY 4CU5A 1KMIY 5IH7A 3BTUA 4MI9A 4C0JA 4FBGA 1U0FA 1I8TA 2CYAA 2OGTA 4DLZA 2LIPA 1HDYA 2Z2KA 5E1BA 1HEUA 3SYTA 1QR2A 3ZPXA 1Y4AE 3EVBA 3HCBA 5DHFA 2QL7A 1K5DA 4DMGA 4TYWA 1KARA 3MW8A 4PG6A 3NHJA 4DJTA 5JSHA 2NYRA 1UBRS 4KUEA 5HVNA 1E60A 2G9NA 1L2TA 2V1XA 2W2KA 3IPCA 4HOYA 4JJ7A 3THWB 2E4VA 3IB3A 3V80A 4WKOA 2JEYA 5FUBA 4RV4A 3E8MA 3H97A 3PQ4A 4UHJA 5CJPA 1IIRA 1SXIA 2ONCA 2E4UA 4XM0A 1LC3A 4A5OA 4H77A 1L1EA 3ELBA 4X71A 3URMA 3WGVA 3QU9A 1GXSB 3C7TA 3G6KA 1NBMD 1KAEA 3K05A 2C3UA 2BHTA 4KPGA 2V5AA 4MUHA 3HR8A 5CNIA 4Y2GA 4ZVPA 5I9SA 5KAPA 3UUGA 2FXVA 3FZNA 4MA5A 1AUXA 2F8LA 2NZVG 4MVJM 1FMFA 2EJUA 5FBLB 3W2HA 1C7JA 3CG4A 4OHXA 2NT4A 4DCCA 1QHFA 1N5KA 5F64A 4C03A 4EJ6A 5A3JA 5KYYB 2C8VA 2IHBA 2DWPA 2ZSHA 1N9ZA 4UEWA 5J2TA 2OILA 2Z5FA 3ZV5A 3ZQUA 2OFWA 2FZWA 3M3PA 5A5DA 5KPJA 5DP2A 4W8GA 4C7JA 3QX9A 4BQOA 3HV0A 1QGED 2O2CA 3RFVA 4BFUA 2B1RA 4MVYA 4C7OB 2Z3ZA 3DL0A 3PFNA 4I7EA 5CVVA 3R7DA 3SJCA 4ZHQA 1M7HA 3R7NA 3TVYA 5HRUA 2OCIA 1ULZA 2QRVB 1A77A 2WU3A 3PPXA 1G4HA 3FKQA 4IQ8A 4DC1A 1U7UA 3N6VA 1RQXA 3R3UA 4K9LA 2HU2A 5HKOA 3RYTC 4AC9A 5EEGA 3KFLA 3OPQA 4OGGA 1UBSB 5IXSA 1E1YA 2HRCA 3PD1A 3A28A 1P5JA 1UKBA 3C3XA 4HVLA 1S2NA 3QU2A 2D7JA 4ZDIA 5JS6A 5ENDA 1QH1B 4J0FA 4MQ5A 4ZCIA 4DR3B 3BFKA 3LLVA 2K4MA 4FB4A 5EE3A 1GA4A 1U4NA 3HUUA 3Q2IA 4YIHA 3WAGA 1B1CA 1L6RA 4G37A 1XD2B 2FX2A 2UVPA 1NXXA 4F9EA 5HKKA 4YJ2A 1FX1A 4NEQA 3CSSA 3EEYA 5EEHA 2R68A 1T43A 4JS0A 2ZAIA 4F72A 4BQIA 4QXQA 4C6HA 2AF4C 3CRMA 5A04A 5IC4A 4YY3B 3FNIA 1EIZA 4PYQA 2ZU6A 3SHVA 3FMGA 3UG6A 3WGMA 2BGTA 3FRJA 4FXOA 3O31A 1C0IA 2N1BA 5IDWA 3EARA 3C74A 4MPPA 1TB4A 4YRKA 2FZ5A 2ZSBA 3W2IA 1KZ9A 1WMSA 5IWAB 1OXTA 1XG5A 1E6MA 3GR6A 4LTDA 4R1OA 4Q34A 4TUYB 1P1KA 5DB4A 3NV9A 2QTWB 3QP9A 5ICGA 4IJQA 4M8NE 5FO0A 1HE2A 5KB3A 1QX4A 3CMMA 2HPZA 1N0HA 2OWEA 3LT4A 3MXOA 3DV9A 3QVXA 4JHXA 5EE5B 3HNPA 2HWXA 4PYIA 4TS4A 3U4HA 1SKMA 1MU0A 2UAGA 2BTEA 1KR5A 3I53A 4JFRA 1YDHA 1XT6A 3DE1X 3NHMA 3V8NA 3QFFA 5DTRA 1H22A 1TFRA 5DM1A 2REBA 3GFBA 3Q0TA 1AGYA 1C1YA 4XFDA 3TD9A 3ZHZA 4B17A 4BP1A 1G9SA 5B3KA 4A92A 1HL3A 4TVBA 2ZRAA 3GLKA 4QOSA 4D4HA 5BV7A 2UVDA 1QU2A 4ZDWA 4OJTA 2ZRGA 2X0RA 4CTJA 4N5IX 1ADGA 4RA9A 4KFSA 1K66A 4ENUA 6YASA 1HQDA 1RCUA 3DE5X 4BMXA 4D3DA 3OI7A 3K6SA 4Y3UA 4WKCA 4CEJA 2PJUA 5HF8A 3IGFA 5TQ0A 4YAGA 3T1HB 1VC2A 4K87A 1JTFA 3UMBA 3KOYA 5A5EA 2B4KA 2IODA 3IJRA 5LUAA 3M6LA 2FUG1 3LF2A 3P97A 4X7BA 3DZFA 1JDTA 2JLAA 3Q15C 1ZJ6A 1RJWA 2GYVA 4KGDA 1ENZA 1L4NA 3BWBA 1N92A 3MCZA 4L51A 4MP6A 3SY8A 3T3NA 2HUNA 4H35A 4JUIA 2Z83A 3HACA 1W7AA 1DU4A 4QASA 5FADA 2JFUA 3RTBA 2C9ZA 4XUCA 4Z7OB 2E85A 2D3TA 2XYVA 1RXSA 3P9PA 2IJGX 5JAQA 1FRFS 1WZCA 1CUHA 4FHEA 4HNAB 2CHVA 4BVEA 2UUAB 4PM4A 3TRFA 2R5FA 4L5BA 3W9BA 5K8UA 1A88A 2CNKA 4ND1A 1W9MA 1N4AA 3NG1A 3VSAA 1ETHA 1JPUA 3AFMA 1T2NA 4DUGD 2XVAA 1KXZA 1G8PA 1KC3A 3BH7A 4HEHA 1MX5A 1RBQA 4TM8A 4EL0A 1G8YA 2IGBA 2ZIEA 4GGPA 4MTLA 2QZ4A 1CJKC 3URKA 3NNNA 4K9KA 4NLLA 1W5AA 5DMXA 4L95C 1E4VA 2EFEB 3FZQA 1GIAA 2PSFA 5A1JA 1O54A 3RSGA 2JHFA 2JARA 3GEGA 4M88A 5FTWA 2GEJA 4FC6A 5KYKA 1Y80A 2QD1A 3OZIA 4J76A 2QU7A 2G17A 4GEKA 3UIEA 3WWZA 4YQZA 3AI1A 3BB3A 3L7IA 2QK4A 4POAA 4D3YA 5MGBA 3UK7A 1KK1A 5U1PA 2ZUTA 4NZZA 5G1NA 1L4HA 4UMVA 3WADA 1M6EX 3N28A 3N8DA 4QTZA 4AKSA 3IULA 3DDCA 4TXJA 2NAFA 1O95A 3EPPA 3PIIA 1PFVA 2UZ3A 3FWYA 5EHIA 3SE7A 3N7UA 3RG8A 2CHGA 2DBZA 2C2ZA 1MT0A 3KX2A 5A03A 3HDHA 1VP3A 3SWWA 2F3QA 3QLJA 4Z9XA 3KUDA 4C88A 1OFVA 5AKZA 4C22A 3HB7A 2H51A 3PXBA 3KL4A 2ZW9A 3BGOS 4P9NA 1ACMA 2PS3A 2QLFA 1P2SA 1LWOA 4F12A 5FKJA 1THZA 2C2GA 2QX6A 4S24A 1ZD9A 1M8KA 1D5CA 2HREA 3R75A 2J3KA 4OHVA 1FFBA 2C5FA 4IO0A 3AMVA 5DGDA 4R71A 1PD1A 1KFEB 4J90A 4PC1A 3U7HB 1CBUA 1XN4A 3FUWA 3IRUA 4RVNA 5J2UA 4L3WA 3AR2A 4TV8B 2P7HA 1QANA 1ORDA 4II3A 3KPVA 2HMWA 4H6VA 1YK1A 2KPOA 4M22A 4R69A 1IK4A 2CK3A 2AFVA 5JMPA 5FXMA 4X54A 3ROKA 3VU0A 1AK2A 2IYYA 3EY9A 4L6AA 1NPDA 2QROA 2QMEA 2IX9A 2B8EA 1FUIA 3ILXA 1M33A 4FFLA 1QZXA 3KVVA 4B7ZA 4F9GA 3JD1A 4N3GA 4R01A 4XCQA 2PMCA 3OH8A 3F9IA 1XA0A 4RVSA 1C7IA 4RHCA 1KVUA 1NQXA 1RIIA 3ORRA 3EASA 2BFDB 3GCDA 3N87A 5JAPA 1IN6A 2IIVA 2YJ3A 1ITZA 5BV1A 2C8JA 5ETJA 3HJCA 5JD3A 2DKFA 1YV9A 1LXCA 2GYWA 1YZLA 4GR5A 5JU6A 2O0HA 4YAWA 3KB6A 4CT0A 2PXHA 2WVGA 4R8LA 1MFPA 1ZLXA 3PHGA 4G4SO 4JWTA 2AFIB 4JUFA 2XCOA 4LJRA 3MJVA 3IQWA 5EVJA 5L95A 2B6HA 1SCAA 4YMGA 3OD1A 3M6IA 721PA 2MYUA 4MVCA 3WDSA 1UAGA 4K6HA 3QKUA 1JJAA 1KO4A 4BLTA 4CDGA 4LYHA 2EKBA 1I3CA 3NTQA 4MUBA 1GSOA 5IT4A 5EGNA 4A6DA 1GZDA 2UYQA 3CB2A 3PQDA 3EHEA 3ESQA 3VPFA 4BAZA 1KERA 1Q7CA 1O87A 2ZAOA 4G5XA 4Q9NA 1RKXA 2CDRA 2I78A 5AJWA 3H16A 4FYIA 3PJRA 1Z12A 4G5SA 3Q7RA 3TNLA 4ZYUA 4BBAA 5KWSA 4YN3A 2P9EA 1ZXLA 1GUBA 3WV5A 3ZLUA 3HJTA 4L4SA 4W1SA 1MB3A 3HVUA 1AKWA 3D59A 5EIEA 1IONA 4FPXA 3ZWKA 1Z5VA 2J3LA 4DZRA 3UHJA 1UF9A 4WESB 5JZVA 4K2HA 5AJVB 4BKRA 3W3AD 2EYUA 1TRKA 2BM8A 3VKGA 2WOJA 4OSEA 1NDHA 1I1NA 1F4PA 1NVWQ 1W1WA 2ZSKA 4JROA 1FP7A 2I6QA 4MV9A 1QGDA 5E0KB 1XKTA 2YWHA 3AH8A 2KM1A 2C9OA 4LDZA 1XO1A 5FTJA 5B53A 1N77A 3C6BA 3RHFA 1UJ5A 3R7WA 2QXUA 4GZMA 3EIFA 3H3JA 2FEMA 2JF0A 1QIIA 3HL0A 1NQAO 1SBCA 1HZJA 2IYPA 1GDTA 3D3JA 3GPBA 4AAYA 2D1FA 3KZOA 1IHXA 4EEKA 2XF2A 1HYQA 2YWEA 3OICA 2E6KA 2R1TB 1NX9A 2B35A 4H31A 4D8XA 1MQAA 4U2CA 1TQ2A 2G5GX 4GM4A 3RVDA 5IBCA 1LBHA 2G0NA 2ZCVA 3KQWA 5TEWA 2F62A 2X8LA 4ZWNA 2ODQA 3HBNA 3DVSX 2WNIA 2WD7A 1B4DA 3QH4A 3Q72A 2AEJA 5ERYA 3DBLA 3ET5A 1NNI1 2AG1A 2XUFA 1E5QA 2PZMA 2XYPA 1C3JA 5JS2A 4HDMB 5SYNA 2GZ3A 2WAAA 4PNEA 2AKAB 4JR0A 1XJWA 4DPMA 1N8TA 3GD7A 3MB8A 5DX0A 4EW6A 3ZY2A 2AXNA 2YH2A 3VHXB 1ZMRA 3LBFA 3DC2A 1WCXA 1SVNA 1LKZA 1UMCA 2AN5A 5C7OO 3PGKA 1E59A 3O4HA 3NYIA 4FFWA 4UU0A 2QZZA 1Y82A 3SE0A 1U98A 1YIDA 3BCSA 2PXAA 4HWRA 3R0ZA 4LOJA 5C0OE 2I7VA 4OL9A 3FOFC 2Z43A 5FA6A 1Q17A 3ND9A 1AD2A 4DIEA 3GCWA 3OZDA 1J99A 1YR7A 4RKYA 4OSPA 4V2IA 1XCBA 3NHZA 4I5DA 1U2RA 1HFKA 1N2CB 5H4GA 5KHLB 1XZKA 2ONZA 3LDAA 5JJLA 2IYOA 1ZH2A 4X94A 1HWYA 4ZQHA 2GTHA 2RBKA 3REOA 3ZDEA 5CD1A 5CB0A 2C00A 4JC8A 1I6MA 1Z0KA 2CFIA 2XMBA 4D44A 2LDBA 1D0IA 1HSZA 4WJKB 4ARZB 1JLSA 3A4NA 3A4VA 3NYRA 4ND3A 4UEJA 1NM5A 1NY5A 1DB3A 2JLRA 2A78A 2F1HA 2QR2A 3NDRA 4FDLA 4JA2A 4L5IA 3LT0A 2ODPA 2PVPA 2W6JD 3F47A 3M4ZA 3PQ2A 4FK8A 2AG8A 4JCCA 4E1AA 4AWBA 1GAJA 4XJXA 4C4OA 4TN1A 3EF3A 1GPMA 1JIJA 3PJGA 4FU0A 2D0DA 2W42A 3BGVA 1E6KA 3R9XB 1MGOA 2AJ8A 3LT2A 3ICOA 4XE5A 3N2YA 3PQ5A 4RY0A 5CG2A 1A69A 2F6RA 3I4FA 4X1YA 4BX8A 1JU3A 1T4BA 3A4LA 3TCXB 3KETA 1ZVJA 1TDJA 4GD3Q 2CE7A 4H3VA 4IIHA 4WKPA 4Y2JA 5EINA 3P0RA 3IMCA 4B6OA 1V47A 4I36A 3FDXA 1OLUA 3PEVA 4RU1A 4DDTA 1T2CA 1NX6A 4PV7A 4WA8A 5LQKA 4BBPA 3AW8A 1PNQA 1BVHA 5B55A 1BE8A 2HB6A 3ABSB 3OTGA 5JMWA 3X1MA 4UUAA 1JEOA 1VBKA 1BDJA 2DYKA 2ZB2A 5EKUA 4EY8A 3TLZA 4XFKA 5CPBA 3LNTA 2IUEA 5A3QA 1SD5A 4ABTA 1THTA 1W49A 1FFEA 2GZRA 1BEUB 4X97A 2GBIA 5BMVB 3JAKB 3AXSA 3MT0A 4JBHA 5F2OA 3GZJA 5AXAA 4C3ZA 1EM8B 5EESA 1NLZA 2QTGA 4PZCA 3T1QA 3CX8A 3LQKA 3HN6A 1VSTA 4IGFA 3VR5A 2V4MA 2OE2A 2VCYA 1N2OA 2A59A 2OCPA 3C15C 1BCSA 4IDPA 1DAGA 3EUWA 4Q1EA 3RVOA 3D31A 1EFUA 1ABEA 2LXNA 4B3BA 4RLFA 4H2DA 4O2LA 4ACBA 5JY6A 5JNLA 1BIFA 4KI7A 2W5UA 4A82A 5FTNA 3GLHB 1ZUIA 1MJFA 1ZGZA 5EG5A 1DX4A 1FNCA 5TQ2A 5FHRA 1W87A 2VQEB 1R8QA 1O7JA 2BV3A 1NQUA 1DPFA 1DC7A 4LGCA 2PR2A 2OCLA 4X7MA 3OKFA 1XCJA 4CM1A 3LLCA 3V9AA 1Q57A 3TRKA 3KD2A 4CHTA 2AMFA 4II7A 4X8LA 1E7YA 4EJSA 3T3PB 4GOOD 2J45A 5C5EA 4QJ3A 2ZBVA 4S12A 5SV2A 3ZE0B 4GKKB 3I0NA 1XEAA 3VZPA 4JCOA 2AV6A 4QULA 2CYCA 4UOQA 4MINA 1J06A 1D2AA 1EDBA 1WPRA 3SMVA 3VNBA 3WLNA 4HXFB 4PBRA 1X74A 3Q2KA 4ZVTA 3OE1A 3WB2A 1UBKS 3ZXSA 1XDDA 1RYEA 1WW8A 4F4JA 3ZGLA 5HJEA 4TUYF 2HPAA 1KDZA 5CDYA 1CC1S 1VL8A 3BD6A 1AS3A 3HYRA 4FT4A 4QPNA 1M2OB 4L4YA 2JASA 1Q12A 3LYUA 4NV0A 1PLJA 1U9ZA 4UQLA 5K05A 2M1ZA 3UJPA 2FDRA 3IKVA 5FOQA 1CR0A 2XWSA 4ND8A 3D8BA 2X23A 2YHSA 1WM1A 4NMWA 4OU4A 4RELA 1ZNXA 3MOSA 4G3XA 1CYDA 3A58B 2IXBA 3V6MA 3I61A 1DFHA 4ZT5A 2QM7A 1WF6A 2RHDA 2ZU0C 2NXWA 4QGHA 2COUA 2VSYA 3OSUA 1Q74A 4EF4A 3ELYA 1NKSA 2XGSA 3RVSA 3R8FA 3DWEX 3ECCA 3EYAA 2R44A 1AKEA 2FSVC 3JYLA 3BDAA 5HPYB 1MP0A 3A11A 4HZUA 3COYA 4Y7CA 4Q4AB 2RHGB 2GHRA 4NBNA 3HXPA 1KHHA 1R6VA 1SRRA 1PT6A 3FCYA 1XKXA 4D8VA 4E3ZA 5JD4A 2QDXA 3S55A 3K1AB 2EX1A 1WSDA 2OLJA 2RB4A 3T15A 2PZ8A 1U0LA 3OESA 2A4MA 4RJ2A 5M2QA 1HDXA 2VH5R 1WDTA 3H7AA 3CU5A 2XB9A 4NCBA 4KR6A 1U4OA 3TGLA 1FTNA 2E49A 2P6OA 2HCFA 4YRZA 1GL9B 3UA3A 4W5OA 3U3JA 3ZJYA 3AR6A 1LPNA 1QFMA 2GO1A 2MT9A 4ESOA 4DDUA 2IYTA 1P7VA 3THYB 5K8IA 2LZ0A 3VM6A 1WCIB 2AFRA 3PDCA 3D7KA 3PRJA 2RGXA 5GMOA 3QFTA 4OA8A 1UXJA 4ND5A 1IXKA 1Z35A 1A1VA 1US8B 2DFVA 1LBTA 4WZZA 2QUAA 4JLAA 2PXCA 1I1HA 1NJSA 5CM9C 2PT7A 2HJGA 2Y1OA 1U1EA 2TMKA 1G8SA 1XDBA 3QRWA 3EXFB 4MVJG 4U0JA 1Q50A 2AXPA 5C3MA 1E2IA 3JPWA 1N32B 4NPHA 4PYOA 4P3YA 5IUJC 2C5AA 4DVGA 1CR1A 2ZBUA 3K72B 2A5DA 1KGSA 1EXNA 1NU6A 1AZSC 3HB1A 4MTCA 1QE3A 5IDVA 2JDID 2AXEA 3GB9A 4MGZR 2HSGA 3ZW9A 2J30A 4RV5A 2QRGA 2W8BB 5LQCA 2JS7A 4WOPA 4C14A 1CZUA 1S8AA 2QN3A 2BGRA 4KQFA 1XCLA 3PKZA 3L7LA 3EZYA 3TE6A 1I4TD 4ZXFA 3UJ3X 2DGDA 3CJQA 1HE3A 1HDEA 3C8MA 4F1JA 5LN1A 4G41A 1EEHA 4AUKA 1PHPA 2HJ9A 3CRVA 4Y2UA 1YO6A 4IAOA 1E9FA 4ZOCA 4LJ9A 1YRLA 2OUKA 4YCSA 3OLYA 4XVRA 4NR0A 4AMBA 2EWMA 1WF3A 4X0EA 5H3LA 4B9AA 1ZG3A 1YZUA 4MUJA 1YXMA 4NU6A 3MCTA 1E5DA 2O3JA 4LV5B 1Y8AA 1OHHD 3GHYA 5F23A 3EPKA 4XVQA 2QE7D 4YGYA 1DBQA 1XYYA 4M9XA 1G5IA 4AD8A 2C61A 2YNMA 2H3EA 4S0ZA 4DY4A 4EUSA 3W3ZB 2EBUA 1YBFA 4EGSA 2OBBA 1FUUA 3IKTA 2R7NA 1HZZC 1PJCA 2QN2A 4MCHA 1LV7A 2WWVD 1KYIA 3UHAA 4A10A 4BFXA 4XRGA 2XCRB 1FYDA 1A7UA 1GNQA 1QDUA 1R7RA 2Q8PA 7REQA 5K0JA 3IPRA 3GO4A 2EAUA 5E6SB 1L9KA 5ARCA 5IC5A 3ROEA 5D87A 4F3YA 4I50F 3NHLA 1N7IA 4XYGA 4MV4A 4I0WB 5C18A 2FUG6 2ZJ5A 3OPXA 3MGBA 1X1BA 2C97A 4UVGA 2JKZA 5TR9A 3DAOA 5CLGA 4B3DA 1I6KA 2JD1A 2EKPA 2A0KA 2V7XA 3U1TA 2OYRA 3ZE6A 1F7UA 4MVJF 4HMOA 2IBTA 4P32A 3SVZA 5LMCA 5EC8A 4MS1A 4BDSA 2HHAA 1FZTA 4W99A 1GSAA 3T61A 4E3WA 1J07A 4PAMA 1W36D 4YAJA 4ETIA 4FWIB 1JAXA 2A2ZA 4TWAA 1U1DA 2IITA 2VEOA 3CKKA 3FYUA 4L15A 4LRXA 4MW6A 4OXNA 4OLHA 2X4DA 3LPAA 4B6RA 3BK2A 4MPTA 3TM4A 4PHFA 3MGCA 2IVZA 3NTXA 2HA3A 1WBBA 3EY4A 4N0MA 1Z06A 3CT4A 1CUGA 3OFND 1I6LA 5GM2A 2E1PA 1NZFA 3FW1A 1SHZA 4DYHA 2F4NA 2OXFA 3WQHA 5LBIA 3G0CA 2ADMA 3DHWC 2GXQA 2QG6A 2X13A 3F73A 1YB2A 4LWQA 4OKNA 2YQ4A 3E7WA 3TSCA 4FHCA 4IVNA 1Y3BE 2VXOA 2ZYSA 4YAKA 4DQ0A 3UAWA 3B6ZA 3TLGB 3W6UA 3INTA 3NTLA 3HXKA 5U4XA 3JYOA 2X8JB 4K0RA 4MH0R 4R0NA 3ZU5A 2MU1A 4QUGA 3UBMA 2G04A 2Z8YM 2OZVA 4FNAA 1YR3A 4XM2A 1OKKD 2XXAB 4LY6A 2DXIA 4EGCB 5IMSA 4PICA 4ZXPA 1RBYA 1ISGA 1TYDE 1GPUA 2H17A 3B1VA 1IN8A 3NJ4A 3RCBA 3SDZA 3VX3A 4OI0A 2XRFA 2TS1A 1UUFA 3BF7A 3SIPA 2YVKA 1V9LA 3DMNA 3OX1A 1PEYA 3EPHA 2ON6A 1QFYA 1F5SA 4OK6A 4RVCA 3AB8A 3TKLA 1SQ6A 3FWZA 4BX9A 1O8BA 4XX0B 3HVIA 4FDAA 4S2EA 5CNKA 1JHVA 1SBYA 5IDYA 4BNZA 1PSWA 3B3JA 2DX7A 2XSZD 4DUPA 1DTSA 4HDRA 3PSHA 1XL0A 4U39A 3SHWA 1IN1A 5GV8A 3GJ4A 1N1GA 2WM3A 1EXWA 4FJ1A 2CN1A 2BM9A 1TRHA 3HL4A 4QFCA 1RIFA 3GA5A 3I2HA 3ZHSA 4TSFA 1O57A 2ERXA 3C4JA 4ZQGA 4L27A 5TMBA 2XQGA 3PEWA 3L8MA 2WTUA 2ZIXB 2XYGA 4LWOA 5EVCA 5KJFA 3FF4A 4NH0A 5IN5A 3G2OA 3TXXA 2P9JA 3RC8A 5MFPA 4L3OA 4DCGA 2FQYA 1JZQA 1Z8HA 5KINB 7ABPA 2J7KA 2X2FA 3PHCA 2COKA 5HCUA 4NHEA 1L8QA 1IM2A 2I34A 4ZAFA 2XMGA 3P45A 3QWBA 3JSAA 4RSHA 4CMEC 1ENOA 5A4KA 4KBGA 4R6XA 2O57A 3IH5A 3L9WA 2I2DA 4Q4AA 1Z2CA 2C5HA 2VHYA 1XXLA 5TLSA 3UZUA 4EHLA 1C29B 1G7TA 3PUXA 1ZBQA 5JAIA 3FLBA 3X1WA 5KKNB 2II6A 3WGHA 2VYVA 2X7JA 1A5TA 3R09A 1ISHA 3FF1A 3AEKA 5TY0A 1M0EA 3EDRA 4Q3CA 2YXPX 1N5MA 3EGCA 4LBWA 1BWSA 4GNRA 5CH3A 1AB5A 1G8HA 3TB6A 4ZZ0A 3LC2O 3VQTA 1ZD3A 3HYNA 3IMEA 4EGFA 4ESHA 2X9GA 5CCXA 3ES9A 3DQPA 4E5UA 4BN4A 3QVGA 4R81A 2VPZA 3A37A 3GNLA 3NORA 1DCFA 2SCUA 1ZX1A 4FILA 1OBCA 1EQ2A 5H83A 5TMEA 3VJKA 4JV5B 1ZP6A 3RS5A 3EK2A 3BMOA 2PKYX 2BFWA 3U9TA 3R2JA 3RSOA 2PKQP 3PXAA 4I4TB 3C70A 1I30A 1ZXBA 2PO5A 1RJ9A 2H1LA 2O07A 1YTLA 2JAHA 3E18A 1AUVA 1CUVA 3IIKA 3OJOA 1Z62A 4YK7A 5B37A 1JW9B 3SLRA 3UANA 3W4JA 3WYFA 2Q6TA 1XLTA 2V9PA 2XNDD 2N42A 4FX5A 3U4QA 1GT91 5DBIA 1SAYA 2GZ2A 3L0SA 3MB5A 3L7CA 5DXFA 4ZTUB 1DC5A 2XR1A 3P19A 4A6PA 1DADA 3GLFE 5HIAA 4X1KB 2LKDA 4LCJA 1XGKA 3BM5A 5EKDA 3R9IA 1MJ5A 4PTLA 1GQFA 2XCQA 4EO7A 2JK0A 3N2IA 1A9XA 1SG6A 4XIGS 3A2KA 4ROSA 2PEZA 1JHYA 3WKBA 4YRQA 3GXBA 4CKBB 3DDNA 3HRKA 2P9QA 2EJCA 3GLIB 1QQAA 1QPGA 4QUJA 3UK6A 4XVCA 3I01A 1EVKA 2I3AA 4MUIA 5DBHX 4BN0A 3K4PA 4WXRA 3AUUA 1UC4B 3QGMA 2PG3A 2RHBA 2YXEA 3DEJA 4BWGA 3KOMA 2N75A 2RK3A 3BXGA 4DS3A 1E1LA 1ADCA 2GKSA 2JKVA 1QGAA 2CJXA 3AKCA 1PGJA 2CT8A 1HH4A 1JG3A 3AM5A 4G4IA 2V5VA 3VZBA 4AFNA 5AVZA 2C3YA 2VP5A 5JBQA 3ZVMA 1VYVA 1YIAA 4OIFA 2ZE5A 2X3YA 3ESBA 3G5LA 3L04A 1GKUB 5DSZA 3AEYA 5HQ3B 5TQ0B 3SSMA 1OYWA 2WIAA 3GRKA 3LCCA 4CBVA 4N7RA 5BR8B 4K28A 2CL7X 3CNHA 2UXCB 2GZ1A 4BCCA 3THXB 2O5CA 2IDMA 4DR7B 1O9GA 1JN0A 2RK6A 4C3OB 1MTZA 3OOJA 4HVAA 3RAGA 1F48A 1EFAA 1U5CA 1XA4A 1NVDA 2I29A 2HHJA 3LX6A 4MZXA 4OCZA 4Q1VA 5FEMA 2JFBA 2EW2A 5BVHA 2G4CA 1N6LA 2YOFA 4ZGGA 1AQNA 3T1NA 3OWOA 1G1AA 1S2DA 2ECQA 2REQB 3GPDG 4R54A 5EGSA 2FPWA 4ARVA 2YNMC 3IERA 1SQGA 3SSNA 1F8UA 3BSSA 2X8BA 4BCBA 1VPDA 3S2IA 4NE7A 2VJYA 3IUBA 3BK1A 4O4HF 3A1DA 3VTAA 2HMUA 5GIPE 3PJFA 4LYYA 3MWYW 2XE6A 2AQIA 3I42A 3OFVA 4JJ6A 1GTG1 1A5AB 2X5KO 4JXKA 4UHHA 4XXHA 1B0ZA 4EFMA 5JRDS 4FS8A 1V5EA 3KDAA 4Q4JA 4F3NA 2NAPA 3LRTA 3SJBA 4D9EA 4EG4A 4NMMA 1G8FA 2FCAA 3QXCA 1W4LA 2WJAA 4HEA6 3DFMA 5EXDA 5CLIA 3GBPA 2CUKA 1KNQA 2PD3A 3UMRA 2HNAA 5EJ8A 4BL5A 1PQUA 5DF1A 2F3SA 2VRBA 1DKOA 3SHOA 1R18A 1RXCA 1KHTA 3AESB 5FBZA 1I5OA 3QYAA 2G6BA 2IHVA 1P1FA 2OC9A 5CITA 2EF1A 3AHJA 3ZX5A 1O77A 2OBFA 3PKIA 4MQUA 4RGQA 3RIMA 2DQSA 2HLDA 2O50A 4ZI2A 2E4XA 5G3ZA 3C14C 3M6XA 3QWFA 3W1VA 1AG9A 1ZYUA 3S4YA 4BB5A 4FMDF 4D9MA 1EVYA 4C9BA 1W4BA 3U4MA 1DAKA 4Q9IA 4DLUA 1LGYA 3ZXYA 2GBGA 3VPSA 3NYQA 1WZIA 4PAGA 3QI7A 5ALNA 2R8PA 2P68A 4RXMA 3LS2A 4YDQA 1YQTA 2IPNA 4J2TA 4LZZA 4ISBA 3KK0A 3LP6A 3GJ5A 3L84A 1BFKA 1QHHA 3IAHA 3V4PB 4JB2A 1BOFA 1QNFA 5IT9A 2GXSA 3JVVA 5CRIA 3DBHA 4I8IA 3F49S 1QZUA 2WD8A 3TTXA 4E7OA 4H15A 4IG4A 2FN3A 2WUWE 4RPLA 3TK1A 2HRQA 5U9CA 2Q4EA 2JANA 4QM7A 3N2GB 4G6ZA 1HYHA 2H1HA 2PFGA 5KJEA 3WYCA 2GYUA 2ORWA 4TV8A 3QUCA 2CV2A 3WK4A 5F78A 1SG9A 3KEFA 3WP1B 3A1VA 1RADA 3HFJA 4OOFA 1R6DA 2FLVA 2J7PD 1ZC4A 3ASYA 4BFZA 4JI2B 4D9BA 3RYFB 4KJXA 5AJZA 1J56A 3EQ8A 1SBZA 3OBIA 3WK5A 1OBHA 2R8YA 4DLWA 3GP8A 2GRJA 3DLIA 1U7ZA 4B3JA 5IKXA 2QT1A 2YV1A 4G4GA 1RJGA 3WB0A 5I6DA 2IYXA 3JYNA 2IKQA 5T6MA 1TCUA 1HDIA 1UBLS 1QRUA 4PXAA 2AHRA 4JHLA 1NLYA 1OFIA 3OCZA 4OHUA 4CHGA 1CERA 1CW2B 2ASVA 2KW5A 3H0CA 2VAPA 3PT9A 1ANKA 1XMIA 2YQ5A 3KKLA 2VHUA 4J0DA 4LXTA 4Z49A 1XVAA 5K6RA 2OV2A 1V1MA 2WF5A 2QVLA 4JQSA 5EERA 5LZ9A 1XNRB 4ZOQI 1NRXA 1DRKA 1E61A 4CV1A 1JR3D 4I50A 4X93A 5EUMA 4O8CA 4E13A 5B57C 4B4VA 1J9EA 2QLJA 4YFVA 1L8AA 1PBNA 3I5UA 1KY2A 3MOGA 3OE4A 4J03A 1UANA 1IG0A 2PAFA 1WTAA 1EJ6A 4AS2A 4Q4LA 4B48A 3ZU3A 3U61B 2F1RA 1M6YA 3FGPA 1DBRA 2YYSA 1KP2A 4H7EA 4WV3A 4DJAA 1MN6A 1Q1AA 4LN1A 4P7JA 4ZI7A 4OHOA 4BECA 5D7BA 1C0EA 2BSAA 4WCDA 5TVKA 2GF9A 3CN9A 3FAZA 5H82A 2Q7DA 5A5GA 3W5IA 4DIBA 2BUBA 5DI3A 2FPUA 4F5ZA 4URFA 2ASEA 1YB6A 2FV8A 2RD2A 3QMVA 3OMLA 2R65A 3NDJA 4Q1AA 2V4UA 4QDXA 1NMZA 1JHZA 1KKMA 3PUYA 4L5CA 1T6NA 5L4SA 2VZ0A 4PHTA 1GLGA 2CXXA 4EJFA 4AJPA 3D4LA 4TVSA 2P0AA 2B1IA 1DP4A 4TTSA 4AJEA 5K99A 1NSYA 4WBSA 5EP3A 4IOLA 4DA4A 3GN1A 3N8HA 4QOJA 3T5DA 3EZGA 4O3FA 1G63A 4HBZA 1IM8A 4KX3A 5E3IA 3W04A 1SCNE 4IMIB 1QK3A 2AOXA 4LDNA 5ALMA 4U5XA 2XZOA 3K92A 3ACCA 4C05A 1DBPA 2AI1A 4LBYA 5ITSA 4A03A 5B36A 3WHLA 1MABA 1UMBA 2AJCA 3AEUA 1SCIA 5FBKA 1ZOOA 1LPAB 1VIMA 3TOZA 1NJ5A 1M73E 4LE0A 3ZWDA 5CIYA 1Z4LA 2P0EA 4N49A 4GLJA 3IEXA 4DV6B 4QVIA 2GVZC 2HRZA 1R27A 1JBQA 2P4SA 2Z4SA 4CEJB 2JJ8A 4URXR 4AG5A 2F3PA 3C4QA 4KMSA 3BMQB 2FSSA 2Q6KA 4GS5A 5DBEX 5KQGA 3T7AA 2AJTA 3BB4A 3LAWA 2W4IA 1EBUA 4BGEA 1H4QA 1Z0ZA 4RNCA 2G1KA 3LWBA 3MWDB 3LJKA 2QX4A 2UU9B 4B71A 3TQIA 2XNCA 1K6EA 1YFLA 3NATA 1KEEB 1MVOA 1NR5A 3CRNA 3OD5A 4MVWA 3AHGA 4JBWA 4URUR 2HN9A 3JSXA 2J7PA 3GJ0A 1MX3A 4GMHA 2EZUA 4DNOA 1ST3A 5G53C 3SEAA 3LO8A 2CNOA 1KEZA 1RQLA 4LZAA 3CH5A 4PGGA 4OKIA 4E12A 3ZD7A 1AZWA 4WLNA 3V8EA 1N33B 3BD8A 1Q0UA 4U2FA 2CLCX 3OA2A 5B30A 5K20A 1A4XA 3G0GA 4PN3A 1QTQA 3H65A 2WEKA 3K96A 5I7OA 3VV3A 2A86A 2BFEA 4YDRA 3ELUA 2AMJA 2CVFA 1BXRB 3PITA 2J0UB 4D6YA 1XWIA 3SF8B 1N3YA 3COWA 3IT2A 2QTCA 1YKFA 1T24A 3DDSA 4M0EA 1RT9A 5HK9A 4B6GA 1BE6A 3B5EA 5AK0A 4D3FA 1PKXA 4LW8A 1NN5A 4HQRA 2GFHA 1TE2A 2WMNB 2V0GA 1KKUA 3AWDA 4Y67A 5IFLA 1S6YA 4IS2A 3C3DA 3FFTA 3IE2A 3LLSA 4U2KA 4F84A 4CV0A 3ZHVA 1QUEA 4FCCA 5I7VA 3BQ9A 3OQNA 1O6BA 1DAFA 1EJ0A 3HKDB 1H1LB 1PG2A 1U5AA 1LH0A 1XTVA 1Y48E 4W9NC 3ROTA 3ZKWB 3ZNQA 5JR3A 1N5LA 4PHGA 4Q7MB 5HOQA 1DUIA 1R0ZA 2WT8A 2B7LA 3KHKA 4I1VA 5EI5A 2ZJFA 4H7IA 1GZUA 1ZKDA 4Q7KA 3E7PA 2EW1A 3KYJB 4CTMA 2EHDA 4Z7QB 3ZZ1A 2WM9B 3H6HA 3SSOA 3OJEA 2C29D 3DEZA 3OZEA 4K9NA 4YJ3F 5E38A 3VOAA 2BMWA 4FGLA 1U65A 4Y1GA 2OGUA 4MWTA 2R8ZA 3TOXA 2WT9A 4G1BA 4AECA 2Q3HA 1EVQA 2KLHA 2O8EA 1XRJA 3N2LA 2PSHA 3OCJA 4JENA 3F4BA 4OA5A 4OHBA 2KSQA 4LVCA 5I7SA 3OEED 4IX9A 1UIRA 2DZDA 1D2EA 1IXYA 3MD0A 3AX6A 1M54A 2UYHA 1SQSA 3ZY6A 4R9RA 1IN7A 4AYWA 1W34A 1BGWA 1P4HA 1RJDA 1YR1A 3JWEA 4YJGA 1JIXA 3LQ4A 2QIOA