3E58A

Crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
MVEAIIFDMDGVLFDTEKYYYDRRASFLGQKGISIDHLPPSFFIGGNTKQVWENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELIFPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGIAAGVAADVEVWAIRDNEFGMDQSAAKGLLDSLTDVLDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Beta-phosphoglucomutase
publication title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Isomerase
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3e58A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e58A01
1RMTA 1YNSA 5AM3A 4UMEA 5AKEA 2GO7A 2G1AA 3SF0A 5AKKA 2OBBA 2GFHA 1LTQA 4GXTA 2HF2A 2ODAA 4NV0A 2Q4RA 2WF8A 3WKBA 2ZOSA 2EARA 5ALQA 3OTQA 1Y8AA 4E88A 3U26A 1J8DA 3M1YA 2EAUA 3NRJA 2B1RA 2JGAA 4BNDA 4IFTA 4RETA 4H1WA 1L8OA 3BWVA 2JAUA 2I7DA 3NASA 1QQ6A 2YJ4A 4UMDA 4OFZA 2AMYA 1U2SA 1EK1A 5ALKA 3E8MA 1U7OA 3KOOA 2CFSA 2RBKA 1K1EA 5ALYA 3E81A 4BNDB 5AKYA 2YMQA 4YCMA 5AESA 3WK6A 1ZJJA 2HEGA 3A1CA 4Y2VA 4PNHA 3QX7A 2R8YA 3WKCA 5AVXA 5AKZA 2QYHA 2YJ3A 5AW5A 4UASA 2C4NA 2C88A 3MPOA 3W5BA 1LVHA 5ALGA 4UMFA 3WK8A 4UU1A 2B1QA 3E84A 2YN4A 1RMQA 3UMGA 1QQ7A 3I1YA 1QQ5A 2JARA 3OCZA 1T5TA 1RDFA 1S2OA 3I28A 2GMWA 5AVWA 1WR8A 4DCCA 3QNMA 4XE5A 4Y2SA 2OYCA 3WGVA 2I34A 3W5AA 2RARA 2HDOA 2BDEA 5ALIA 5ALSA 1L7PA 2O9JA 4Y3UA 1F5SA 5ALWA 5AW9A 3QUQA 2HCFA 3QUBA 1WZCA 4C4TA 1Z4IA 2GHTA 1RC8A 4XQ0A 4CF3A 1ZRMA 2NYVA 4BYGA 4KYTA 1PW5A 5AW3A 4AS3A 2BY4A 1SWWA 5AK3A 3U13A 1ZD4A 4XPZA 4YGYA 1RRCA 5AKLA 1YDFA 2WF6A 4Y2RA 3EF1A 5FP0A 3WK7A 3ED5A 1YJ5A 2WFAA 3QUCA 1Z5GA 4O8CA 3QU2A 5AKGA 4I9GA 4Y2PA 3QYPA 2YJ6A 2P69A 4C4SA 1RLOA 2MU1A 4L6AA 5ALDA 1L7NA 3HYCA 4Y2XA 5E0OA 4BBJA 2IA5A 3TLMA 5AW7A 4UAUA 2Q4TA 4DWOA 2FUEA 3L0BA 3P96A 3QXGA 3I76A 4Y2TA 1N9KA 3L8HA 3DNPA 4F71A 5AM1A 2AH5A 4YH1A 5AVUA 2I55A 5AM0A 3L5KA 3M9LA 2B0CA 2G09A 1RLMA 3FPBA 3L8EA 3N28A 1J97A 5AW8A 5AW6A 1WVIA 2PQ0A 4L6CA 3WKAA 4UMVA 5AI5A 3WK9A 4F72A 4ZEXA 3DV9A 2QLTA 4YIKA 5AW1A 1QH9A 2YMPA 3UMBA 2CN1A 3EF0A 1Z4KA 3B8EA 1T9ZA 4CNQA 3L7YA 2C8LA 3L8GA 5AW2A 4I9FA 3UM9A 5AK4A 5ALHA 2HSZA 5A3SA 3SMVA 2YMLA 2P9JA 5AVZA 3MMZA 4OHFA 3SHQA 2YMMA 3PDWA 3L8FA 3CZ4A 2ZBGA 3RF6A 1L7OA 3A1DA 3SLRA 3OCYA 4MUMA 1YS9A 4NAVA 2WF9A 5ALZA 5AVSA 2G08A 4AS2A 2HX1A 2OA0A 3EPRA 2W4MA 2RB5A 1VJ5A 2Q5EA 3ZX4A 3AR3A 2IYEA 3CNHA 1ZD3A 4ZEWA 5ALRA 1Z88A 5ALOA 5AIBA 3R9KA 2C9MA 4NFLA 4DW8A 4EX6A 2R8ZA 4EELA 1VJRA 1RQNA 5AI6A 3I6BA 1KYTA 3NUQA 3R4CA 2X4DA 5IT0A 2HF7A 3KC2A 4QJBA 4YCLA 4BEVA 3AR5A 5AVQA 2ZBFA 3EWIA 3FGOA 4EEKA 3IB6A 5ALLA 3AR9A 4JDPA 2WM8A 3OCWA 1O08A 1Z4LA 2IOFA 3OCXA 3IJ5A 4BX0A 3ZI4A 4CF4A 1ZOLA 3DDHA 3F9RA 2I33A 4HGPA 5ALPA 4B6JA 2ZG6A 4OCZA 5AHXA 4MWOA 1Z4OA 3QLEA 3U7FB 4Y2QA 3U19A 3B9BA 3UMCA 3J7TA 3ESQA 3E58A 2IOFK 5AM4A 3AR8A 3L0YA 3MN1A 1Z4QA 3U7GA 5A3QA 4AP9A 3FPSA 2ZBEA 1RKVA 5ALJA 1TJ5A 2WF7A 2G80A 3ZVNA 3KZXA 5IT4A 3N07A 3WKDA 2R8EA 5JJBA 3FVVA 2HHLA 2AUTA 3QU9A 4J03A 1NRWA 3KDPA 3OCUA 5AVYA 4DFDA 3AR6A 3VAYA 1XP5A 1XPJA 1U2TA 3WGUA 4KNWA 3PGVA 4KX5A 4RESA 1JUDA 2HI0A 4BX3A 5T41A 5A3RA 2FDRA 5AKIA 2WF5A 4NWIA 3S6JA 4FYPA 1U02A 2P27A 4HGQA 4OD0A 3ZU6A 1RKUA 5AI8A 4Y2UA 1Z5UA 5AVVA 3N1UA 1TJ3A 2NO5A 2I6XA 4NABA 1RPZA 4FFDA 3KD3A 4UAVA 2OM6A 4HYTA 3IRUA 2I54A 4XOUA 2R8XA 4EENA 4KN8A 2FPRA 3W5CA 5AKXA 3PCTA 3PGLA 4GIBA 3DAOA 2B8EA 1ZD2P 3ZTWA 5AM2A 1Z4JA 2CFRA 3NANA 2G0AA 1TE2A 1AQ6A 4G9BA 4KX3A 2ZBDA 3ET5A 4HGOA 1YV9A 1XVIA 3KBBA 2YJ5A 4UARA 1Z4PX 2B30A 1N8NA 2FPWA 3L1VA 1Z4MA 1QYIA 2D2VA 2CFTA 2ZXEA 3ESRA 5ALXA 3L0CA 3FZQA 4EZEA 3AR7A 5AI0A 3NIWA 1SWVA 4BEWA 5ALFA 5IS2A 1L7MA 3SKXA 3K1ZA 5AW0A 5AICA 3GYGA 1SU4A 2FPXA 4QQFA 4FE3A 3OPXA 2FI1A 2AGVA 2FPSA 2JAWA 2YY6A 3AR2A 4CE6A 5ALNA 1T5SA 2P11A 5ALVA 4YIHA 2B82A 2DQSA 3NAMA 4L57A 3RFUA 5AIAA 1NNLA 3QGMA 4HGRA 2FPUA 1L8LA 3WK4A 5AK5A 1VFPA 2BDUA 2FUCA 4UW9A 3ZVMA 3L1UA 2WHEA 3ZUPA 5AKHA 3ZWDA 3BA6A 1S8OA 3W5DA 1ZD5A 5ALMA 3B9RA 3OCVA 2G06A 4HGNA 1FEZA 1ZRNA 1Q91A 4BX2A 2C8KA 2JAOA 2YFYA 3ZTYA 3ONNA 4JB3A 2RAVA 1Z4NA 3ZVLA 5AVTA 4C4RA 2B8JA 4BKMA 1NF2A 5ALEA 2W11A 5AI9A 3A3YA 4UM5A 3N5KA 2MU2A 1TA0A 3QU5A 2HOQA 3R09A 3NALA 5AM5A 5AW4A 3SD7A 1WPGA 2GHQA 1RKQA 2IOHA 2PKEA 3AR4A 4KNVA 3ZWKA 4IG4A 1Q92A 1O03A 3ET4A 1ZS9A 2MSNA 3ZW7A 4Y2JA 4Y2YA 4UM7A 1CR6A 4J2TA 5AVRA 2FEAA 3QU4A 2EATA 3U7EB 4CF5A 2O2XA 1X42A 1MH9A 2YBDA 1RQLA 5ALUA 1RLTA 5ALTA 3ZX5A 4ZEVA 3FM9A 1TJ4A 3U7HB 2G07A 3QUTA 2VKQA 4EX7A 3MC1A 1EK2A 5AI4A 4UATA 5AK6A 2HO4A 2NO4A 5AKJA 3D6JA 2W43A 1IWOA 3QU7A 1RMYA 4YCNA 3WK5A 3SKYA 3HLTA 1YMQA 2PR7A 4G63A 4UU0A 3A1EA 1CQZA 3N8GA 4HAIA 1L6RA 1U7PA 3WKEA
chains in the Genus database with same CATH superfamily
1RMTA 4TV9B 2ZWVA 4GWKA 3AU6A 2C5BA 1R0WA 2VJMB 4HRYA 3KYCB 1NT2A 1NJ8A 1XDBA 3FCUB 3L0OA 2O5EA 3QJYA 2HRDA 1C4WA 2PKQP 2AOTA 2H3IA 1CUHA 2X9GA 5HR6A 2ZUWA 3EISA 3DFZA 3LX4A 3NDPA 4UBCA 3PP8A 4P3KA 3G2KA 4HYKA 1JQJC 1P9WA 4DA7A 2Q4RA 1WEHA 5CNJA 3RODA 1S3SA 4H7HA 4KXWA 3H0RB 3BERA 3LPDA 3EPHA 3OJFA 3OTQA 1S77D 3DMDA 4B3GA 3CPSA 4GPIB 3R0XA 5EJ5A 4YP0A 4MLPA 5EIEA 3ADCA 1NQAO 3NH9A 3V1UA 5DGBA 4BNDA 4H1WA 4KK4A 1PW7A 5JXWA 4Q3OA 1E3EA 3PX2A 1SVWA 2Q8QA 2IWHA 3SYMA 3CISA 3AUTA 3N6RA 4S05A 1CEXA 4A15A 4DR4B 1PK8A 1VP3A 1ZESA 3NASA 2ASLA 2GD6A 2ZWOA 4YUZA 4JJ6A 2YJ4A 2Y1KA 4RZXA 1RXIA 4PANA 3SFTA 1JR3E 4EPRA 2A1JA 1GPNA 2F9LA 1DQRA 1E63A 2PSJA 2XRZA 4B8WA 4US2R 2NRWA 1RYEA 3F74A 3MBOA 2X14A 2H4YA 3HTXA 3O92A 7ICTA 1U94A 4FZMA 2CW5A 2PTGA 4LHWA 4RY2A 1ZN2A 4YBZA 2HMVA 1KMHB 1CG6A 3GN2A 5ALYA 1BJRE 1DADA 1ZHOA 3C70A 3IEUA 5DXAA 2LHTA 4B47A 4DG9A 3D59A 4FGWA 1H4TA 2GJ4A 3F5FA 3NHBA 4MK4A 3TKAA 3M49A 4RHYA 4WINA 2F8LA 3BRQA 2XZOA 2VPTA 3RAFC 3DOJA 4CN9A 2QYHA 3HWSA 4HEA6 5DYWA 3V4LA 4B3BA 1WMSA 3EXIA 4R9NA 4AKEA 4H59A 2BH2A 1K92A 2XPCA 4O2BB 3UWPA 4FR5A 2GK7A 2WUEA 4XYGA 3NS1A 5C35A 4KOAA 5JNRA 4KXUA 4HDNB 3HC7A 5K7SA 2R6AA 5D3QA 2LBPA 2PEZA 3ONVA 3PCXA 4PFSA 4BMCA 4OL0A 3TSOA 2BHTA 3TG8A 1M33A 3B2NA 3LGAA 3PUKA 3ABQB 5FNVB 3SYTA 4LS3A 4GWGA 3VNBA 2R9VA 1N6LA 2VOJA 5BNIA 3UPUA 4LHEA 1RFLA 2JBWA 1S0OA 3RJHA 3ABOB 1Z22A 1GUDA 9ICPA 3PJEA 4QQKA 3V46A 2D6FA 1U11A 2DY0A 2V97A 2YXEA 2ZR7A 4BWYA 3OKCA 4R63A 2BMWA 2YV5A 3OHMA 3AY6A 2AR9A 2Z5VA 3CX4A 2YB4A 5IASA 1OYOA 3B48A 2NVUB 2IGTA 3CRXA 3S8YA 2QE6A 3L1IA 2P9GA 4YUVA 1YT3A 4O3MA 4NCXA 3RR2A 1WWVA 1K27A 3M89A 2Q41A 3D2AA 4TRJA 1C3OA 2K8CB 4BKPA 3BKWA 4ZYVA 2FSVC 1ESNA 1M1NA 1F5SA 2F48A 3C2QA 3WYBA 4YAWA 5FEUA 4IOMA 5BV0A 2ZIGA 3UFBA 3G82C 3QHAA 4INJA 3C29A 2GHIA 2PT5A 4Y9UA 3JPNA 4ZRNA 3K92A 1OV4A 1R0ZA 2RHFA 2CXHA 2J6TA 3RSFA 3O2NA 3RS0A 1Q5PA 1SOMA 3OSZA 3WYCA 3M82A 3TMYA 4BYGA 4QTYA 1YDMA 1Y6QA 3V7JA 2J5BA 3ER6A 1Z2AA 5BP7A 3QVXA 4RIFA 2D1RA 5FOUA 1PGNA 3UHFA 1UJ6A 1VBFA 4HWOA 4XPZA 4F1WA 1M5UA 3A6JA 5DEOA 4RHCA 2ONYA 3UXOA 3FGPA 4MPRA 1SIWA 3PQ6A 1NKEA 1ECBA 2Z4SA 5CAEA 1I2BA 2F8KA 2F1JA 3CGWA 4FQ7A 4JOQA 4RA9B 3UIEA 1OBFO 3AEUB 5L4SA 1CJSA 1LZLA 3NIFB 3UENA 4DR7B 1G2OA 3A6HA 1RYZA 2EGHA 1KRPA 4D2IA 2XUJA 4M2YA 4H7FA 3DOOA 1M2JA 2UVPB 4J94A 4KLRA 4MVYA 4YI3A 4F4JA 3QY9A 3HG7A 3JZDA 3AN1A 2HKIA 3VOBA 1M6VA 3T4PA 3AHHA 3PQEA 3KYCA 4I1IA 2JPDA 2M1ZA 3VI3B 3GLVA 1AV7A 4JL8A 3ASZA 4MR9A 3UH1A 1ZVJA 3RAGA 3RASA 1II8B 1PKEA 2Q4TA 2PS1A 3C39A 1BROA 4FVTA 3L7OA 4MUAA 3VTAA 2R1TA 3EIWA 2FUEA 3L7DA 1SCBA 4H31A 1SBHA 4EGFA 1E2HA 3TEMA 3OEED 4ZAGA 5CRXA 4C0BA 1HT0A 3O0FA 3EC7A 2VH1A 2GEVA 4F8YA 5A4FS 4M1SA 2XIJA 2A1UB 5DDMA 1PFUA 3I30X 5AVUA 1XVLA 2W2VA 3BS4A 1AKNA 1TVCA 1ZM2A 1ZN8A 4WXMA 1VMIA 1LI5A 4QUEA 3L8EA 5AW8A 3GDGA 1XDUA 1XVUA 4JOSA 1O97C 4P83A 3WKAA 4RGVA 2R47A 3TLCA 1OV6A 2ZTVA 4AL4A 2K87A 1NF8A 5BQXA 3FTEA 1E4VA 4GPEA 2XDQB 1T4BA 4ENVA 5KZMB 3EDMA 5J2UB 3WBFA 3U56A 3A4IA 3CEMA 2ZTUA 2FSPA 1CQIA 3NGLA 1QH9A 4CLEA 5K99A 4KI7A 4RUCA 3DYIA 3JQBC 3OFSA 2ZUVA 4LZWA 4I2GA 4O3QA 1HOTA 1WY7A 1LDBA 1LDMA 1N0IA 4QJIA 1PTJC 4KPUA 3SC2A 2B4YA 1KP2A 1S4MA 1TGVA 1WKVA 2XT6A 5CTAA 4JV0A 3JPRA 1P62B 2R97A 1DHTA 2NIPA 2OXTA 1S0VA 1QR6A 2GJKA 2G04A 4MCIA 2JDIA 4KW7A 5E2IA 4FZRA 2RGEA 1W5AA 4DIEA 1W8IA 2V55B 3BZWA 2LD4A 2DT8A 3NTVA 1UFRA 3WGNA 2PANA 4CR7A 2V98A 1SBQA 1UM9A 5K6TA 4PGHA 1ST3A 3LPLA 1BX0A 2FETA 3A1DA 4WZAA 2GEJA 4Q19A 3IBYA 1Z37A 4MKRA 1UPXA 4IQ8A 3LYSA 1XCMA 2OYSA 3AONB 5CG2A 4BQFA 2YY5A 1PD0A 1ND6A 1DUVG 4YMOA 1KMCA 4K46A 4D97A 1IHYA 2IDMA 4KQGA 3C23A 1NUTA 2ZATA 4M0KA 4D3XA 5JAQA 4DL2A 3G2OA 1UBKS 1YRAA 1XZLA 2PJZA 2BVNA 3AR3A 4REMA 2RHWA 3U7JA 1KHTA 1KC3A 1YULA 5KFBA 3QK7A 1CZOA 4K4HA 4S3MA 5DO9A 2VFAA 5C5EA 4GI2A 3GROA 4TSRA 3ECSA 1MTZA 3KEMA 4WOCA 3EGOA 3ZWVA 4GPTA 4B3DA 2GHRA 2LCIA 5HQ3B 2NXNA 3IT2A 2JLUA 5DTJA 1S8FA 1U99A 1VL5A 3RJEA 1NPTO 3H0MB 2JFFA 3FHOA 3NB0A 1CRQA 2KZMA 2GXAA 3DMPA 1STOA 1PK1A 1LRLA 1PT8A 3ALRA 1JEEA 1VCIA 3I64A 3C97A 1QUEA 2CXXA 2EYUA 3HZHA 4YXMA 3T0IA 4WK2B 2C82A 3QUAA 1DCMA 4NG5A 2J67A 4TXMA 4ZRDA 3H9BA 3PL1A 5FUMA 1BEUB 1CLEA 5ALLA 1QO7A 3AR9A 3TE6A 2CDRA 1S0MA 2W2TA 3HYSA 3PW4A 1UH5A 4PGAA 1LDEA 1DHRA 3T0FA 2VT3A 5C37A 1CNEA 2QU7A 4IHJA 4K6OA 5JMOA 5JYEA 4D26A 1WWUA 4M60A 5CUQA 1XD9A 1ZOLA 2KLBA 1UM9B 1T2AA 2O8VA 4FFLA 2DWOA 3Q7IA 1Y4DE 2GZ2A 3EYAA 4XIFA 2O57A 2ZG6A 1JX6A 2JLQA 1XN1A 2F59A 2JFBA 3SV3A 2WSLA 3L6CA 3LZCA 4GOJA 1YI8A 4DYHA 2ZYGA 3GJSA 5E3IA 3G0HA 2CJWB 2BSAA 2YWCA 1SG9A 3AXTA 3B7PA 3LUHA 4W7IA 1DTWA 1VMDA 2IOFK 1T6NA 4LK3A 1BZYA 5FTMA 4C43A 1ESEA 4DF4A 2I76A 4LVOA 2W54A 5T4BA 3VTFA 4BP9A 5JS1A 2R0QC 1SVMA 2C2KA 2Q3BA 3TI9A 1Z0UA 2F43B 2IZ5A 2GRUA 5I3CA 3VJRA 2H4JA 2VDJA 2PRIA 3I23A 5KNBA 2PGIA 2ZJOA 3T5JA 3H8JA 1FIQA 4UDXX 5DCUA 3LT4A 5TXGA 2J8ZA 3A3PA 3L04A 1YHZA 4C07A 2AJCA 2J6BA 3HLYA 3MM4A 5JHGB 5KPDA 5J43A 3KVOA 3OU7A 1MCZA 1WB6A 3D8SA 4HZGA 4XARA 5KAPA 2D4AA 3HU5A 2ZCVA 4IDPA 4ZIRB 5BNTA 2BFWA 2ZZKA 3D7RA 4B48A 3D8NA 2VHEA 1L7EA 3RQSA 4YRIA 4GX1A 2C4WA 4EL0A 5BW8A 5CW2A 4Q5IA 3DO5A 5JJKA 3CEHA 3IH5A 2CDCA 2P9QA 2XT0A 3LFUA 4OAPA 2WWWA 1XP5A 4WDRA 5DOVA 3SQDA 3ZQ6A 5K8UA 1B8PA 1QP4A 1NV8A 1MT3A 1JJAA 2ECQA 5LYJA 1II8A 2B3TA 4ZT3A 2O3RA 3QF4B 4FOSA 2AQ4A 3ABIA 2AIRA 3FKSA 4X6YA 3C3AA 2CUNA 2UZ3A 4B74A 4ENTA 4DSAA 4IGEA 4KV7A 4MGYR 1P4HA 1R0LA 4PHFA 3C3BA 3ZHQA 4I50B 3I9MA 1TJPB 4HDKB 3Q4GA 1R8JA 4QBIA 4CM8A 1TUGA 3F0TA 2XMCA 4NMXB 2K4PA 2AYYA 4LHZA 2WT9A 1BDMA 1CERA 3TW0A 1ECLA 2GJ9A 1JG2A 2PHZA 1FVXA 3N1UA 4FQ8A 4HDRB 4JBYA 4I4IA 4JP3A 5KFKA 4AF7A 3C3EA 4AO6A 1ZICA 1PGOA 1NP7A 3DBHB 4KACA 4MUJA 5CAEB 2VK8A 4OJMX 2LVBA 4M7RA 1BDHA 1QRRA 4UAVA 3ZQKA 1XRSB 3IRUA 3D2BA 1R64A 4XOUA 4Y9SA 2AT1A 5DM0A 2QM3A 4BVBA 4M9XA 1U0TA 1YBVA 4GO1A 4QTZA 5DXJA 3VZDA 4ARCA 4DIKA 3TN7A 5AM2A 4ZICA 1XVTA 4L8WB 4DF3A 5BUQA 1DJMA 2A94A 1T3LA 2Z3WA 3BE8A 3UXPA 4EYEA 4WKGA 2QQ5A 2ZBDA 2YV3A 3R44A 1H5UA 1ZNZA 4OI2A 4M4SA 2H5LA 2GZAA 3QX9A 2PX3A 1DS6A 3QH4A 2FK8A 1Y5LA 2IRWA 1Y89A 1GSIA 3JAWB 3T7DA 1LC3A 1A1SA 3CRVA 3PVCA 4JBGA 4XVCA 2HM7A 2J3KA 3OPQA 1L5SA 4NLKA 2ZSAA 5FFMA 1TZMA 1NOIA 2DR0A 2RHBA 3LQQA 1SPBS 2D1QA 3G0DA 3D2LA 4FB4A 1DG9A 1O96A 4GX2A 3JXEA 3C8MA 2CZCA 4K8RB 2Y66A 3AR7A 1ZYQA 1Y81A 3GCXA 3HXLA 2GTIA 3PHGA 4HC4A 3DT6A 2UZ1B 2XXJA 4P4GA 2AWOA 4RTMA 3IBSA 1JQ3A 3R0ZA 4GC6A 2DHRA 3HWX1 4OGWA 3HJFA 1DC6A 2D6FC 3S1LA 1AKTA 1GL3A 3IXQA 5BQPA 1PL7A 4AIIA 3PRJA 4C78A 4RVCA 4FK8A 1PL6A 4G4GA 4DIOA 1E3TA 2G83A 3IDZA 3E0QA 3DV2A 3HUTA 2BH9A 2G9ZA 2HUNA 1EDBA 1R6BX 2VDKB 4JLUA 5DM4A 5KTRA 3OKFA 5CG1A 1TADA 2IFTA 4TTIA 4N18A 5LUBA 1DG1G 3G6VA 1V95A 1ZAKA 3C1YA 4GMGA 3ZE8A 4YV7A 2OBNA 1T5SA 3C3KA 3G5MA 2XXAB 1MZPA 1C81A 3A9WA 3PQ3A 4NIMA 4O4JB 4D81A 5TQ2A 3I5XA 4UTPA 2O0JA 4GZ5A 1L8LA 3WLHA 1QTMA 4ZOAA 3ZWPA 1HDXA 3PUZA 5T7BA 2AOXA 5I8ZA 2NRTA 2QTMA 3SR6A 3QPVA 3IDWA 3E22B 4TLLB 4E2FA 4EY6A 2YFQA 3AVTA 2ENWA 2GN8A 3HVUA 5HE9A 1HV8A 1MHTA 1X3SA 4CDRA 4HNQA 1XEWY 4ALMA 4RQMA 5KMGA 3D3WB 3VKGA 3KQQA 4RJIA 2JIPA 3SK0A 3PC2A 4BRSA 4JJ7A 4HQKA 3KPUA 1LRKA 3VVBA 1AQYA 3E15A 1XBTA 5EZ5A 5A2GA 4UUQA 3L6BA 3G0CA 3GV8B 3WYEA 3JR3A 4PLTA 4DLKA 2W0SA 2IT1A 4LC0A 1VOTA 2B8JA 1OW3B 3AP2A 1DKRA 3OZTA 2DQNB 3PQDA 3WYGA 1S2IA 3BHNA 5B1EA 1LVGA 1FP4A 2HN9A 1HE2A 3BQMB 1G3QA 5CNMA 2Q5OA 2WLSA 5EIFA 1VYUA 4UFPA 4DDUA 4F4YA 2P90A 1KVQA 3VHXA 3ZOZA 3NALA 1WP4A 1RWWA 4H0NA 4I28A 4DL5A 2GPNA 3A7DA 3CUUA 4R7TA 5DCWA 2PMWB 3RB0A 1LJLA 3CNQS 3RHSA 4CGYA 5GONF 3RHTA 5EUQB 2HMYB 1EZZA 4JVMA 1XQXA 4EY3A 4CR8A 4EHKA 2QG6A 3GLHE 3TTWA 3FTQA 4R51A 5J1SB 3FTFA 5FNVA 2YNMA 3DAGA 4YRRA 3NV9A 4B87A 4N8EA 2GWHA 3CRW1 3TXXA 4DSTA 2XITA 2JJ2D 2B6GA 4G8BA 4N1AA 1UCVA 2OGSA 2J5KA 1YACA 4W8GA 4B7AA 4DO9A 1HSZA 1MXHA 4J2TA 2BHNA 5HKKD 4XQGA 1UINA 1Y5IA 3U7EB 4E12A 1XKLA 4FFMA 3R7WB 4JAVC 3ASYA 1PIWA 5KX5B 1FTNA 1VI2A 4LYYA 3GRFA 5ALTA 1VP9A 1Y6JA 2AD1A 4FJ0A 1GPAA 3JQBA 4YWJA 5HVNA 2DUJA 1TJNA 1DAGA 1CTQA 3V72A 1EB9A 4LJYA 3NOVA 3F73A 1NBIA 5H70A 4INOA 5BO5A 4HAWA 2QT1A 1VSTA 2PG3A 5BYAA 1E3DA 4DWIA 4W5JA 4DC9A 3LQ2A 5GVSA 1R15A 1C9DB 2ISCA 3OQMA 3SEZA 5JC8A 2OV1A 2ZTSA 2VYVA 5KG4A 5JJ5A 4IOKA 2A1JB 2HHSA 3HB5X 4DDWA 4EAAA 2D7CA 7ICOA 2K7ZA 2X8JA 4CMEA 1EQAA 1ADCA 2ODBA 4MS4A 4CEHB 4GVLA 4O1IA 4Z6EA 1Y9DA 1TEHA 3V34A 5AKEA 5H9WA 5LQKA 3HMKA 3LUCA 2Y0DA 3VR5H 1NVXQ 3STTA 1PVDA 1JDJA 2WYVA 4QPZA 3WDMA 8ATCA 2RONA 4MV6A 1ZXIA 3HDGA 4YXWA 3WL7A 1RI3A 1EWTA 1A9ZA 1CHDA 2WHXA 1GGMA 4KLMA 1OJ7A 1USGA 5H3LA 2UXCB 1H23A 4IDEA 1UJNA 3ND7A 5JT1A 3M1YA 2RHMA 3KS9A 2PLRA 4ZT6A 5ELMA 2KVCA 3PV8A 2JLCA 4UBBA 4FGSA 3LOQA 4GRAA 5G3YA 4IGAA 1QHIA 2HIMA 2VNSA 1W88B 4Z6FA 1YDEA 2VJMA 3GXBA 4UD2A 4ZQHA 3NV7A 2LIPA 4X6UA 3TPCA 4HDNA 3TRJA 4QGSA 4FO6A 3N2IA 3TLKA 4LJ7A 1VIMA 3WNBA 5CEFA 4BQSA 5LWHA 1I5OA 2GAAA 3ZHTA 1QQ6A 1V7CA 5KFQA 2G4LA 3X3HA 4B5LA 1CEZA 3DT9A 5IANA 2AMYA 3B7GA 4PZPA 1OXMA 1TQ6A 4RPKA 1SCAA 2QX6A 2IYWA 1TCVA 1LEHA 4RSHA 3W8DA 1GSOA 5D84A 3L43A 2OHXA 2EJUA 2QRVA 4IYRA 1K1EA 4LXHA 2CBZA 3WOVA 1DJPA 3N2GA 5FLKA 1UBOS 2VO1A 3CV3A 1KYIA 2AE1A 4J3FA 1JKFA 2DHDA 3PGXA 4KXLA 4RA6B 3AU2A 3E2MA 4KLCA 3NG1A 3NWPA 2X0EA 2CJYA 4XFJA 5H3CA 5BV2P 4YCMA 3RTBA 4M8SA 4CMKA 3EEIA 4KAAA 4FDUA 4EH1A 1NE7A 5DWVA 2JC3A 5KFEA 3HSKA 2R7KA 1C7YA 3AF0A 5ANRB 3MLAA 2WM9B 5F98A 4AQYB 4ZCQA 1D1QA 4YR0A 4UASA 1BMDA 3G7SA 3F47A 1IZ0A 5CH5A 1WB5A 3UPDA 4JWMA 1A2BA 5F9NA 1KI9A 1TCAA 4J0GA 3TXAA 4C4YA 4DT1B 2QBYA 9MHTA 2BCSA 3I1FA 3IHQB 1Z39A 1XQYA 4DUGA 3WK8A 5BVHA 4F11A 1ZLXA 1P3Y1 4RZ2A 4ETNA 4YT2A 5IU6A 3R9IA 1B15A 3TRDA 1LS6A 2JASA 1VKJA 1E92A 1H1LA 1UXIA 4I55F 5CWRA 5B64A 1EBUA 1CVIA 2RHDA 4ROTA 4HNGA 4QSMA 4LXYA 4TTPA 3RYHA 2IDKA 1X2BA 4IW3B 4H60A 4WOBA 2NVWA 4LOLA 2C5FA 3THWA 3PCRB 1XC9A 2QDXA 4JS0A 2Q1YA 3ROZA 1ILEA 1OXXK 3BMCA 2NADA 1T34A 3OX2A 3PUXA 4HOYA 3B1FA 3FTPA 5DYGA 4IIJF 5CP8A 5AW9A 3P0HA 4XIJA 3QVWA 3NZEA 2HCFA 1V97A 3EEYA 1P2TA 4YO7A 2YHUA 5FOWA 4IWXA 3N5CA 2JFOA 1XPOA 3OX4A 2R1VA 2XKJE 1UHUA 3PSHA 4W8HA 4JNKA 2V8BA 4IIEA 3AM9A 4F3RA 5LMZA 1EI9A 2QVZX 4FOTA 3EIQA 1X14A 4O33A 5E7QA 3H11B 3VPCA 4U6PA 1IL0A 2ZU0C 5K3OA 4DLLA 2BFEB 3K2IA 2XD4A 2EAMA 1AF4A 3PYLA 1G8FA 3IUEA 1XZNA 3IN5A 4NECA 3ORRA 2SKCA 4MUXA 1D9XA 1QUFA 4Y6PA 1G6HA 1SXQA 2M6LA 1KEPA 2NXEA 1MC8A 1XTUA 1TC1A 1IONA 1OH7A 4WXYB 5KNCH 4HO1X 5DYIA 3VKWA 1Y6FA 3RJ9A 1KQNA 1BVSA 4X7PA 5AKGA 1GT91 4EK9A 5KWIA 2KFZA 3VR2D 4Y2PA 3GH3A 3V1LA 3QYPA 3MNFA 1OC2A 3Q85A 4N6GA 4K9DA 2IU4A 4PWYA 3I05A 4PGQA 2MU1A 1Y7LA 2PZMA 4UAGA 1L5LA 4BJ1A 4B76A 4YCCA 4K4GA 5J4VA 5I9LA 2ZIZA 2GETA 2D3TA 1AUQA 2HJHA 4Z9BA 4YMHA 5KJ1A 4B79A 5L95A 1YKSA 3OT1A 5AW7A 2OFFA 5CA1B 2UKDA 1QZUA 2VAWA 3JQAA 1LPPA 4CUJA 4ER5A 4GYJA 5J8YC 2D8AA 3O73A 3R0JA 4NV1A 5F64A 2VJNA 3F1KA 2PSDA 4CIAA 4L5AA 1OAKA 4MEXA 2FN3A 2GQ0A 2OSVA 3H9JA 4LJXA 2VXCA 3IP1A 2E1PA 4Z0HO 4P31A 3FSRA 4H9GA 2JEJA 1RLMA 1RFGE 2DX7A 2QI9F 4JYBA 4V2UA 5DBOA 3TS1A 2CXTA 3Q8XB 5ADWA 2DWQA 4NR0A 3TD9A 1E5VA 1Z8FA 1N7GA 4OKNA 2GF0A 3L7IA 3PFWO 2PFGA 4IIFA 5CJJA 3RFFA 1T9KA 1JHOA 1XU7A 4X6LA 2PZEA 4XQ9A 1UP6A 3N6XA 4DLUA 3NDIA 4IKPA 4XX0B 2HOFA 1M72A 4DM7A 1PGQA 4BQIA 4GYKA 2TMDA 1SG0A 4WNYA 3E27A 3GGJA 3E2IA 1M5TA 2ADMA 2ANCA 1TK3A 3P8ZA 4FS8A 3D6MA 3A1SA 1QF9A 4YDSA 4F5RA 2F00A 4F4XA 1L7BA 4KQKA 3DPUA 1GSHA 2IUTA 3Q0TA 4OGFA 2LM1A 3KD2A 2JGJA 4MKIA 1X2EA 2OVBA 2OBFA 4QPNA 1XMVA 2JAQA 1ZIXA 2HA5A 5JNWA 1P39A 1Z9BA 4P54A 3OE7D 4QRHA 1G63A 5BOVA 1DAIA 2W55A 2WPNA 4TTJA 2NAFA 1JQEA 1ORIA 4PZOA 1QGOA 1PHRA 2YHBA 4O3SA 2OMEA 2PL5A 3KUKA 1LX7A 4UHCA 2VQDA 2BFNA 4BNZA 1L5HB 1R4ZA 2CWDA 5H80A 1VDZA 2RDJA 3S81A 4OQDA 2PH3A 3TRHA 3ZYCA 1ZD9A 4DJEC 2FMPA 3IIJA 1Y63A 3A2MA 2XUAA 1M83A 3COSA 4HDMA 4I46A 1A5AB 4K9MA 1J2NA 3SGLA 5MGNA 1OTXA 3CPJB 1GGNA 1KAQA 3QJ5A 4UEKA 2WHPA 3LE8A 2YASA 4KQ6A 1HETA 2WJGA 5JWOA 2A9QA 1SXIA 1I3KA 4RX1A 4BDPA 1VE7A 4Q16A 2F1IA 5FBRB 3OIGA 4ZT7A 1LW7A 5C46F 4WFJA 3TFSA 4C4XA 2BP7A 5DN6D 3GK3A 5K0CA 5I7AA 4BLVA 5KJCA 1Y9EA 2XA2A 2XF8A 3OA0A 1GNRA 4N41A 3H5NA 3VV2A 2GN0A 4FEGA 3CMMA 3M2TA 4H27A 5LP6F 1VA5A 5T8KC 1NZBA 4YJ3B 1JPVA 3UJHA 2EYQA 3DEZA 5JI2E 3RK4A 4RZUA 1XS9D 1WXDA 4AB1A 3DKVA 3UBTA 2A35A 2VF7A 3IAEA 3L05A 1TKCA 4K05A 1JMSA 4HN2A 3V6HA 4HTFA 5BXYA 3DE0X 2BF7A 1I2AA 5B2ZA 3U3MA 4Z3KA 4WCFC 3ETHA 1R9GA 1MAAA 1LUAA 3MJFA 2BPFA 4NCJA 4CF4A 2DBQA 4E7PA 3WBJA 3F9RA 4KDCA 2UAGA 3F7TA 3M9XA 4PXYA 2Q07A 2A5FA 1R9NA 4IS7A 4G37A 1A3CA 1GCIA 4AM8A 3N8HA 3OJXA 2EX0A 1DMSA 4Y2QA 3WLAA 4PZEA 3U7FB 3ZWWA 4NQZA 2FMTA 3IAXA 4B4KA 2RJOA 3VU9B 1S2LA 3IUMA 4J0DA 1ONOA 1BVUA 3DOIA 4YMVA 2HCTA 1JMVA 1CB7A 3M1IA 1T6ZA 5J1TB 4QLBA 4NH0A 3EZ6A 4RIEA 5KHLB 1Q7EA 4R05A 1GG9A 1PZGA 9ICIA 4G5QA 1Y8ZA 3CZPA 3FZEA 1T4GA 1DUIA 3DEKA 4QOGA 4A26A 4CMEC 4X9XA 1MQ2A 5JAOA 2VDMB 4DMHA 1BE1A 1CDOA 3IEIA 1UEJA 2JFGA 3GRPA 4GMFA 3BRCA 3EFHA 1KIAA 2VHWA 3NC0C 4XGRA 2DUYA 5F7OA 5IFLA 3G7UA 3QFSA 3SSMA 1HX7A 3GLGA 2RK6A 3PDUA 9ICCA 3CC8A 3RABA 4JT2A 4GDMA 1IBKB 4N12A 4NU6A 4JI6B 1JAYA 1NONA 2V7BA 3S2GA 4RTPA 1SGWA 4EPXA 2BKEA 1DKLA 4TL6A 1MB0A 2BCQA 2BCVA 9ICXA 5K3CA 5SY6A 5CA0B 1OKKA 4G1CA 3RU2A 1XZIA 5F7JA 3LU1A 1LPMA 1DBQA 1EYZA 3K1AA 2EQ5A 5G1OA 3U6BA 1M2GA 4KUGA 1QSGA 1OWNA 3TIFA 1P73A 2OUKA 4F2DA 5L3QB 2Y0SC 3HCBA 3KLNA 3UMSA 1J70A 2OD2A 3BOSA 4RESA 5IVHA 1SCNE 5IN4A 2XNHA 1Q0QA 5KWVA 2YV1A 5C32A 5LKRA 1YI0A 2GEFA 2ZJAA 2OXRA 3DM5A 5T41A 2ZWMA 1MXFA 4QIWC 4PQGA 3OJEA 5A9SA 3FUVA 4ZQEA 2Q49A 1HF3A 5KFDA 3DB2A 3EIEA 3GN1A 4ED0A 3EFOB 2J9XB 4UXJA 1Y3BE 3TD6A 4Y2UA 1TTPB 2WZBA 1CUUA 3NEYA 2DM6A 4Q3EA 3M6KA 4WZBB 2AN9A 5TGZA 5JDCC 4ZOQI 1A9XA 3O8RA 3IE0A 4I66A 2Y0BA 2BONA 1OWPA 1PR3A 4JYPA 4LMAA 2B37A 3K9BA 4QDXA 4ZT5A 4UB2A 4ERXA 4F84A 1ECCA 2Z3VA 4UE3S 1UIMA 3WAKA 1MOQA 4HYTA 4DLVA 2C4UA 4OA8A 1JQDA 1SVKA 1Z12A 2W58A 3AM3A 4UTOA 2KSOA 1ZNWA 1C3JA 2ZYRA 5CMLA 3N87A 1ECFA 2I9GA 2FPPA 5BVGB 5HF8A 3WHPA 2Y1OA 2X0NA 2ZYAA 3NANA 1SELA 4EZ6A 1V7ZA 3I9KA 2C9YA 5JLAA 1W2HA 1TCCA 3OIYA 5LQSA 5ICCA 4JLWA 1SKQA 4R2KA 4BIMA 1BN6A 4LE0A 2G9NA 4C0LA 4JCOA 4QOIA 3U48A 4E6EA 3QG5A 2H11A 3E9QA 5IK2A 1A5ZA 2QE7A 3KNZA 4TXHA 5A6VA 4GHWA 2B30A 2FPWA 2PKRA 4PFKA 1UMDA 3ZS8A 2ZTMA 5CR0A 1NXOA 2G40A 3FCAA 5CK4A 4J1QA 5F5LA 2X8LA 1HZZC 1C1HA 4KAFA 3NHLA 4WASA 5FPPA 3SXUA 2D2IA 1FX0B 1KI3A 3B5EA 3C3MA 3QXHA 4G2NA 2PMDA 5CNIA 1BXGA 1GCAA 2O1EA 4BEWA 4L76A 2HWKA 3KL4A 3JCZA 5KB3A 4J7CA 3VNUA 4IUYA 1NF9A 2VPXA 4Q44A 3GX1A 3I3OA 4HH4A 1Y3AA 2O7SA 5DM70 2PKXA 3BKXA 5GAJA 4K4IA 4JJGA 4C20A 2F77X 3DXYA 2FJPA 1EJ2A 4PG7A 5ADUS 1NI4A 4ZZIA 2FI1A 1D2RA 3H4IA 3O1JC 3WIEA 1T1SA 4MA5A 2BR4A 3T34A 5ES4B 4U7TB 5HKLA 1Z5ZA 3L46A 4LDZA 1W5FA 3CLTC 4CU2A 3PC8A 4BUCA 3N7SC 2XWQA 1OC4A 5LQAA 1T26A 2WWTA 4FI3F 3PNLA 2ENUA 4EL5A 3DPIA 5EPEA 3LSTA 2R5NA 1WDWB 4M9GA 3ZKWB 5IIIA 1NC1A 3KE8A 4TYPA 3W90A 2VP9A 4YMSA 1AK1A 1L3CA 1MU0A 5LBIA 2E55A 1FLAA 3GUVA 1E1LA 1XNQB 2W6PA 2OESA 3UK1A 4XIYA 2P2SA 3U4DA 5DI9A 2VL7A 3O9MA 1W34A 1IUKA 1O9HA 1UXJA 1O87A 1XJ5A 3DS8A 1R7RA 3G0OA 5DX0A 4AICA 2VWQA 4C3UA 5LSAA 4J9SA 1R74A 2H65A 1IN1A 5A0TA 5EJMA 3MJVA 3PR1A 1H38A 4ZHQA 1YU6A 5E38A 1D5CA 1ZRNA 3LLSA 1NBMA 1P19A 1ICEA 3AF4A 4RSMA 3OEYA 3W6UA 3ZTYA 4Q47A 3ZVRA 1FFWA 1VKRA 2QLJA 2UVUA 1TC2A 4YROA 1AMUA 3DFKA 1BJKA 1XC7A 1ZMXA 4W7HA 5DBHX 2MU2A 4M6WA 3QU5A 3CYFA 3RYFA 5JBIA 4KRYA 3DWEX 1B6TA 4BNWA 5I7WA 2O1WA 2DL0A 2CNLA 2MINA 3MJDA 4J0EA 4GL4A 4UPVA 4Z9XA 3P7MA 5I7EA 1A2KC 3CIFA 5KTQA 4A0RA 3TZLA 3FPEA 3W7BA 1H69A 1ZJ4A 3C6XA 4I99A 4FFWA 4CQLA 4J2HA 2W9CA 5DI3A 4EBEA 2ATEA 2JGDB 3K0EA 1EUCA 3K1JA 5EY5B 4WA7A 3W2EA 3EFOA 4L78A 1FF9A 3ET4A 2VC2B 4PE5B 2Z5GA 3EIXA 4CM4B 2Z2IA 1QM5A 1DINA 3N0VA 2RGYA 2LDXA 2ORED 1NMXA 2ZYIA 4A8EA 3QIVA 1ZJNA 2BMFA 3H0KA 5BWBA 2V7UA 3FUXA 2D7JA 3O1IC 5TMEA 2CXOA 4OJTA 3TDKA 3ZNNA 4CQJA 5IUJC 5JH7B 2D54A 5IK2D 3F49S 4FBGA 5EHQA 2GA8A 2HMXA 5FO1A 3KP1A 2ST1A 4CF5A 1CNFA 4V0KA 1NX6A 2E1RA 3M6AA 2QW0X 3MMSA 4EG7A 5KAFU 4FMCF 1M2WA 2AQHA 3LD9A 1XCLA 4ED8A 3W2HA 1JBEA 1D1SA 4LGVA 3FM9A 3H3JA 1P31A 4KG7A 1C9MA 1CHNA 4NCKA 1AQIA 3NTXA 3PK0A 2KLHA 2I2XB 3U39A 3A6FA 5J3JA 4AJPA 1M34B 1V16A 3ZU5A 5K8VA 5AKJA 4NAUA 3P4YA 4GZLA 3C74A 4GOOD 3ZLUA 1P44A 1RJ9A 4A9AA 2NRZA 2PR2A 1G59A 1NAHA 1MB2A 3ENWA 3DV0B 4G63A 4PSAA 2Z8XA 2XWBF 4HAIA 4MOWA 4NG4A 5JATA 2XB2A 3UGQA 1JG6A 5CYOA 2HNKA 5CVDA 2GN2A 3UV6A 3D4OA 2XQVA 3SYLA 2QTNA 3VPSA 2PNFA 2Q6TA 1Z7YA 2QW1A 5CVVA 3PQ2A 1NUPA 1B3BA 5D5QA 5DYNA 3ZXXA 3OIUA 4KXVA 4KN7A 4B6EA 4KU4A 3PTZA 9ATCA 2NQ8A 5K8LA 3VSDA 2C2MA 1D8YA 1IHPA 4PR0A 2QDKA 1PTKA 1B0PA 4TMKA 1OYYA 2MWMA 4KFRA 4ZPXA 3WGKA 3V8BA 1KE1A 4CCWA 4P3XA 5FPKA 3RVSA 3DONA 4QATA 2VNIA 5KFOA 3RE1A 1G8GA 2H5EA 3WR5A 4NV0A 1RCTE 2RHOA 4KO3S 2JFHA 4XCQA 1K86A 2C84A 5KTKA 3ADDA 2QI9C 1Y8AA 5BW4A 1KYVA 4NCAA 2FWRA 3E8SA 1J8DA 1J09A 1NVKA 1V45E 2C5EA 2Y76A 2ZR9A 2XZTA 2JGAA 1XZCA 1L4UA 3GRAA 4KR7A 5IIOA 1D4FA 2RSLA 4R5MA 1F6BA 1YZHA 3REQA 3NJ4A 5TEWA 3HR4A 3C98A 3MQ4A 1W73A 3PL5A 4DEVA 3KALA 4TV8A 4EA8A 5IEJA 2Y1IA 4BAGA 2OAP1 4Q3DA 3EY9A 4IKOA 3CWQA 1KZ4A 4R9RA 4YJ3A 1T9GS 2IPAB 1UBLS 3G8BA 1AU9A 3ABSB 5EP4A 3VKHA 4UU7A 7MHTA 2P4SA 1H4VB 2BCJQ 4GUDA 5FO0A 3A1TA 3ZU4A 1UBTS 4LECA 1VPLA 2EZ4A 3D0OA 2WJPA 4P98A 1B6SA 2CKMA 3FAZA 1QYWA 2BFAA 1JI0A 3IGFA 2B34A 3N8NA 2WPDD 2O4CA 4MIYA 4LPSA 4M21A 1JIQA 5CB6A 3GJ7A 4JBWA 4C29A 1W9HA 4UB5A 4L3VA 5F5NA 4IJQA 5TPWA 3ND5A 5AESA 3VDQA 2VWGA 1HQDA 2NV3A 4JNCA 4EQ6A 1YVRA 3QX7A 1DI0A 4RE5A 3ZD8A 1BCSA 3IFSA 2RGGA 5AKZA 2Z3ZA 3O47A 4J3JA 2H31A 2PZLA 3T4XA 4CT0A 3WLEA 5GM2A 3OZFA 3EIHA 1K3FA 4YRJA 3S3TA 1QVRA 2FN7A 5IX8A 4I1VA 2EG9A 4XVQA 1Y8RB 1ED1A 4BJ5A 2BFCA 2QLBA 4ZYZA 5IJZA 1F2DA 1X1RA 1JHRA 2ZB4A 5LB4A 3I2IA 3E1KA 4PO9A 3VR6H 1L7AA 3AUFA 4P36A 3UMGA 2BKLA 1GNPA 2W2KA 2R7MA 4H7JA 1N8SA 1NN5A 5IN5A 4RQ4A 5KFGA 1KA9H 1Y33E 2JGEA 3QWFA 2BSQA 1XDZA 4U2BA 2W9BA 3PSFA 1XTJA 3H97A 6LDHA 4LSGA 3LUPA 1WX1A 4X63A 5CHGA 1U0GA 4V0SA 5D7BA 4LNAA 8ICKA 2B92A 4MULA 5FTKA 2C5AA 3AP1A 4EYOA 1L4FA 1PR9A 5KJEA 3GLIA 3JPSA 2Q0XA 3T99A 5JASA 3EMVA 2DLDA 3WDLA 1MAVA 1PS8A 1QTIA 4HLQB 3T3FA 3Q6NA 3V7YA 3B6JA 5JSZB 2IE0A 4IDOA 3K09C 4L4ZA 4PZAA 5EGSA 1SIUA 4MW6A 2E1FA 2N9UA 3ACBA 2JCYA 1JEJA 2DERA 5CA1A 4RNNA 4C06A 3STWA 1IZ7A 2YWEA 5TVKA 3FJ1A 4C4TA 1S3GA 1IY2A 3EQZA 4NLBA 4MV3A 1FU4A 3VPHA 4BNUA 1N78A 3Q3GE 2HPZA 2PUEA 4EYSA 5F33A 1KH1A 3L77A 5K03A 1NDHA 4KYTA 1U8EA 2GOYA 3CKMA 3T52A 4OXKA 1K2VN 1T8YA 2I6GA 4LMRA 1N5DA 1YDHA 2GNOA 1GR0A 2K2WA 1D4AA 3DEEA 5FV7A 1NXTA 4ZCRA 4QWDA 1M8KA 3FPGA 3IAFA 4DG5A 1YB2A 4YNBA 4P6VF 2P65A 5JDCA 5UKDA 5JROA 3OQJA 1E2JA 3BJRA 3ITEA 1E8NA 2ZEJA 4TTAA 4JOCA 1WU8A 2DZDA 5KT3A 4Q7LA 4Y7CA 1CDDA 5AMXA 3MQFA 4O5KA 4KOEC 2BPGA 2FZEA 4PFJA 2PQ2A 3I09A 4BRUA 2IHUA 2OLEA 3OPMA 3WLKX 1NJYA 1JPUA 3PR5B 1DCFA 2IP1A 3HVHA 4C0ZA 1JHDA 1RRGA 2QQ0A 3BD9A 1U0FA 2P69A 5K3FA 3UH0A 3PA6A 3ZGYA 2RGRA 1M74A 2ZDGA 3IMGA 2B4AA 2AWNA 5ALDA 2BRUC 2HJVA 2I5PO 2VATA 3N75A 5DG7A 4RM3A 5EMMA 5EZYB 5KQLA 2B5VA 5C31A 2FMHA 4PSKA 2IA5A 2KFNA 5IILA 1LKYB 1ZGGA 2J46A 4KK3A 5FI3A 4QZCA 3GQBB 2BBTA 4YRDA 4R71A 4Y2TA 4NFYA 4TZ6A 3MBKA 5J0SA 4X71A 5E6SB 1NATA 1U8TA 5DTMA 4EJSA 1HDIA 2YUIA 1XQWA 3B36A 4WCDA 3HYRA 4XYLA 4A1FA 4GKVA 1RBQA 1Z17A 2DPMA 4H4DA 1JSLA 5TQ0B 1W44A 2HJSA 3WADA 1JJ7A 3VX3A 5CCXA 3K70D 3L4KA 5E79U 3MERA 3FUWA 2RRDA 2ZTHA 4Q4AB 4TMXA 3TRIA 1LNQA 2B1IA 2QIOA 3T8YA 3UV7A 1V3QE 4YXFA 5AW6A 2PQ0A 4JI2B 1ZIOA 2AG0A 1L5QA 2F64A 5AI5A 1P2VA 4FT4A 4ZYUA 2WJ3A 3DV9A 1D09A 3KYDA 4JOBA 4X3OA 5IHPA 3TQFA 3K75D 3T5HA 5EIBD 2CN1A 4WKOA 2ZULA 1KDZA 4PRKA 4OQEA 4I4TF 2QAGC 4JUBA 1JR6A 3D3KA 5DHQA 1D6NA 1JHYA 3FYUA 1YFLA 5EWGA 3RANA 3CLSC 3DE7X 4XCXA 3RSLA 1PT5A 4JYAB 1A4UA 4M0PA 3QPUA 3A58B 3O8CA 3K0FB 5CLQA 1R0KA 4XLZA 4I55A 3HKEA 2UVQA 5FPYA 3R0VA 1L4KA 4DL4A 1KYQA 2F1RA 3N2LA 4Q24A 4EABA 3WYFA 1VLBA 1YS9A 3H04A 3N2KB 5ETJA 2R6R1 1K68A 3AUJB 1GU0A 2O3QA 4W5RA 5CFQA 2GTPA 2JEIA 1AUVA 2HX1A 4KLUA 2QQFA 3Q5DA 4O59O 2XRMA 3F4LA 4KIFA 4ZCTA 1AQLA 1MA3A 4DM3A 3H4DA 1AS3A 1OHHA 4YV2A 3ZWQA 1A9TA 3AQIA 4RSGA 2XCOA 4JA2A 1EUYA 5ISMA 3AUSA 1EX1A 1JZQA 3UANA 2V0GA 3PIIA 2G5HB 3DO6A 1N5IA 3O8QB 4FDAA 4ZQCB 2DUUA 5CLGA 1ZH8A 3U1VA 1JSXA 5B4VA 5BMVB 3HA7A 5D85A 4YN3A 1WZEA 4XVRA 4RXUA 3HX0A 5IKEA 4I1YA 4YALA 1TVAA 2ZJYA 1B8NA 2GCGA 3TJZA 5FAKA 4OXIA 4LF7B 2HA2A 4QJBA 2DBZA 4B9LA 2HMWA 3JAMA 1VECA 3TXYA 1BPDA 2C61A 4EEYA 3DNFA 1HFKA 1S7CA 4H1UA 1RZTA 2RHTA 3L7JA 4JSYA 5LA6F 3WL3A 5JSYA 3FRHA 4ICAA 4PCLA 4Q4JA 5JY1A 1EDEA 4CUKA 3AVQA 3L8MA 4PHCA 2IKQA 3VAZA 3CVJA 2C78A 1NVWQ 3H3FA 2E1EA 1U63A 2AA3A 3DGFC 2F3TA 5DFAA 3ZI4A 1ZQFA 2CL0X 3W3AH 4B5KA 4KMRA 4QGBA 2DFLA 5KNBD 2R48A 5HXAA 5G3ZA 3ZLBA 2ZRGA 3QLEA 3NFRA 2YZGA 2CLKB 3PYXA 3DE6X 2PUWA 2BEJA 1V4BA 2AYXA 1QGZA 4ZH4A 1R50A 2CLSA 4GE0A 1NOKA 4HHEA 1DBVO 2P91A 4NLNA 1GPBA 2ZE5A 2FGKA 1ZQKA 3B13B 4QA9A 5CJ2A 2HBLA 1Q7CA 3HCEA 2NUPB 3QENA 4QJFB 4FHFA 5B6JA 4QAQA 5ER9A 4IJ5A 4LRYA 5LNK1 4P7KA 3ACDA 5GIPE 5KFHA 3G17A 1EX6A 2GB4A 2XVYA 5CB4B 3GEEA 3FZNA 4HWPA 1KSFX 2P6PA 4G86A 2J6IA 4LVUA 1IG6A 2OSBA 1R37A 3P2MA 1GUBA 1ZL0A 4MQUA 2QTHA 4GF5A 4AZVA 1ZUNA 4CMIB 4MX8A 3RAEC 3R3WA 1H2YA 2E8OA 1BFUA 4GLFA 2K6GA 1AN0A 3DP9A 4U4AA 4BEJA 5EJFA 1FW6A 2VHQA 4IJ6A 1ACJA 2BQUA 5B3AA 2ZPTX 3DVLA 1R6DA 1USVA 4Z9FA 4RDIA 1NVVQ 3OZVA 5DI3B 5DG8A 5IMBA 1E1CB 2O8EA 5IVKA 2EBUA 3ITKA 1K8XB 1B0AA 1F2VA 1WMEA 3AG6A 4I08A 4FFNA 5IDYA 1FRFS 1LKYA 1JUDA 1Z3IX 4GNRA 3W5VA 4CMBA 3KLPX 2Q9BA 4NBUA 5EOZA 2YVAA 3PZPA 3ZDBA 5EPUA 2BGLA 4Z8XA 5KNLA 1FE8A 1JN3A 4FYPA 4HL6A 2P27A 3H83A 3JQ7B 5LYYA 5LZ7A 4BGUA 3SN6A 3L01A 2COEA 4CHGA 2ODEA 1R4MA 4GG1A 3KXKA 3DP7A 2NO7A 4J90A 2VEDA 3KR2A 3SDZA 3VQTA 3M9OB 4R3UC 1IBRA 1EXDA 1EWRA 2AXEA 4KJZA 4KR0A 3RAXA 4XPIB 1H8EA 5GPBA 4B71A 3UYKA 821PA 4DR3B 1HEYA 1AIPA 1IAVA 5B1SA 4FFDA 4K9SA 3F7NA 3KQLA 4E33A 3MIZA 1FJ2A 3H87A 1WUTA 4J0FA 1FFDA 3NWEA 3HGTA 4AFNA 1JXMA 3I5AA 3QBEA 3QRWA 2GTHA 1CF4A 4ZZ1A 4DSKA 2I2WA 2UYOA 3ZE7A 3WGOA 1G8KA 2DQZA 2VT7A 4R7GA 5K6RA 2DPIA 2EZZA 1ZQYA 3WGLA 1Z6TA 5HSGA 2BZSA 4C6TB 3IELA 1AGNA 1FDOA 2EHJA 2XYHA 1KFDA 3EWAA 1IIRA 1E99A 3LTEA 4IBOA 4DLEA 4BTEA 2GEKA 3H9QA 4IGIA 3UKJA 1MQ9A 3V8QA 2XCUA 4GOKA 4RDXA 2CVFA 3RB8A 3Q1KA 1ISMA 4DA6A 3D2SA 5ER6A 3PC6A 4JQOA 1JQBA 4Q4JB 4WUVA 4BNJA 2LV8A 2NU6A 1Z4MA 1PN3A 2F9MA 3GAFA 3QA3E 4FYMA 4HNTA 5LZ2A 1G2IA 3F2BA 1UODA 2XGGA 5B37A 2ZXEA 3MAJA 2OL4A 3GVHA 4B9VA 4L8FA 3E9ZA 4OSOA 2CF6A 4J16C 3MFIA 4U8GA 1ZQRA 2XX3A 1KJYA 4INZA 2R25B 2IYTA 4JENA 3BT7A 3F9IA 5GVRA 4MP6A 1ZUIA 5BMVA 1UIRA 1Z33A 1MNAA 2PXAA 3JR7A 4NXMB 4LEIA 4TL7A 5BMOA 1SKMA 3EVCA 3KEQA 4C7YA 1H65A 1M2HA 3O8QA 3TZQA 4F5WA 2HUPA 5JCZA 2AXNA 2ZRNA 3EGDB 3GEBA 4KL8S 2I2CA 3M6VA 1Y8RA 5JD3A 4FE3A 1U49A 2I3DA 1PG5A 3O9VA 4M0CA 4BGDA 1LQUA 4Z9YA 4V3CA 1PZXA 1POXA 2F7SA 1GZDA 3KHRA 4YLEA 1W7AA 3ERCA 4L50A 1K5PA 2RE8A 1JLRA 1XK6A 4MS1A 3O3NB 5M3BA 4KFTA 5ITWA 4GKJB 2CVHA 4F2GA 4DBZA 2B82A 3NYIA 4B34A 5NLLA 1YR3A 4LYFA 1I32A 3FOFC 4RZQA 3QGMA 3CEPB 2DFNA 1NV9A 2E4VA 3BS5B 5AQ1A 2JFZA 3KWJA 2HGZA 1PQYA 4A36A 2OV4A 1T9HA 2OYYA 1OFUX 2H1VA 2X86A 3AVOA 4J6EA 5FOQA 5KOHA 1OXKB 4RULA 4U2CA 1RXVA 3KR9A 8ICGA 2WW8A 3DF7A 1K3TA 3N7RC 3ZE1B 1BG6A 2IUYA 3F67A 4YMUA 9LDTA 4Z53A 2A0FA 2BELA 3EMDA 3ORFA 4J1TA 3OPYI 3TBKA 3M7IA 4TYNA 1F9EA 1QB8A 4AJOA 3PFHA 3TX6A 3R9WA 1BWSA 1EKXA 1V1MA 1HYBA 2GF9A 3DHNA 3KWFA 3MW8A 2QUKA 4EHHA 2IYSA 3AY0A 2YFYA 2KICA 2FLWA 2CC2A 2A5GA 2Q46A 2BI7A 3MILA 1Z4NA 4D4IA 4EEZA 4NL9A 3OD1A 3W06A 4C4RA 2NXWA 3EMKA 3JQFC 5BWLA 1NF2A 2ISSD 5IYZA 3EXFA 5KSYA 1T4CB 1NFQA 3R9XB 2ZIWA 2ZETA 4Z51A 2VEOA 1M8JA 1Q0RA 2L42A 4DEZA 3I2HA 3S1AA 3T3NA 4NLCA 4HNSA 5IARA 1UK8A 1TQHA 3VYVA 5L45A 4UB6U 4KLFA 2OZEA 2RG7A 3QLVA 4KFSA 3I83A 1MUUA 4RPHA 4Z1MA 2ZBRA 3FWKA 4B40A 2QAJA 4R2HA 2YS7A 3TK1A 1P0QA 4N0QA 3H5OA 3NM5A 4P1ZA 3H2BA 4LKRA 1RI5A 3VPFA 3DLBA 4QYXA 1K6EA 1L4BA 1F3LA 4GPBA 3UT0A 5HK9A 3VNQA 4BXOB 2VP6A 4KSYA 4ETMA 1NW9B 1Q3TA 3C7AA 1PRYA 4DAOA 2FFBA 4EGCB 4Z7QB 5IM4F 5H59A 3A9SA 3JVUA 3BXEA 1I6MA 4YJHA 2C7VA 2I4RA 1RXEA 3C5VA 1ZK4A 3E2PA 2QSUA 3I52A 4A8JA 3S40A 9ICSA 3N76A 4QBTA 1ZM7A 3S2IA 4DQVA 5IC4A 5CDHA 1IN8A 5ALUA 1PG2A 2QZ9A 3NATA 2KZZA 4CVNA 1U0SY 3CX8A 1GA6A 3M81A 7REQA 1FFXA 1P4GA 2CMHA 1Y1KE 4NCNA 2JD1A 4K7JA 1ZA1A 4CFYA 1DB3A 5JCJD 1QF6A 2CCJA 4RIHA 1L4MA 3M0EA 4X24A 1V1MB 5KFYA 2WYUA 1RPAA 2W43A 4MGIR 2X6RA 5GONA 4M76B 3LT1A 1B0ZA 1TOAA 1UAGA 2PD4A 4JLVA 5DGCA 5TPZD 4GBJA 5FWNA 2RH8A 4GMHA 5K5EA 4EJFA 2D1FA 1X9WA 2C77A 3C15C 4TTQA 4Z0NA 4C21A 3WWCA 1J2UA 4ZI2A 5TRTA 3SM3A 4CM4A 4PY2A 4O2AA 3SZ3A 3FFBA 3WKEA 3IILA 2W9CB 1G19A 1VJ0A 2WKQA 1JA1A 4LISA 4R01A 5AM3A 1CIPA 1X77A 2YIJA 1F44A 1V6AA 2F67A 3C6MA 5E9JA 3X1MA 1TYBE 3FWYA 5JADA 3SF0A 4A8TA 4C76A 3FYCA 4J76A 2UUBB 4IIJB 2GM3A 3JZAA 3ZK7A 5LP6B 5IKPA 1B2RA 1BKYA 2QZJA 1Z0DA 2JRZA 1Z83A 4ACAA 5JNLA 2B5OA 5GJWC 2HXGA 2RAPA 5KC9A 1Q6ZA 1EB8A 1JWBB 5CT8A 2X6TA 4B2PA 3DXFA 4MRAA 2W2KB 3RTEA 3AB3A 3OICA 4E88A 1CZRA 1P77A 1M2VA 3JQGA 2Y0SF 1Q2UA 1XSEA 4NYJR 5B12A 5DGDA 4WPGA 4XJXA 2B99A 3BMQB 1KPGA 2VN8A 4IDGA 2IJGX 3MJ4A 2CMKA 5JD6A 3P52A 3DCIA 3TB6A 1ZQNA 1XR3A 4BU1A 1PJTA 1MORA 5E4TA 1T8RA 1Y9JA 2WWFA 5AQEA 4DPMA 1MH1A 2R00C 4F5DA 3OUUA 4OMDA 3TOSA 4YXWD 1CUDA 4X44A 3U44B 1PK1B 4G0YA 3T1VA 2DWCA 3V6LA 1VIAA 2B36A 1ZRHA 1QANA 1C0IA 1K6XA 1Y6ZA 4QZ9A 3KOOA 1ORHA 2G72A 4QZIA 2I78A 1JDNA 1T9DA 3PITA 5KVAA 5HMLA 1T4MA 4YCDA 1Y8QA 1KYZA 2MSWA 3KFXA 2F3QA 4OI0A 1O5IA 2JI4A 2FQQA 2G25A 2QT0A 2XNKA 3K72B 4U5XA 2Z9CA 3DL0A 3D43A 4OV6B 4W1RA 3ZIUA 2KM1A 1B1CA 2IHZA 4PJ0U 2JIBA 1DWPA 3ZLJA 9ICGA 1CQXA 3Q8SB 2RMKA 2VF2A 1Z6ZA 4EYIB 1EZ4A 2XVAA 3P4UA 4ZOCA 1SRRA 2W70A 1USUA 3RIYA 1EEHA 8ICRA 1QWOA 2G5PA 5FOTA 4W6QA 4YS6A 1ZINA 5TVGA 4OHZA 7ICMA 2R18A 1XDWA 2O06A 1PWXA 1Z06A 2REQA 1H1TA 3DAPA 3FKJA 4H16A 4Q39A 3ICCA 4UUAA 1HE1C 3TUZC 4WZAB 4KPYA 4MI1A 3L1HA 2OXOA 2GR9A 1LVHA 1F0NA 2OK8A 1YQWA 4KTQA 2VHZA 1K8RA 3FNEA 3PEUA 2IS1A 1EFCA 5L3VA 1LZKA 3RBDA 1FYFA 2B25A 2CKDA 2ZI6A 4KE9A 3T9FA 3T7EA 3I2KA 4OH7A 1JB9A 1QQ5A 1PU2A 3DJYA 3LXXA 1DX4A 3IBCA 4GPD1 4L27A 1S2OA 4YR9A 4MVJM 4ZODA 5B4TA 1G7CA 1NTOA 1UBCA 2AOWA 2KI5A 3DMYA 3FWPA 3DBLB 5TMDA 5CH8A 5LCXA 3AF2A 2J85A 3WLLA 4TS3A 3QPDA 1GNQA 4WNAA 4XE5A 1JECA 4F21A 4BMOB 2NTJA 1HM5A 1NM5C 2ZKLA 3MJSA 3CLHA 2L2QA 2BDEA 1HC7A 3LCCA 4DC0A 4QXRA 5ALWA 2XDQA 3PX7A 5TE9A 4ZYLA 3GW8A 1T9BA 4JKIA 2O7QA 3A1UA 1JIVA 4CQMD 4CG2A 2E5SA 1T2FA 4XI9A 4G1BA 1ZXLA 3ZHCA 4HB4A 3K5PA 4W9MC 2O7RA 3LA6A 1V8PA 4J9QA 3QE2A 1ARZA 1E3SA 2OZPA 5CDFA 3SI7A 4V1CA 2OK7A 4G9GA 4UVIA 8ICJA 3NO4A 2FPPB 2PVSA 5BVGA 4RQ0A 2K60A 8ICTA 3A27A 3NYRA 5AK3A 2IV3A 5C1BA 3KU4A 3OEWA 3UOWA 3LUJA 1GGKA 4ECTA 1W93A 2ZXIA 5KSPA 2OZLB 5C7LO 1KPHA 4EARA 3GRRA 3UXEA 1IEWA 2HK8A 3IUSA 5C5CA 3DLHA 3AEQB 4LFAB 4F92B 2E4YA 3DFFA 5DDIP 4D4GA 1CY2A 1U3GA 4CUZA 2AKYA 4WK0B 3DEAA 4ZARA 2Y68A 5KT4A 3B9JA 1AGXA 2BJVA 4MO9A 2BGKA 1T3GA 1ZBQA 4TLBA 2B4TO 2NUPA 1SXJC 2VSYA 4UEQA 5ILQA 5EJ2A 2JH8A 5A9SB 1G8HA 4F9FA 2EZYA 4WCVA 4ASUA 2EBFX 3QF7A 2O2CA 1L7NA 3HYCA 5DK6A 5G0UA 3UXMA 4CDGA 3GHYA 4J0QA 5B55A 1DSSG 1YXMA 5C9ZA 3AU9A 2Q6VA 2FN9A 3TSAA 2EP5A 3F78A 2AQIA 3FPCA 3VDXA 1BCRA 1OT5A 3E48A 4LSMA 3UCFA 3X43A 1GN8A 3GUZA 3I92A 2MSKA 3GV0A 3BSWA 4KAJA 3VDRA 1KJWA 5EKDA 2IVZA 5J0XA 3MGIA 2VS1A 5AM1A 1LY1A 3EOAI 3KU1A 4ECXA 4EPYA 5AXBA 1GQRA 4IF6A 5AM0A 1Q95A 4RGYA 4B33A 2Q0QA 3FWZA 2X9VA 4YD2A 3I6IA 2NW6A 4XCVA 2ATLA 3P2JA 1DKQA 3GJYA 5KWSA 3KHLA 5BN5B 4FU0A 3C1ZA 3LTNC 3M8SA 2YRXA 2ZXHA 1OSNA 4V38A 4US8A 1PVVA 2FYTA 3NX4A 5KFMA 4QNLA 5JVDF 2O2EA 3SR3A 2JD2A 2OFPA 2Z9DA 2YWFA 3CF0A 3D81A 3EA0A 1AUPA 5F3XB 3D6AA 2ZREA 3H2KA 3H5LA 2HXSA 3KZCA 4R9UC 4LZGA 4YA6A 4ZQGA 4DJDC 1NKBA 1SOVA 3MMZA 3TLYA 3ZOKA 4RQ1A 4EP1A 2C7OA 2YMMA 5E6UB 2DKFA 3QVVA 3AJEA 1UOEA 3VTZA 1R0XA 1ZH6A 3ILYA 3WMRA 2RP5A 3PXXA 2H0QA 3FKSD 4OXNA 3A3KA 5DP2A 3V3TA 1L7OA 4NYMR 2A4KA 4LJ8A 4B6SA 1EP2B 1J4AA 2BTOA 1WU7A 1K1QA 2R6ZA 3AJ8A 3G79A 3HL4A 4NL9C 3GYBA 3D3EA 4DMMA 1ORVA 5IHXA 2H1LA 3CRQA 1VHLA 2C3MA 3EPRA 5A6SB 3VYRB 4RKRA 1SXJB 2C3PA 1QKJA 5MDHA 4DB4A 4PHEA 1AKMA 2D13A 2QN9A 3CW9A 4BAUA 4BVJA 1LWNA 3AZQA 2J07A 3SOZA 4X5OA 5A4MS 1EA7A 4Q66C 1IY1A 2WJWA 4ALJA 3DVRX 3EVZA 2ZRJA 3K9NA 2P7HA 4R8UB 3LL7A 3ZTTA 3FC4A 4N03A 1O94A 1KMHA 3U0VA 4YV0A 2ZJBA 2PT6A 4IXNA 1U98A 3HPRA 3AFHA 1E5QA 2PY6A 5HFAA 3TZBA 4YYEA 5KNDD 2X4DA 4OHYA 3S7TA 3U16A 5IT0A 4FHGA 3R40A 1LPAB 1OW5A 1GRQA 4KYIB 3G6YA 1N2GA 2QTTA 5DN9A 4AWAA 3OQVA 5KHOC 4WXRA 2G4VA 2WHPB 1YO6A 1YAJA 1HZZA 3WXBA 3J81j 1WUDA 1SCDA 4IHAA 1ODLA 4G5SA 1QGDA 2BUCA 2VK2A 4O08A 4DIBA 3IB6A 5BSEA 1M8GA 4YRLA 4YUWA 1RZVA 3RUFA 1ZW6A 1EHYA 4JDPA 5MF6A 4C2AA 3I58A 4IQ0A 4X00A 7ICLA 4B7XA 1XMSA 5G0WA 1F4VA 1PK7A 4O5EA 2QN7A 3KKEA 3FDZA 1RPNA 1B8UA 2XGSA 3WRWA 3RG8A 2OP0A 2VPPA 4TL9A 3TSYA 3WSWA 1PX2A 3M1AA 5KHAA 3I2GA 3VZQA 3P9YA 3MD0A 3NBYC 5CVEA 1ZAYA 1C9EA 1PDVA 1K8YB 1W6UA 3I01A 5LZ5A 3B6ZA 1Z7EA 3DE5X 1QBKC 3C24A 3IHLA 3MN1A 1W19A 5EE0A 3FIJA 4MUNA 4D5GA 4UM9D 2V0NA 5K3FB 4X90A 1UT5A 4ELVA 1QS0A 4PQYA 3ZGLA 3OOHA 1B16A 2CF5A 2JFVA 4PIPA 3VR5A 4N3GA 2W03A 1TUBA 1P9RA 3ACCA 1PJQA 1E3JA 5J5AA 2JGFA 2CLOB 2IYZA 2R8EA 4KYUA 3B12A 5F73A 1S8AA 1L4HA 3IV6A 2HHLA 2WG2A 1BXZA 1JEQB 1R2QA 1KFKB 4C3VA 4ENQA 1S9HA 2D74A 2BSXA 4AIRA 1N6OA 1T1JA 4P22A 4PG5A 3ZGNA 2B3DA 1CY7A 2GLEA 1YDWA 4OM7A 3U4AA 1QGUA 3F6YA 4K3VA 1E2LA 1SC6A 3JQAB 1EVYA 2VNHA 1O0BA 3HLKA 3FMVA 1IOZA 2AHOA 2B0JA 2HREA 4R8SA 2XLCA 4DLZA 5CA0A 1N1MA 2CLMB 2OY0A 3D8BA 4MCAA 1PV2A 3RS5A 1CUYA 5LQCA 1YU9A 1GJRA 3BWDD 2W2XA 4HX5A 3EH1A 1U02A 3LRPA 4QXQA 1WZIA 5A9RA 1S3IA 1VKOA 2HIGA 2ATXA 4OUDA 2VYVD 4V2IA 3Q3JB 4Y1GA 1RG6A 4P4MA 5HE8A 3TGWA 3U49A 1HQKA 4BEBA 1Z5UA 1D8TA 1WMAA 2OGTA 2AS0A 4GVPA 5K4GA 3MWDA 1T6BY 3HJGA 2WDPA 3AI7A 5KG6A 2FEXA 4M7OA 3NRCA 5ABPA 2O2HA 1FNBA 3DKRA 3KHUA 5T6MA 4BFZA 4L22A 2G1PA 4G0MA 1NW8A 1RXUA 2CNOA 1E3QA 3KD3A 2DCUA 2EFDB 2HWWA 2OD7A 2FB9A 2ZYVX 4L4RA 3CUKA 5DF1A 1F1JA 3MG9A 1N0UA 4NJMA 2YWGA 3W5CA 3RJGA 5AKXA 1ZGAA 1QRDA 4XB6B 3P9IA 3KZMA 4IF4A 1X38A 4UB4A 2PIAA 3OE1A 3R20A 5FUYA 4G8CA 1E2GA 7ICIA 1WTCA 1TT5A 1C8LA 1E6LA 1TE2A 1UDWA 2B83A 2J5RA 5LA6A 3W4IA 3C2MA 2IZ0A 4I6EA 4LDAA 2P1DA 2NT4A 2YNMD 3BXOA 4MNTA 1Y3DE 5KSOA 4XRRA 1D0VA 1FDUA 1ZK2A 3M3PA 1X8XA 4GBED 4KXNA 2KB0A 5CM9C 5FUWA 4PAGA 3R7AA 4BKRA 4UB8U 3B2EA 5B53A 3C4VA 4KLNA 5D1HA 3SNHA 2DH5A 5JYDA 4RTKA 4MRPA 3MUFA 1L5VA 1VCOA 2EF1A 3PFIA 5BW5A 3ESDA 1W1IA 3UHAA 5AD1A 2Q62A 4ITUA 1I4DD 5CT4A 1F60A 1P17A 4FC6A 3PBKA 2VIXA 2F44A 5IW8A 1I6WA 3S5JA 4ZT4A 2C96A 2O5CA 3T15A 3EIUA 3NGMA 5FEMA 2H63A 2Y1CA 4HDSB 1GIAA 3QY0A 3BZCA 2GKOA 5KNIA 3GJ0A 3H2GA 4TV8B 5M7EA 5LYJF 2C1ZA 3PXAA 1M1XB 4HLUA 1FSGA 1PZMA 1ZU5A 4U39A 3VGPA 4BQEA 4OYYA 4ZCIA 1W4CA 3ANYB 4YVFA 3QX3A 3LCUA 3L84A 2PX6A 3VRHA 1R4NA 4IRCA 3EZLA 2QM7A 4JVLA 4HNVA 1ID8A 4J43A 4IIHA 2JAXA 3MABA 3GGDA 1LF5A 3M4JA 1ZOOA 1II9A 2RGWA 5KFPA 1ZNYA 3FLMA 1INLA 3IQEA 3LOUA 3OY7A 2C2EA 1AQUA 3SHWA 1ZK3A 2ORYA 2W8ZA 3UJ3X 2YZKA 3AUXA 1IOVA 1SUAA 4CE6A 3OJSA 1LBTA 5ALVA 2AX3A 3FYHA 3KJEA 3ST7A 3TIGA 3RRYA 4MV4A 1TU0A 5LQDA 3CZCA 3KRTA 1CCWA 3LM8A 4QPDA 5I9SA 5HR5A 2HDNB 3G2JA 4I4TA 4DY6A 3WK4A 1TD9A 4EUFA 4LNUA 4BVFA 2QRVB 3UN1A 1MO3A 4UW9A 4MWEA 1X80A 1ZHFA 3QNUA 4QHTA 1XO0A 3T0GA 1ZQEA 2WHEA 1XZKA 3PTLA 4KZPA 4KLAA 1EZ1A 4MITA 3CPEA 3Q9SA 2QVYX 2IZ1A 4BP1A 2Q9UA 3ZWNA 2BISA 2EJTA 3B9RA 4JBNA 1X8KA 2B2XA 4O4IB 3O2JA 1G4HA 1JAIA 4XLTA 3SX2A 3GDXA 1LTKA 2I9PA 1K98A 5BSHA 1RXYA 2DECA 3SKVA 1DBWA 1ZWLA 2XBLA 3MRVA 1J06A 3ZDYB 2GCEA 4GGMX 1MIOA 4L72A 5JLJA 4ZVUA 3IT1A 3A0HU 4BKMA 2V7WA 3D31A 3AK4A 3K8OE 4W5TA 3LUAA 4UM5A 1E9AA 4MUIA 4AVYA 3UATA 4B82A 2AEMA 1VI6A 4QT0A 3KB8A 3A0UA 4XA8A 2HOQA 1EQUA 2A0WA 4TVBA 4JHXA 4HVLA 1KWKA 5AM5A 1K1SA 3HM2A 1RM6C 1V3UA 5CYFA 3OEHA 3CH7A 3DL2A 3LF1A 4G5XA 2ZFUA 3HZOA 4OBEA 3EARA 2P78A 1VHQA 2W2OA 4XXHA 3A1WA 3BC1A 3CZRA 4ZV9A 3DE2X 1HUOA 1QFZA 2QENA 2IOHA 2IE8A 3E1SA 3N8DA 5KTOA 4Y6QA 3MTIA 4DR6B 4KNVA 3BTOA 4P4LA 1O5OA 3VSEA 3JQ9C 4RACA 4F85A 1PSDA 1Z56C 4HFRA 2J3DA 4WK4B 4X45A 5C8XA 4E0DA 2MT9A 3GDWA 2D1SA 3F3KA 5LQJA 3OZRA 5EHGA 1UPBA 4QBHA 3K5IA 1BAPA 2MR6A 2R96A 3PXDA 2WE8A 4UM7A 1MFPA 1IH8A 2OV8A 2PIDA 3RC3A 1EK5A 4PYNA 3DKIA 4ZC1A 1BEZA 2O2XA 4M6WB 2HZ7A 4H2DA 4B81A 1BMFD 1KJZA 3S5UA 1QGUB 2XMPA 1S5LU 3E4CA 1XRMA 2UZIR 3UF0A 4F1KA 1G5IA 1GRVA 4FIDA 3KKZA 4V24A 4YP6A 1NWHA 1MA0A 1TJ4A 1KBUA 4QPJC 3U7HB 2QNIA 3GVXA 1F8GA 3DW1X 2Q2VA 2ZLBA 3NT4A 1KSJA 5TF4A 2FQWA 4PU0A 4UAWA 3B70A 3IA7A 3JTMA 4XM1A 1GUFA 2BFEA 2DBRA 1UK9A 3WWDA 2WTFA 4AO7A 4E7OA 5LMNB 4RK0A 3ZLTA 1A97A 2BEUA 3OQHA 4D1YA 5ITVA 3HEAA 2V3VA 2JK0A 2RJ3A 4ZV4A 2PQMA 1QVVA 3GILA 2NXCA 1KIMA 2W8BB 3IP4B 3RS9A 4AJJA 1TMOA 3AVXA 1GZVA 4AY5A 3GVIA 2GRAA 3F4BA 3GT4A 1KO1A 2ACKA 3BB1A 1BFKA 3L0IB 6PFKA 3DMHA 4U1RA 5HRAA 3BHIA 5FL3A 4FFRA 1BO6A 3KJQA 1JH9A 1YT5A 1G8PA 3EW7A 4PRYA 3JQPA 5CH3A 5BSTA 2NX2A 4C7VA 1GM5A 4JBXA 2GVDC 3Q2IA 3DXZA 3UJ7A 5AVKA 3WQBA 2BFPA 2VYFA 2PFPA 3IEMA 1XCOA 4RTOA 2K8AA 5EMHA 1A72A 3SSAA 4ZDKA 4TZ0A 4FBMA 3RFVA 3FDZB 4Z7JA 5D3MB 5CITA 3HB9A 1FTGA 3LQ1A 1VLZA 3FKQA 4LE2A 5GJBA 2FLLA 1G7RA 2EZUA 4UNSA 4G5GA 4G1FA 4GGOA 2IOYA 3A06A 4RETA 1Y1TA 2GNAA 3FGNA 5EFZA 4D8TA 3F5QA 1KS9A 3FNIA 1QC5A 4F38A 3TZHA 2XNSA 4B85A 5JU6A 2BGMA 3MINA 4RXTA 2XUFA 2FN8A 5E0KB 4BQQA 3PR4A 1HMPA 4I6GA 5AHRA 4EG0A 1FX0A 2VHTA 1ODCA 1XCBA 3BICA 1WABA 2O48X 2Z95A 4Q1FA 2PSEA 4AO8A 1SVIA 1KMIY 3RRXA 3URKA 2GJSA 1C30B 2WHRA 3GU3A 1WQ3A 3VC3A 1K7YA 4MARA 5BN3A 3FBTA 3HZZA 1W94A 2WA1A 2WTUA 3VPGA 4S1TA 4Q02A 4UPEA 1DXYA 3NTQA 4YJGB 4OQNA 3VO9A 2JMGA 3D8RA 2HT1A 4HXGA 3M6FA 4J9VA 1I2MA 3TOXA 1DIGA 4UZSA 3JAKB 4E09A 2D62A 2ZAYA 1HXHA 1OLUA 2HQRA 5GGYA 5AW5A 1RQGA 3A2NA 4MAMA 4L16A 1W5BA 1Y1SA 3QHQA 5F3RA 1SQ6A 1BPXA 3RJ5A 3I34X 1T24A 3C8ZA 1TJYA 1HTWA 4URVR 2UXDB 3GLGB 1AXEA 1D04A 3ICOA 1HNZB 5I4KA 2D06A 1FK8A 1OFTA 1OAOC 1NLYA 3AEYA 5CM2Z 2B1QA 3IEXA 2ZJ2A 2QYOA 2YN4A 2IZ7A 1TZKA 3PXUA 1G9TA 1Z68A 3OCZA 4TKVA 3RUCA 2BGTA 5HOEA 1KQ3A 1L7VC 1BNPA 3M6IA 2UUAB 5EJ4A 1NP6A 1PR5A 1HGXA 4OK6A 4PS0A 4B3XA 2F8SA 2YXPX 1Q19A 2C0CA 2OYCA 2RGDA 4KLHA 3F5MA 2HCRA 3DVSX 3HFSA 3KJHA 2JAPA 2H57A 1N48A 4G0OA 4J3NA 4F1JA 1WBBA 1X6IA 3O1LA 5EWJB 1WP9A 2BOVA 1EVQA 4IH4A 1VRCA 4ZI3A 3HUEA 4LCBA 2YN0A 1G20B 3HPQA 2GHTA 4C88A 1JLLA 1DT5A 1HA3A 3BMOA 1COKA 2X2EA 2BLNA 3IUPA 3KHSA 3T5BA 1EVKA 2O4UX 4UREA 4DCMA 2RHRA 1VKHA 3F6RA 2Y27A 1REQA 1X0VA 3DQZA 3QI7A 4JMPA 2HA6A 5G4KA 5G4KB 5I9IA 2NV6A 1IK6A 5IULC 1MZVA 3WB9A 5E3HA 1WHTB 3S2FA 1Y3HA 3LBIA 3TPZA 2V6IA 3PC4A 5B5EU 4ENUA 1G3IA 1E9BA 1XLTA 3K31A 2F4VB 1VE1A 4JWNA 2GPBA 3MS2A 5GMOA 4JLSA 1E2NA 4UXHA 1NK4A 5EWJA 4J8PA 5K3AA 4L9WA 1T36A 4X20B 4XDGA 2HPHA 5LQNA 1RAHA 1QCDA 4B9UA 2GCOA 1S0NA 2DH6A 3Q9LA 2ZE8A 4O0LA 1R8SA 2X8WA 3AKEA 2QP3A 4EKDA 5B7QA 1SQGA 2A3RA 5KFAA 2VSXA 4H3HB 4I9GA 4G09A 3V33A 4AY3A 2WOOA 2CVOA 5CVUA 2Y93A 2JD0A 1IK4A 1RLOA 2E48A 2H1RA 3PI7A 2ZTEA 2GD0A 3RUPA 3T7AA 4BFVA 4PX3A 4I50A 1FDSA 3W5JA 5DQIA 1QLHA 1BXKA 4COKA 5FJIA 3F2VA 1JDPA 1UXHA 1XMIA 3KEOA 4L0DA 4F3CA 2DU8A 4IUDS 3PQFA 1EG7A 4Q4CA 3CVUA 4JI7B 1MSWD 3DHEA 5DK4A 2IH2A 4U0JA 3GWGA 1A4IA 2H1CA 2ZRLA 3L0BA 3QXGA 4MIOA 4RLFA 2KP7A 1QX4A 2FR8C 1IC6A 13PKA 4ZCLA 1FFEA 1QHSA 4AJNA 3CW2C 1DDGA 3W79A 1YS4A 2DKOA 2FMQA 3QLUC 3OLXA 1BDJA 1LPOA 4JC0A 4D0SA 3UB2A 3HKBB 1W49A 4GNKA 3WFIA 2KPOA 1DKMA 1DXQA 1H0RA 1ORWA 3EPJA 1CU1A 4J9KA 1FP4B 4D0RA 1M5RA 5HM6A 4GOXA 4DV1B 1E0DA 4E70A 2FZ4A 1FPQA 2H2WA 2VT6A 1U2PA 3E1GA 4FPXA 1VJGA 4TYQA 2IF0A 2AFIA 4CLDA 1NK9A 1WAMA 2QS9A 3FMIA 4R6WA 4P0QB 5HQJA 2HL6A 2W98A 1NSYA 5JV5A 5EC8A 1SN7A 3QLTA 4LJKA 5KTPA 4NMHA 3KQHA 2GUGA 2WICA 1CY1A 1LFAA 2QGZA 1YR2A 1F9AA 1DO8A 5FRDA 3DBLA 4R2MA 2OFWA 3E3AA 4D92A 5AW2A 1N5LA 2G82A 2IDJA 3D4IA 2V1UA 4GKBA 5A3SA 1MEOA 5KVVA 5DRYA 3I4FA 3HO8A 4G0XA 4ZCMA 2XUKA 1BKSB 4OSPA 5JSKA 4C05A 2G76A 3DNMA 5CFOA 1EAYA 4QYIA 1W46A 4WX2B 1I5EA 5CXXA 5EQFA 5L3SB 1HNWB 1H3EA 4Q9DA 3CZ4A 2C00A 2XQIA 3M6MD 4LBYA 1I0IA 2JLXA 2HHXA 5IBRA 3P2EA 4DDVA 2V7QD 2WIAA 1URPA 2WJAA 1J0BA 3FOAA 4RABA 3X2SA 1GV0A 1ESDA 2I29A 2XCTB 2QGNA 1TMGE 2WY2D 9ICRA 5DHSA 1RR6A 5D87A 3RAJA 3UJBA 3BWYA 1IVSA 2DBVO 4GXNA 1WPRA 4YRNA 4QZGA 1CK4A