3EA5A

Kap95p binding induces the switch loops of rangdp to adopt the gtp-bound conformation: implications for nuclear import complex assembly dynamics
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 52
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ea5A00
1R8QA 1FNMA 1WB9A 3NG1A 1KK2A 3VU9B 4MA4A 2PLFA 4C0KA 1A2BA 3CX8A 2HJVA 4HAWA 2RMKA 1OYYA 5EXPA 2ZRIA 4HAUA 4TL7A 2ZS8A 4Q1BA 2Z43A 1UBCA 1E2HA 3KXLA 5DNYB 3B5JA 4E03A 1JQJC 3PEYA 1NVVQ 2RAPA 1G17A 3ADKA 3GLFB 3U7FB 3DOEA 2QUZA 2REBA 5DI9A 4GRAA 5J40A 5FPYA 1W5SA 2CCJA 4NCNA 3P32A 2P0EA 1RRCA 2N42A 2R6GA 2YWGA 2OBNA 2XTMA 1FTNA 4P4SB 2ZSDA 2YWFA 1MRSA 1PZNA 4ZV4A 2XXAA 3W5IA 2FSFA 1DS6A 5CLLA 4EJSC 3ND8A 3RSLA 1DAEA 4LHWA 4CVNA 2C9OA 3A1SA 1FFHA 3ZH9B 2VEDA 4JJZA 4DLYA 3CKLA 4HEJA 3AF4A 3OEED 3B82A 4LOAA 3C7KA 3PR1A 2R6AA 4LY6A 4AIIA 3QKRA 3QKTA 2N46A 3I4LA 1AS0A 2RGEA 3QF4A 4GOKA 4HZIA 5AUPB 1GL7A 1C9KA 4C0LA 4NYJR 2HUPA 4RD4A 4TT3D 4Q21A 1E9SA 4GBMA 1G8GA 1KI6A 4M53A 2H1LA 1FQKA 2IS6A 4BASA 4DLWA 1UDWA 4E09A 3VU9A 4G5RA 3KQUA 2OEPA 1HEIA 1HH4A 4M1YA 5K8TA 1OHHD 3ZS9A 1NG9A 2ZSEA 5A4JA 1FUKA 2BKUA 3DKVA 5EE3A 3T34A 1AZTA 4G5GA 1S1MA 5JS7A 1R5NA 3UMSA 4MDFA 1JNYA 2G88A 2ZVPX 4PHFA 4BFSA 1W47A 4DVGA 1XJQA 4H1UA 3RS4A 3MJHA 1FX0B 3R8FA 2GJ8A 1UDXA 5C46F 2QTFA 5FL3A 1T0HB 2WAYA 4I1UA 1VHTA 2JA1A 1XF9A 1WXQA 1E1RA 1KI9A 3E1SA 3KXIA 3GJ5A 4DBLC 3U3MA 4Y0VA 1AGPA 3SU8A 4PC1A 4LC0A 5TY0A 3VKHA 3AVPA 4UNNA 2ZJBA 2ZI9A 4NHOA 4NTZA 3VNUA 3NXSA 3WYGA 4B74A 1M8PA 4D0NA 3AVQA 3OAAA 1P2SA 2C95A 1TF2A 4EAQA 4M1WA 1CJUC 1E2DA 2IT1A 2IUSA 3Q3JB 3W90A 3WHLA 1V5WA 1VECA 2NG1A 2ZPTX 5EP1A 2RCNA 4OI2A 1E4YA 2QU8A 4KLNA 1S2MA 4D4JA 4TN1A 3HPQA 4IDOA 3EZ7A 1XX6A 5TVKA 4V0KA 3A36A 1OFHA 2J0UA 4GMXA 4IOMA 3KZ1E 1M6NA 1XXHE 4A8JC 2OFWA 1RIFA 1R0YA 1LS6A 1KSJA 1M2OB 2OBLA 2QENA 2ZJYA 4L16A 5K8IA 2WWWA 1GDDA 2WKPA 1VG8A 2EQBA 1VCNA 2AFIE 1AZSC 1FX0A 4ERNA 1SKQA 1G18A 2KE5A 4ZCIA 4AI6A 1XEWX 4NMMA 1NP6A 3IQXA 4WXRA 1JI0A 1X8JA 1W48A 2WSSD 1TUIA 1ZNYA 2O0JA 4D4LA 1N5IA 3ZVRA 2IW3A 2DB3A 5KO2A 2FJUA 1CF4A 5AJZA 5C4MA 2ZYTX 4EPTA 1A5TA 2A5GA 3DO6A 3RABA 4EFLA 5JWRA 1UFQA 1TNDA 3D6TB 3AGPA 2J7PD 3GLFA 1ZVQA 1HT2E 1HV8A 3PCRB 4HZUB 2DCUA 1AKEA 3EW9A 5P21A 4TT3A 3NHBA 1VTKA 2ZIAA 4NZYA 2OFXA 2YC4C 3LWNA 1E32A 3SQWA 2VIIA 1SXJE 4N0EA 5BN3A 1PVOA 5DHAA 3B78A 4L9WA 1N5KA 2Q3MA 4U7DA 3K0EA 3GCGA 2UZ3A 4A2PA 4ITRC 2QL6A 2WWXA 4KFRA 1ZAKA 2P65A 4Q4HA 2XSZA 4IRUB 2IWRA 4B35A 1W2GA 2RGBA 2Q3FA 4KU4A 4RD3A 4NYMQ 3ETLA 3VNVA 4X8OA 3QF7A 4DIDA 4LJ4A 2WPDD 1JBKA 1X8KA 2F3TA 4PAQA 2G0TA 4GP6A 1NLZA 1QDEA 4JBWA 1TUEA 2R9VA 4LPKA 1N6OA 4ZO4A 3A4LA 2W6ID 1K5DA 3RC3A 1YZLA 2ZRCA 4O0MA 1JB1A 2F7SA 1EXMA 1XJCA 1W4RA 2NGRA 3BXZA 3E70C 3M0EA 2JEOA 4LX0A 5L3QA 4LBVA 1N6NA 1ZW6A 2KWIA 4MYCA 1AS2A 2EFDB 3OFND 4RZ3A 2JLXA 3WMGA 2V8OA 2IXEA 2JLYA 3B1VA 1Z83A 3RWMB 1S4QA 2JCSA 3AVTA 2O8EB 3SYLA 3GEHA 1Z6YA 1PLKA 2NQ2C 1I2DA 1W7AA 3LVRE 1GRNA 1N2CE 3AKCA 3EA0A 1YZUA 1CS4C 4K81B 1YHNA 1E9DA 2BBSA 1F6BA 1U81A 1KDRA 4OK5A 1SHKA 2GEUA 2I1QA 2KJQA 1ZNXA 1RKBA 3EIEA 3GMTA 5FTMA 3LXRA 4Q1EA 1ZD9A 3SFVA 4MYUA 3TVDA 3WRYC 3U7GA 1EX6A 3K0CA 5HR5A 4W5JA 3FFAA 3QPWA 4IVQA 4A8JA 3CRVA 4BZXA 1IN5A 1NN5A 2FNAA 1I4DD 3CNLA 1M7BA 3W8NA 4DCTA 3LXXA 4D2IA 4B75A 5KYKA 3KDSE 3NEJA 2D62A 1Z0FA 1T6NA 4ASUD 4JZKA 4FCWA 4CEJB 1LF0A 1YR6A 1NKTA 4Q19A 2H8KA 2C9CA 5LPNA 2J0UB 2QM7A 3EPHA 3GJ3A 5C18A 1RJ9A 5FBRB 1SVOA 3ZD7A 2J87A 2Q21A 1IBRA 5EUMA 1VCIA 5JZVA 2DWOA 4LV8B 1G3RA 3MWKA 4C30A 3RS7A 1SULA 4KHZA 1IN4A 3W6OA 2TMKA 2P3SA 5KDOA 1ZM3A 1ZC4A 1ZU4A 3LRPA 5JS8A 3QKUA 3DVLA 2XITA 1KI8A 3L43A 5KPJA 4KFTA 1TADA 2ZAOA 1KJZA 4RCZA 1P72A 5FBLB 4KVAA 4MKFA 2L0XA 5IRCD 3WYAA 1XMJA 2JLVA 3AEZA 4Z51A 3QY0A 2HCBA 1XFAA 1G20E 1WE2A 4P32A 4PO8A 4A36A 4AY2A 1NVXQ 1WA5A 3CF6R 2WVJA 2B7CA 4QHYA 4Z8YA 2EVWX 3BD9A 4M1TA 4Q1DA 2H5EA 3I5YA 1TU3A 2IYLD 5KDDA 3CLVA 5GJWC 3I8XA 4JLVA 2ZU6A 3FDIA 5LD2B 4LYAA 1P62B 1W0KD 3ZQJA 1KI3A 5FUXA 4D25A 1VG9B 2ZI4A 3CONA 3L0PA 4CDGA 1ZUHA 4D0LB 1NL3A 3VR5A 3L8ZA 4O2RA 1N0UA 1BH2A 4B3GA 1Q3HA 4HAXA 4URWR 4XIGS 2J5XA 3A58B 4GOXA 2H7VA 3TGPA 1W5TA 1N5LA 4TMTA 1XJ0A 4FMCB 4EDHA 1QHYA 2QAGC 1P60A 5EQTA 4LJAA 3DM5A 1H8EA 5JJKA 2NPFA 3QBTA 2QT1A 1OH8A 1W2HA 3QKSB 4PQYA 4O25A 1DAHA 3LQRA 5K8UA 3QJYA 2Z4RA 3NC0C 4RCYA 3OAAD 4ACBA 4B76A 3F3YA 2ZREA 4LHVA 4HATA 1MV5A 3SHWA 5BW8A 3CW2A 5KSOA 2P6RA 2ZTSA 1IOZA 4LJ7A 2GTPA 4F4CA 4CEHA 3IHWA 3EZ9A 5CDFA 4LHYA 2ZRPA 1MKYA 2Y8EA 3IBGA 2WJJA 4MQBA 4AKGA 1YR7A 3IDQA 1OKKA 3UMRA 1QF9A 3ZVNA 2HXYA 3GD7A 1OW3B 1X1RA 2AHOA 1Q12A 1F2UA 1II9A 2HDNB 1YZGA 3FKSD 1XTRA 1GFIA 3FVQA 2FPKA 4QHTA 4ESHA 1GUAA 2QG6A 5FTJA 2QRNA 1ZNZA 3A1TA 3FHTA 3QXJA 4IFEA 2DFKB 2JATA 1VIAA 3G82C 1E9AA 1E0KA 4IKEA 2CE2X 2YV5A 4ABYA 4P4SA 1XTQA 2HLDD 4HLDA 4BLSA 3WXMA 1LY1A 2PZFA 2O8DB 3B1ZA 2OV2A 1Q21A 4TYNA 1XD2B 2HT6A 3Q5DA 1H8ED 1E9CA 2CLCX 3UPUA 3GFTA 4WZ6A 2VHJA 1KI7A 2D4HA 3DL0A 3IGFA 5KTYA 5BN4A 3LQQA 3BWDD 4UJ5A 1E2FA 2ZI7A 2OCBA 1B0UA 3LO5A 2A5FA 3LVQE 3MWLA 3WY9A 1UAAA 1FPMA 3MWYW 1D2EA 5K8LA 3KQHA 5DSZA 2J41A 2ZI3A 2J7PA 4QBHA 4URYR 4KLZA 2IS4A 221PA 2ZSFA 3T1TA 3NBFA 2OAQ1 3TAHA 2B8WA 2HYIC 4OI1A 4TZ0A 2NO0A 2WTUA 1SVIA 4DDUA 3NH9A 2YZ2A 4Q01A 2R2AA 1DADA 1N0WA 1NI3A 4HAVA 4MKIA 4MUBA 4CIDA 1S9DA 3MFYA 1TPZA 1MABA 3EPKA 5JSZB 3NEYA 1KMHB 2CBZA 3NTUA 4QXAA 5CIWA 5DLQC 1OPXA 2EFEB 5GJCA 3LLUA 4D4KA 4GDFA 3OE7D 1MABB 4XH9B 1VPLA 4LRWA 4TQ9A 3EIHA 5CYOA 1SVLA 1Z6AA 2V9PA 1GL6A 3RLFA 1OSNA 3RRZA 1ESNA 2AKAB 4NCHA 5EXXA 4R2IA 1F48A 2GK7A 3Q5EA 1JALA 1ZRHA 1J8YF 2WJYA 1II8B 1JECA 4OBEA 3U7EB 2J1LA 2H57A 2OESA 3A4MA 3PUVA 1H65A 1C1YA 1SVMA 2YOHA 4TTRA 5EP4A 3CNOA 3X1YA 4KAXA 2C04A 1CKEA 1ZP6A 4AKHA 1LF5A 4DIEA 2GF0A 2Q0HA 4JL8A 3REGA 2ZXUA 2QMEA 4HUTA 4JLBA 3UANA 3KX2A 2ZJ5A 1DEKA 5SZKB 4HB3A 1XPOA 1N3BA 3QIAA 2DFLA 1B23P 4DZZA 1WBBA 1CXZA 1G5RA 3KTAB 2ORVA 1VYTA 4BWYA 3T1VA 3GJ6A 4U5XA 4FXPA 3ADCA 1G1MA 1GIAA 2AR7A 2OT3B 1Z0KA 5JRZA 1UM8A 2FMXA 2HYDA 3TR0A 3K9LA 3FYHA 4BFUA 1TMKA 1KK3A 2V6IA 3Q7QA 2FDCA 1Q3TA 4KCGA 3VAAA 4DT1A 5GADl 5HTKA 2J7KA 3CR7A 4JLPA 3AP3A 4DSOA 1NVUQ 2ORIA 3LLMA 4TMWA 1W4AA 1AKYA 3W6NA 2UKDA 3PITA 3IUYA 4YXWD 1TEXA 4C0HA 4NCIA 2WHXA 3NKVA 1UF9A 2XTNA 1P2VA 3UIEA 5BYKA 2WIAA 1JPNA 2VHQA 1CR1A 5M04A 2QNRA 2QI9C 4LCBA 2JDIA 3C5CA 2P6NA 3FMFA 1YRAA 4C9BA 3GJ8A 2H18A 3TUJC 4HB2A 1HQCA 1IQPA 1NMZA 2IEZA 3LW7A 1Z0AA 1E4VA 3FPAA 2IF0A 2CHQA 2O5VA 1N6PA 1P75A 4M2LA 1G8YA 3SDZA 2ZR9A 4TQAA 3HR8A 1W1WA 4GT1A 5J4KA 2WM9B 4DSUA 3IHLA 1SGWA 3LAWA 3ZQ6A 3N5CA 3CWZA 3OZXA 4TLCA 2WWGA 2QE7D 4TL9A 1R5BA 1DG1G 3FWYA 5A5GA 4LJ6A 1RYHA 2QSYA 3B85A 1US8A 5FPTA 3AKYA 2IHYA 1Q57A 1SHZA 2ERYA 2EWWA 1FNNA 3BAFA 4NPHA 4GP7A 1A2KC 1JJ7A 1DAKA 1HQYE 1ZCAA 3L0OA 2CDNA 2R8RA 1A7JA 5KDLA 3TIFA 1UPTA 3LD9A 2F3RA 1AQUA 2OXRA 2Z83A 3WMFA 3X1WA 3B60A 2V7QA 3C5HA 3HDTA 3NVAA 4ILEA 2DYKA 4GSYA 1N6IA 2OFOA 5DI3A 4JIMA 4YONB 2W2VA 3U6KA 4MGYR 3B7GA 4LGMA 2YINC 5SZIA 3I92A 1XXHA 2PCLA 1P2UA 1Z29A 2JLQA 3VX3A 2FSHA 3UWOA 4ARZB 1UBFA 1N6KA 2EYQA 2F1JA 4KV9A 4DDVA 4BZPA 3P20A 3H2YA 3WNDA 3U4QB 1VMAA 2FSGA 3PEUA 4V0OA 3I73A 5CLQA 1GKIA 1VYVA 4PANA 3REFA 4PZLA 4EFNA 3I61A 3T1OA 2KBEA 1O3YA 4GMDA 1VG1A 2VL7A 3KKQA 3RAPR 5LBIA 4WXPA 4QGGA 1DO2A 2GNOA 2XSZD 4G1UC 2QTVB 3GFPA 3HPRA 4JLAA 1D6JA 3TSWA 1KO5A 4B6EA 1CLUA 3NDPA 4RD1A 3UG7A 4BLQA 3UWKA 2W2XA 5DGXA 3AVWA 4TMVA 2JIZD 2XOKA 3CF2A 5G3ZA 3AVVA 4ZKDA 2JLRA 3PV0A 3R7WA 2R62A 4TZ6A 4GPTA 3VHXA 2R44A 4PSAA 1FP6A 4F91B 5CJPA 4YXWA 3K70B 4O2LA 2FE4A 4NYIR 2RGXA 4WA7A 1CEEA 3I32A 3DM9B 1OH5A 1G4UR 2D06A 4U02A 2F9LA 1ZM7A 2GRJA 1MH1A 2CK3A 3U4QA 5FUYA 1X6VA 2NPIA 1AN0A 1GSIA 1NBME 3R8CA 3TVTA 1R5OA 5C2JB 1KYIA 4PC7A 3ASYA 2PH1A 5L3QB 3MWJA 4MYHA 2KBFA 3F8TA 4IOKA 1U0HC 1IY1A 4M21A 1XD2A 5DHFA 5HCNA 4MRSA 3ZIAA 3BFVA 2ZE8A 2ZI6A 1HURA 2CNWD 3SJAA 1KI2A 3NWJA 1TF5A 1CR4A 1KAOA 3E2IA 3JVUA 3GLIA 3I62A 3FMIA 3TR5A 2XZPA 4D4MA 1GRQA 2ANBA 3ZZTA 3VKGA 521PA 3Q7PA 3ZZ0A 1EFUA 2GXUA 2A3RA 4DHEA 2XX3A 3EARA 4JVLA 5AUNB 1SQ5A 3OIVA 3W8RA 4D81A 1U9IA 3QVVA 5AUQA 4ESVA 4XSHA 1OT3A 1VHLA 2R6DA 1E94E 2JLWA 2IXFA 5E7JA 3O8RA 2RGGA 2WWHA 5FI0B 2J0VA 4KFUA 3U44B 2MMGA 1BS1A 4FWTA 1R0XA 2A7QA 3CPJB 3PIRA 1OHHA 4YMTA 1E2PA 2AWOA 2Q9AA 2GXQA 4B33A 2V3CC 1M7GA 2KI5A 3KB2A 4BECA 1TU4A 3AVUA 1OV4A 4M1SA 3CF0A 3KKOA 1F2TA 2V7QD 5F2EA 4POAA 2BJWA 4WZBE 4BFZA 2RHDA 2C96A 3AV0B 1MO6A 2FF7A 2VHUA 3THXB 5BN5A 2ORWA 4I99A 4JT4A 4URXR 3PJRA 1L2TA 4CT4B 5KNBA 1FQJA 2QQEA 3VR1A 1NY5A 2A30A 2E87A 2BOVA 3SN6A 2OZEA 4B3DA 2ZU0C 4PZYA 4PHTA 1XMIA 3TLXA 2VF8A 3DEFA 3K9GA 2C9YA 5JJIA 1W0JA 2VHCA 5KOYA 2ZR7A 4XWAA 1KDOA 4XTCS 1S8FA 2YWHA 4L9SA 3THXA 4QHSA 3ZLJA 2GJ9A 3RS5A 4LYHA 4BE7B 1CTQA 2VBCA 2E1RA 4W7SA 1F2TB 1Z3IX 2EFCB 3EAQA 1KDTA 4YLGA 3IQWA 4RJLA 1D2NA 3U60B 5EE5B 4B2PA 2YC2C 2NZ8A 1E98A 1GNRA 1EX7A 3K0CC 4G3XA 3KB1A 1ZM2A 3WHKA 1ZYUA 4NH0A 3B8HA 3QXHA 2CCGA 3CO5A 2IS2A 5TDHA 5TMPA 2CVFA 2DFTA 1TF7A 1ZCBA 1BKDR 4JLOA 4CEIA 1KNXA 1X1SA 1U8YA 2REOA 4OJQA 4C0QC 1DELA 3BFXA 3K70D 1XEWY 2WJGA 5FR1A 2CEAA 1IY0A 4DCSA 1N6RA 1UBGA 2QT0A 4EFMA 3OIUA 5JEDA 2YNMA 3K1JA 3WP0A 2X19A 5HE9A 3QPVA 1U8ZA 2QM8A 1JPJA 4LJYA 3U3KA 3IPYA 1E2MA 1E1RD 2BVNA 4DUGD 2GEVA 3B6EA 3RWOA 1U0LA 2GCOB 4TMKA 1NNEA 1NBMD 1II8A 1FP7A 4XVQA 1IJFA 3LX8A 4CEJA 1XU4A 1NRJB 4FN5A 5AJXA 3BB4A 5AUOB 4TMZA 4TLDA 3I3SR 3B9PA 3PENA 3KL4A 3LV8A 1CU1A 2ZYUX 4OKSA 2JJ1A 3T15A 3MJRA 1FW6A 5AK0A 2I1VB 3PQCA 1E2JA 3WRXC 1RZ3A 3BIFA 2WZQA 3U7HB 2X77A 4OHVA 4Q7MB 5AJWA 4RD6A 2BCGY 2Z4SA 3CRRA 3SC3A 2GAOA 3W3AA 2BDTA 4EPYA 2C5LA 1Z6GA 2IYXA 2GAAA 1ZIOA 4PX9A 2ECKA 5FOSA 4PAMA 4I4LA 3LW8A 2GF9A 3LBNA 4AYXA 1DAIA 4EPXA 5ANRB 2G9NA 2ZYVX 3QBVA 2G83A 2H92A 2FOLA 2V54A 2HT1A 5BXQC 1X3SA 1YZKA 4LBZA 5F9HA 1XMSA 2AK3A 2O0KA 4A6XA 2F1IA 1JAIA 3KKMA 4Q9KA 1SVWA 4GFDA 5TARA 1GVNB 1R0ZA 2BMDA 3NH6A 5FBQB 1NMYA 3MGCA 2PEYA 5D3MA 1JQLB 1P9WA 1YU9A 4Q1AA 3ADBA 4CZ2A 4B44A 2O8DA 1UEIA 4FMDF 2CMKA 3K0SA 4IOJA 4RSGA 3B1WA 5E3HA 1ETUA 2GBLC 2ZJAA 5AJYA 5HCIA 3NC1C 3EPLA 5JJLA 1CBUA 3ZS8A 1Z6TA 2D74A 3V00A 4BRWA 1XCMA 5FL7A 3RYTC 4ZCMA 1KO7A 3K0FB 421PA 3R7WB 5FTLA 1XZQA 5B30A 2PEZA 1M34E 1R0WA 1UJ2A 1E69A 3QOFA 3QXSA 1CR0A 2O8FA 4NP6A 621PA 5HKKA 4PPNA 3T1QA 1MR3F 2QROA 3P1JA 4U00A 5EE9A 4Q66C 3QVUA 3SJZA 1QG4A 4LC1A 3NIBA 2PLRA 2XNDD 1YZNA 2WOJA 3AM1A 1ESMA 4QGAA 2F6RA 1E9RA 3B2EA 1NVVR 2WJVA 4OHYA 2J9RA 5CYPA 4DLRA 2IUUA 1G21E 1XTKA 2OILA 2OSBA 4OK3A 4ZDKA 3BOSA 1PLLA 2IXGA 2VYFA 4DLZA 5JMTA 5JCZA 3QG1A 4L4UA 2GJAA 3THWB 1NN1A 1YRBA 4FCTA 2JLSA 2FG5A 4JJKA 1P7CA 3ADDA 1E2EA 1V43A 3ICEA 4D0GA 1NLYA 2QQ0A 3DDCA 3SYNA 4BFXA 5JI2E 5DI3B 1J8MF 5CITA 5EZ5A 4F93B 2ODEA 2AWNA 1A4RA 1WCV1 2CE7A 3KFVA 1HE8B 3OHMA 5TXGA 4FW9A 1NF3A 2A9KA 2GZAA 3K9HA 2ZEJA 3AF2A 1GTVA 3H4MA 5H70A 2AFHE 1IXSB 4TYQA 3B9QA 2FN4A 2BBTA 4LPSA 4UQOA 5FBWB 5FTKA 4WW0A 2PL3A 3Q72A 1DAMA 1HTWA 1UEJA 3KXKA 1JR3D 1E2KA 2K5UA 3GQBA 3QXCA 3X1DA 4KITB 2A78A 3L0IB 1XRJA 3CPHA 4UNPA 4V0MA 3BK7A 2VPPA 1U98A 2XZLA 1QZXA 4JLNA 4M9XA 4B3CA 1Z08A 4CEHB 4P4UA 1AQYA 3V4RA 2JIZA 1TEVA 2QPAA 2REXB 1G19A 2GETA 2XOKD 2YOGA 3GLHA 4TLAA 5DH9A 3SE0A 4C7OB 1BOFA 1MRNA 4HLQB 3UK6A 5AR1A 1OIVA 3S1AB 3ND9A 4HZUA 4S35A 3H86A 4IFBA 2XTZA 2ZE7A 2R6CA 4HYYA 3H1TA 1LB1B 3T06B 1F60A 1E2QA 4OK6A 1E9EA 4RZXA 3SBEA 1A82A 1SVSA 2NZJA 2IWHA 5JCPA 1Z47A 2W6JD 3KQLA 2AXNA 3DZDA 3EXAA 2BEJA 2CK3D 1WRBA 2WJHA 2UVQA 1SKYB 4D82A 2BHRA 3HU2A 4Q48A 3FOZA 4XJXA 5EXSA 5AJVB 5IT5A 1RRGA 2Q3HA 1U99A 3M1IA 2WAXA 2V55B 4QC2A 2VRWA 2QE7A 2QPOA 1WMSA 2X2EA 3DPUA 1EG7A 5DYGA 3RRNA 3A1UA 3PG5A 4LV5B 1E79A 4CGZA 4URVR 1DVRA 5FL7D 4V03A 1AA9A 1E0AA 3RDPA 4GZMA 5JWHA 5J5CA 4YMVA 1IY2A 1IM2A 1KZGB 4D26A 2RGAA 4H1VA 4LUCA 3SFZA 4M9SA 3J81k 4TYYA 2VP4A 3N70A 1CJMA 1GP2A 2XNSA 3CH5A 2P5TB 1T8UA 2PZGA 4PTLA 3VQTA 1DBSA 2IBMA 4AG6A 4BFTA 2R65A 3GFOA 1AIPA 1IONA 1KOFA 3TE6A 3I5XA 4R71A 1O87A 5CM8B 2QP3A 4PFSA 1OYWA 1JJVA 4YC7A 2VSFA 4UNRA 3A8TA 3RRMA 3FHOA 4Q4LA 3F5FA 2JASA 4TL6A 2OCYC 4HDOB 2O8EA 4DB4A 1E9FA 3HYRA 4JL5A 4C7OA 2ZE6A 3KQNA 1W0KA 1L4YA 3THYA 3CH4B 3CRQA 3OEEA 1S0UA 4MGZR 4BUJA 4HUQA 3FB4A 5L3SB 3E5HA 4IOLA 3CRW1 3OIYA 1M7HA 3LX5A 3BS4A 4JLDA 4HAYA 4KODA 3TSZA 1G8HA 1XP8A 1GAJA 2P67A 2VF7A 2W00A 4LI0A 1YKSA 3U3OA 2ZRMA 1QG2A 2WMOB 4DUGA 2XZOA 2ZR0A 3TK1A 3ZJYA 1FMJA 2QRZA 4E5UA 2PJZA 5JLJA 2GXAA 5IK2D 1G64A 2ZRBA 3EWSA 3TNFA 2ONJA 2VO1A 1CULC 4TYPA 5ELXA 4Z8XA 1G7TA 2G0NA 4MGKR 3TJZA 2FPLA 4JS0A 3P26A 1YR8A 2EU8A 3PUXA 3B1YA 1OF1A 4PO9A 3KKNA 1LNZA 4DLSA 4RFSB 1G6OA 1UADA 2PMDA 2ZANA 4CT5A 5F98A 3A37A 3THWA 3CNNA 1E1QA 4OI0A 4JYBA 4QJ5A 4UNSA 1BYUA 1COWD 1KHTA 1BIFA 4M4SA 5FPSA 2I4IA 3MG9A 3OE7A 1LVGA 3LFUA 3MLEA 4QBFA 2QAGA 5SZHB 4EIWA 2IL1A 2GKSA 2G3YA 3CB4A 3ONWA 1W44A 2ZUCA 1BMFA 3GPLA 4JBYA 2ZITA 1AM4D 3X1ZA 2O8BA 3BH7A 1DARA 3AUXA 1R4AA 4B2LA 1Q22A 5HE8A 4TSFD 5E95A 2MSDB 2WMNB 2NOAA 2O8FB 4Q4JB 2AKYA 4YMWA 4ZCLA 4TTQA 1EFHA 3X2SA 2GWHA 3C41J 1D9XA 4JSTA 2ODBA 3EG5A 1DG3A 3FGNA 1T8TA 4KSCA 1TQ6A 1A1VA 1KAGA 1X8LA 1HUQA 4NE2A 2FZLA 5LB4A 3W3ZB 2XAUA 1W46A 5EJEA 1NBMA 2ZRGA 2XXAB 4P31A 2C8VA 3BFKA 4B3FX 5DN6D 1GG2A 1R10A 5FPKA 4ZDWA 3A6PC 4DEYA 4HB0A 5GJVC 5DYIA 1VDZA 3M4YA 2IA5A 5AWFC 1GKUB 2B6HA 2XB4A 4DDTA 4MRRA 2FFHA 4DWJA 3GLGB 2XJ9A 4IVRA 2ZQ5A 1MO3A 5EP3A 2D7CA 4M22A 1SZPA 1US8B 3KFXA 1OJLA 3DZ8A 4LYJA 5EE0A 4ZPXA 3QG5A 1SXJA 1Q1EA 1U8AA 2ZVQX 4OHWA 2IYRA 4A9AA 3CZQA 2VH5R 3BB1A 3T5DA 4NDZA 2QAGB 4NBSA 2YJTD 4NYJQ 1P9RA 3QKSA 1NN0A 3AP1A 3LBIA 3HYTA 3EWAA 2CJWB 1RRFA 4YMSA 2OHFA 3MCAA 4EPRA 2ODNA 4HSEA 2GHIA 2JDID 4AG5A 1E96A 4M1OA 2QEQA 1E0JA 3K0FA 1Q1QA 2HJGA 1LFDB 1TX4B 2C99A 2KB0A 3PFIA 4PR0A 3T12A 2IYVA 1KO1A 1P3JA 5KNCA 4RD0A 4QGHA 1P6XA 1E2LA 4HLUC 1G7RA 1XNJA 2ATXA 4HAZA 3R9WA 1IN7A 1QHSA 2OXCA 4ZI2A 1K8RA 1R7RA 1QHGA 3RRYA 4IEIA 3EX7C 3QI2A 1XD8A 6Q21A 3RS2A 1XTSA 4S2EA 4I81A 5FUWA 5JHGB 4DB2A 1FOEB 3C4JA 1F3OA 3HP1A 5KSYA 4BLOA 4DLTA 4DT1B 3K09C 1E1QD 5C4GB 4HUQB 2WV9A 4PHHA 3Q85A 5FI1B 1DAFA 1DAGA 3ZVLA 5FR2A 2O52A 4Q00A 4EQ6B 4J0QA 4Q18A 2O8CB 4B71A 2IX3A 3WBKA 3HU1A 4BGDA 4V0LA 1LS1A 2WPDA 2LCFA 1FL9A 1WF3A 4FMBB 3TRFA 5CK4A 4M9ZA 3BRWD 2O8CA 2ANCA 3CX6A 4YDHB 1GM5A 2B21A 3MMPA 1E2NA 2PZEA 3RHFA 4IJMA 2JJ2A 4A4DA 4DCNA 4JLMA 4DLXA 4PQRA 4AC9A 1UKVY 2G1KA 1G41A 2WWIA 4Q7KA 2A5JA 1YR9A 3TH5A 4DLUA 1TQDA 1NLFA 3OFNA 1BYIA 1Z06A 1ZINA 2FV8A 3D7MA 1DPFA 4JLKA 2NTYC 2VSOA 1S96A 2ZYWX 4L5BA 4OYHA 4UJ3A 1KSFX 3NBZC 4WAUA 1KMQA 4OQMA 1EWQA 4CW7A 3KKPA 2NIPA 4RKFA 3CRMA 4MITA 3PXGA 2ZSBA 4V0NA 2PJRA 2WWFA 4QGFA 4LHXA 2X1VA 4N1AA 2J3EA 1AGRA 1PJRA 1GWNA 4IVPA 5H1YA 3AVXA 2Z0MA 1TQ4A 3QEJA 1OIXA 1XDBA 2J45A 4PHGA 3NHAA 4PQFA 1F5NA 2CHGA 4Q4HB 4HB4A 4G5QA 5L3RA 3IIJA 2QTHA 2DWQA 1LTQA 4JLJA 2WIBA 4Q4AB 4GZLA 2QBYB 2BJVA 2O8BB 4ZI3A 1G4AE 2CVHA 3MD0A 2JJ2D 1GNPA 1XPRA 3GLHB 3TQFA 1EGAA 1KK0A 1OXXK 1FUUA 3W5JA 2GXSA 1JAHA 1RC8A 1P5ZB 3TAUA 2RHMA 3CIOA 1EK0A 2W0SA 5KHOC 4R7ZA 4TL8A 1U94A 2FA9A 2SHKA 3I1FA 1XBTA 1G5TA 4W9MC 2FFBA 4P4TA 4JBXA 4XSGA 5UKDA 2OCPA 3GLGA 2IYUA 2ZUDA 3C15C 2AN9A 5KUTA 4W5HA 1R6BX 2P5SA 3C16C 3QSYA 2G1JA 2J46A 4B3BA 4MGIR 4BRUA 1VKJA 2IYQA 1ZMXA 1Q1BA 3H84A 3KJHA 4IXMA 2GEDA 3UXMA 2QSZA 5CIQA 1U2RA 3GLIB 1VG0B 4FD2A 3U5ZB 2C03A 3ICQB 4H9GA 5FOUA 4B47A 4EPWA 4GNKA 4AKIA 4KXFB 3CBQA 1E3MA 721PA 4KJZA 3AF0A 4Q4JA 2Z6VA 1NIPA 4LZZA 2F1HA 1IN6A 1G7SA 4IW3B 2BKEA 2OO7A 5FBVB 2DHRA 4ZKEA 2RGNA 1XEXA 2CLDX 2E9SA 1Q44A 1AK2A 3N2IA 4KO8A 4V0ME 1G3UA 3CM0A 4EJSB 3P4XA 1DTSA 1XZPA 4PZZA 3T5GA 4WZAE 3ZD6A 2QGZA 3GLHE 1BMFD 2QZ4A 3VKWA 2O0HA 1G3MA 4F7WA 4FIDA 2A5YB 3MRSA 4LBYA 1XWIA 2EWVA 2QMOA 2YYZA 2YHSA 4Q02A 5E4FA 4RFSA 2ZJ2A 2IEYA 2QMUA 3WBJA 3EC2A 3SI7A 3FHCB 4QM7A 3VHLB 2CL0X 5FOTA 3K70C 1D2MA 1G3QA 1NIJA 4B34A 4TYWA 4N3NA 1S1CA 3TSOA 1CJVC 3GJ0A 1EFRD 1NY6A 1E99A 4OHZA 5IF9A 2ZRHA 1QHNA 3AH8A 2AD5A 3P4YA 1PUIA 2WOOA 3O8CA 1XXHB 3FKSA 4OQXA 3FMOB 3C14C 3SZRA 4Q9JA 3ASZA 1GILA 1E6CA 1ZIPA 1WP9A 1Z5ZA 1T3SA 3IO5A 5JECA 3SR0A 1CRQA 2WKRA 4LWZA 1QVRA 2QN6A 1DO0A 1J7KA 2NO6A 3M6AA 1EWRA 4PAOA 1COWA 1KNQA 4Z54A 4LK2A 4HLUA 1JXOA 1Q1ZA 2W2TA 2ZI5A 1KY2A 4JT2A 2RB4A 3WNBA 2P6UA 4EQ6A 3QKRB 2CLSA 5J4YA 4BFYA 3LNCA 1N25A 3AUYA 5CDFE 4UNQA 1W49A 1S3GA 4WOPA 4QG7A 2Z5FA 2ONKA 2X2FA 5G3YA 1IN8A 1U0JA 4AK9A 2BBWA 2D3WA 1QBKC 4TMXA 1EFRA 2HF8A 4B2IA 4A0GA 4LYFA 3RS0A 1CJKC 5BWMA 3JVVA 3HWSA 4FINA 2BMEA 1G9XA 4Q1CA 1RW4A 1S9HA 2MSCB 2YVUA 2P2LA 2IYYA 4HDCA 4F38A 1GOTA 5FFMA 1OH7A 2HCJB 2IYWA 4AYWA 4R2HA 1RFLA 4TLEA 1NN3A 4M1KA 4Z1MD 3BJIC 5C1BA 2FFAA 1KK1A 3TQCA 4BLTA 2EFHB 1PUJA 4B48A 4UXHA 1Z2AA 2FSIA 1D5CA 2C98A 4KSBA 4JL6A 5FOVA 2GZHA 2B8TA 5LDDC 4OL0A 1AS3A 1KI6B 4Y0AA 1XEFA 1MOZA 4Q7JB 4CYMA 4A92A 4GI7A 4US2R 1N5JA 1QRAA 3U6BA 2WJIA 4A0FA 4QFMA 1XTJA 4O3MA 4GL2A 1KGDA 2ZJ8A 3IIKA 4Q5IA 4OJKA 2G77B 3O8DA 5FOXA 1D8TA 1YJ5A 3SJCA 1NJFA 5H68A 5KSPA 1FMLA 1OLOA 1OXTA 3EC1A 5J4HA 2AX4A 4CF7A 2ZRDA 4K8OA 4AD8A 4MRPA 1JR3E 2FWRA 2F55A 1IXRC 2ZAMA 4NYMR 4NONA 3SS8A 5EE1A 3IPXA 2EW1A 2OUKA 3OF5A 5FH9A 1G3IA 1NKSA 1ZBDA 1ZUNB 4RVCA 5HPYB 1KO8A 5B2ZA 1AJEA 1KSGA 2OLKA 4TWZA 1VCOA 1HY3A 3I72A 2F9MA 1Z07A 2OE2A 2ZRJA 4RZUA 3RANA 4AWXA 2W0MA 2ZJOA 1KJWA 4A0HA 4AURA 1G8FA 2IYSA 5D3MB 3EA5A 5FOWA 2ZRLA 5CJ2A 1NG1A 5A0FA 4F92B 2QORA 5J4LA 3R9IA 4L8GA 5CM9C 4MKGA 4C0SA 1KJYA 1Q0UA 3OESA 4M8NE 4Q9LA 4EUNA 5HKKD 1HT1E 1IAQA 4XWOA 3THYB 3OEHA 2ZRFA 3KUDA 2J59A 1VYUA 4DSTA 2ZRNA 3GP8A 4CRWB 3KJEA 4RFVA 3BH0A 4FWIB 3EIQA 4QKQA 1FZQA 1ONBA 4M1MA 3FMPB 1JR6A 2BEKA 4BLPA 2IYTA 3AKDA 2C78A 3IIMA 1NVWQ 3EPJA 1ZUIA 2IK8A 2GBLA 1L7VC 1KMHA 3HU3A 2VA8A 4ACAA 1QHIA 1Z6XA 5JSZA 2HV8A 3IBYA 4LDJA 5TB5A 1Y63A 3TUIC 1XTIA 1QHXA 3U3RA 1Z8FA 5GVRA 4US0R 3VR3A 3Q9LA 3SJBA 2ZUBA 2JGNA 4QNRA 1LV7A 1QVAA 4X8HA 1Z0IA 4B32A 4F4IA 3BH6A 4X8MA 2MSEB 5D3QA 4XVRA 1GL9B 1TQ2A 2GDJA 1KKMA 2CL6X 3A1VA 1VIYA 4PXAA 4QRHA 2YKGA 3G5UA 2IF2A 3LDAA 4LBWA 4UKDA 1ODFA 3VR4A 4C0BA 5EP2A 5GJBA 4II7A 3LA6A 3A1WA 1TAGA 4R98A 3T61A 1W36D 1PV4A 4Q9IA 3BB3A 2BIFA 3PVSA 1SXJD 4MRVA 4JSYA 4ARZA 1CR2A 1G7CA 1U90A 2RGCA 4K46A 4E07A 2W58A 3TW4A 5L3SA 1W36C 3BERA 4MH0R 4DDWA 2W83A 2ZS9A 3NDBB 2ATVA 2PBRA 4DCVA 4NU0A 5BQ5A 2IUTA 3VTKA 4DJTA 4G5SA 2GK6A 3NBYC 3O8BA 4AKEA 4DEXA 1ZNWA 2ZS7A 4IDNA 3VFDA 3W34A 4A82A 4CEIB 1Z0DA 2BV3A 5J47A 4DLVA 3O47A 4WVFA 1YVDA 2EYUA 4WBSA 3ZDQA 2OG2A 5E7IA 2QGNA 2NMVA 1T0JB 4IDQA 2BWJA 5L8VA 4MRNA 2VSXA 4YDSA 1S3SA 3UMFA 4BQSA 3SEAA 1GNQA 5HZKA 2FGJA 3ZGXA 1IHUA 4ZIRA 5DISB 4PC2A 4C2TA 1Z2CA 2F43A 3OIWA 3TUZC 2VP5A 2ZRAA 4JKYA 4US1R 2FX3A 3GJ7A 3BE4A 4N0DA 2GCOA 3ZYCA 2WICA 2FGKA 3IEUA 2BBOA 1G8PA 4LSGA 1CJTC 2AD1A 3D8BA 4URZR 2BC9A 5FUVA 2JLZA 5H8WA 1L4UA 1FTSA 3SYKA 2D2FA 3DMDA 1OE0A 2OBMA 4NL4H 3U2QA 3VX4A 1RRPA 1T3LA 2V4ZA 3AB3A 2QA5A 3S1AA 3ECCA 4BZQA 2DWPA 4PSKA 2FPMA 2ZRKA 2GJSA 2ZJZA 3V4FA 4DXAA 1CRPA 2PCJA 1K6MA 1OFTA 2ZE5A 5JI3E 1YQTA 1M74A 3QF4B 4PO1A 1T4GA 4W5WA 1DE0A 2WWYA 4BEBA 5FTNA 5HZHA 2CHVA 2B92A 1I4TD 3KQKA 2V6JA 1XMVA 5G40A 8OHMA 4Q9HA 5CB8A 5KSZA 1G5PA 1KI1A 3ZIAD 3TW8B 1SVKA 3PUWA 2ZROA 4LJ5A 2CNWA 2V1XA 4KBFA 5KNDA 4OQFA 3U61B 3SQXA 4TTPA 4P3YA 2HF9A 4FMCF 4PPQA 4M0LA 3WP1B 5LD2C 5JRJA 3KTAA 4D80A 3VR2A 4OQLA 1HYQA 5IK2A 2GCNA 2B7BA 2CL7X 4OQNA 1PLJA 1RVDA 3JZMA 2LKCA 4JVNA 4PSVA 4Q7LA 1W4CA 1C4OA 1E79D 2HEIA 1X86B 2WSMA 2GVZC 4KYIB 5L3VA 2IS1A 4LJ9A 4Z1MA 4IHQA 3QE0A 1K5GA 2GVDC 2FU5C 1ZJ6A 2UZIR 3GJXC 2EFGA 4QBGB 3W9YA 3IKJA 3SNHA 2BM0A 1KI4A 4IDPA 1CP2A 1OIWA 2AL7A 4HDQB 2GZDA 1WBDA 2FZ4A 2CCKA 2R6FA 2XB2A 3LBHA 1E2IA 1E9BA 1R2QA 1QHHA 1W4BA 2OM2A 4B73A 2AK2A 1T91A 3GLFE 2JLUA 1OH6A 3SOPA 4IEEA 4C0JA 4IXNA 2F43B 3GLIE 4I1SA 3D3QA 2ODWA 1P2TA 1XD9A 1U9IC 2A5DA 5DO9A 3N2EA 4A8JB 4X8LA 1XB2A 3RSOA 2PX3A 3BBPA 4FI3C 3AF3A 4TSFA 3T35A 1HA3A 1LW7A 4D6PA 2V1UA 2HXSA 1NSTA 1OB5A 1W0JD 2Q9BA 3C8UA 4ZDIA 1P73A 4V02A 5IHPA 4XVUA 2XGJA 4WIAA 3K0AA 3MAAC 5TV2A 1J70A 1N6HA 5BYJA 4KFSA 3SHFA 2I3BA 5SZJA 4NYIQ 5KU1A 2NO1A 2KSQA 1UKZA 1YE8A 1QHHB 2Q9CA 1ZM4A 3FTQA 3MUFA 1ZU5A 2ZM5A 5DN6A 2LWIA 3L8YA 4KBGA 3GLGE 2GILA 1OKKD 3G0HA 2PX0A 1GZSA 1RJ9B 4ZDJA 2FH5B 4NCJA 1EFCA 4PPFA 1KKLA 4RD2A 1OXVA 3EZ6A 2C2HA 5GVSA 3UATA 3PUYA 3TBKA 4PC3A 4NCKA 3WNCA 3QEOA 1XCGB 4B3XA 2QP4A 3Q8XB 4F4JA 2XEXA 3NBXX 4XWKA 5EZ6B 2DY1A 1OFIA 3D31A 4DCUA 5KPDA 3AQ4A 1EESA 4DSNA 1N0VC 4RY2A 3K0AB 2NO7A 1Q20A 2GJKA 4A6PA 3K53A 4BFWA 5FPHA 4A2QA 4ON9A 5EXTA 2ASEA 1OXUA 2OCAA 4B6FA 1F2UB 4EPVA 3W6PA 2OLJA 1MT0A 4A2WA 4QBIA 4OHXA 4QOSA 5DIFA 4BLRA 3MSXA 4JMPA 4A15A 2J0QA 4JVSB 4LV6A 4A1FA 4IDHA 3AVOA 1KIMA 1M1YE 1NMXA 3AF1A 1N6LA 4EJSA 5B57C 3AVYA 1NSFA 1ZC3A 1ZM9A 3K9NA 4UXIA 1IJEA 2BCJQ 4C0AC 4HLCA 5G53C 1OB2A 4MKHA 1JEDA 3PUZA 2FFQA 1TL7C 1E0SA 2RH5A 3IO3A 2JJ1D 2VP6A 1G16A 2C77A 1MO4A 2BMFA 2LKDA 1GKYA 1E2GA 2VP0A 3CX7A 2PMKA 2FEMA 4B43A 4G0NA 2NO9A 4GOJA 2J0SA 2DR3A 2H16A 1H8HD 4MUAA 3K09A 2VQSA 3FFBA 1UKYA 4FMDB 4Q03A 2RGNC 1I2MA 4QJ4A 1KO4A 1L8QA 2RKOA 3FE2A 4FCVA 3P27A 4LJ8A 5EUQB 4I1VA 1P9NA 3AP2A 3GEEA 3A4NA 2QP9X 3EZ2A 1UKEA 3PEVA 3L0SA 1MO5A 2GCPA 3KUCA 2DFNA 2WSSA 1P4SA 3QNUA 1GITA 2VP9A 4QL3A 3CPEA 2VHTA 1NJGA 1T3HA 2VP2A 1EFTA 4KI0A 1J2JA 3K8YA 2ERXA 3FKQA 4Q47A 2QMHA 3BORA 2VTKA 2Q6TA 3R9XA 4XD7D 5JFGA 4UXJA 3U44A 3TMKA 1KDPA 2XJ4A 3GEIA 4KVGA 2FEOA 1CIPA 4EKDA 3AKEA 4C3ZA 2IC5A 2BMJA 4QNMA 4URUR 4KYUA 2QY9A 1YZQA 3L2OB 3RS3A 1XCPA 3EASA 2WKQA 1G6HA 2IHBA 1IXZA 3HJNA 121PA 5LB2A 3CWQA 4RKEA 5CB6A 5B58C 1KTVA 2JAQA 2OAP1 5DE3A 2QBYA 4Q4AA 1WQ1R 3B13B 5E7MA 4XOIA 4RZ2A 1SXJC 2AXPA 5JBQA 4C2UA 3CUEF 3RVBA 5CK5A 1J90A 4TQUS 3PEWA 2MMCA 3QXXA 2ZETA 5F3WB 1T9HA 1P61B 3UKDA 1ZD1A 4TLBA 3I8SA 1Y3AA 3GJ4A 2BM1A 5JHHB 4I1OA 2ZSAA 5JWOA 1JXMA 3B1XA 2XNDA 1KSHA 3JZAA 3IILA 3VMFA 821PA 1I4LD 1KZ7B 4DC9A 2WBLC 4JVMA 3X1XA 1TTTA 1SKYE 4P0TA 4XD7A 4G01B 2F1RA 4PC6A 2RGDA 2A2ZA 2CXXA 2D7DA 2X8AA 3SBDA 4ZIRB 1VCMA 4OI4A 3H0KA 3U3JA 3IEVA 3HR7A 1GRRA 1J99A 3RNLA 3DKPA 2PT7A 2JJ8A 1DOAA 4DRZA 3TKLA 3CR8A 1Z63A 2YWEA 4Q1FA 4YQFA 3F0TA 2H17A 4MDEA 3VR6A 3WYFA 2CJWA 4P33A 4AYTA 5JEEA 4DKXA 3KJIA 4G5OA 2YOFA 3ZZUA 2G6BA 1G291 1UBEA 3LH5A 1HE1C 4JKIA 3WMEA 1XPUA 1OFUX 4C4PA 1BO6A 3ZVMA 1JEEA 3R20A 4MYTA 1SXJB 3RC8A 3DMNA 1XEXB 2DBYA 4QJ3A 4NKRA 1RE0A 5F9FA 2QAJA 2D2EA 2DPXA 1H8HA 4HI0E 3OEHD 3DOFA 1JR3A 5G41A 2PT5A 1T5LA 4R9UC 1OXSC 3KJGA 3QENA 5IDVA 2GA8A 4L15A 4ASUA 1T5IA 4BPBA 1Z0JA 1KY3A 1Z22A 3THOA 2IYZA 4PPGA 3BC1A 3CZPA 3LY5A 4M9QA 4JYCA 3QQ5A 3EZFA 1WDTA 2VLIA 3UG6A 1II0A 3BGWA 3QPUA 3QUSA 4QM6A 2W6IA 1D9ZA 1Z28A 1R8SA 3V9PA 1ZD8A 4A0RA 1RYFA 2GESA 3AGQA 4E22A 4BFVA 2W6JA 1ANKA 1YZTA 3DHWC 2N1BA 3L82B 5B64A 1ELOA 2QPTA 2HLDA 4LHZA 1RPZA 4XTRA 1W36B 4BEJA 5J4VA 4YMUA
chains in the Genus database with same CATH superfamily
2NSJA 4MZXA 3A9TA 5CEJA 3FWNA 3VU9B 3FDZA 5K03A 4F4DA 1QWSA 2HJVA 3OU2A 2LVBA 3NOVA 4PNZA 2XCLA 1GZ4A 4ENUA 5KNBH 5LSAA 2RMKA 4HN4B 5EXPA 4HAUA 2RGRA 3FVRA 4TL7A 1OGIA 2XEDA 2HRDA 1GQSA 1A4XA 1DQYA 2VAMA 3QJGA 4BUZA 4C2BA 4LYDA 4K05A 1N7JA 4P6VF 1NLMA 3UMJA 3R7DA 2DC1A 3KXLA 2ST1A 3CX4A 4P53A 4DIBA 2I9KA 4JYPA 4E03A 1JQJC 1NVVQ 3KYDB 1G17A 2WQZA 3OCWA 5FWYB 3DOEA 3ETJA 2WD7B 1WMDA 1A4IA 5DI9A 5J40A 1S4MA 2CCJA 4U0JA 3BHMA 1QQBA 5GOTA 2E1PA 1R6DA 3K9BA 3D8UA 4IMPA 5F7XA 2I3DA 4L6AA 3IVMA 5CG1A 2NPOA 1U02A 2ZYDA 3EGWA 4B8ZA 3O1HB 1MRSA 1JZTA 1Z0ZA 3ZEAA 1UT5A 2Z30A 2FSFA 1DS6A 1L5VA 4IXTA 4NJOA 1Q74A 2RHLA 1IJKA 4MYSA 1ZIYA 3RSLA 3SXJA 3H2HA 3V7WA 2NAPA 2FZWA 2Z2IA 4EAAA 4LHWA 3TX2A 4CVNA 4X65B 1CDEA 2P9YA 3O73A 4Q1VA 2OBYA 3OZGA 4UU1A 3ZLBA 3T54A 5DHRA 1LK0A 3NTOA 3WIEA 4UZFA 2CSUA 1I4EB 4HEJA 2C3UA 3AF4A 1QXSA 2QN7A 3B82A 1MTOA 3C3CA 1XO1A 1WW3A 1BG6A 1VJRA 3DG9A 2B8NA 4UUMA 3OUZA 5EQJB 3WYDA 1H4SA 3H2SA 1ZUD1 5JO0A 2QR3A 2WHRA 4MLCA 4S04A 1GSAA 3L7YA 3QKTA 3U39A 3RUAA 1PNTA 2N46A 2P4QA 3VSCA 3I4LA 4TL6A 5AUPB 2B1RA 3WZMA 5B3KA 4AS3A 4PLHA 4C0LA 4NYJR 4RD4A 1A7AA 3I5UA 5G0WA 2YXEA 4BU1A 3NHLA 3Q4GA 1C9YA 5L4NA 5JXHA 1IOVA 3RTBA 3EDCA 4BASA 4H7JA 3IQDB 4ZARA 2HU7A 3PQ2A 3A05A 1I4OA 1UZLA 3PPIA 3OZRA 4MDYA 2QK4A 2VCYA 2QNIA 3L1HA 1UANA 5K8TA 1V6AA 3GP5A 3UJDA 2YWCA 2WU3A 4Y6OA 5I4CA 2PHZA 3G2IA 3GRVA 5A4JA 5JS6A 1UJ6A 2GPTA 3T34A 3TW0A 1XFDA 1RPJA 2GYVA 3WLJA 2XXJA 3ZHZA 1GUZA 4RKYA 2AIRA 1ISRA 1UK9A 3NGXA 2FPRA 2YMPA 2ZVPX 3UMSA 1W47A 2I4RA 2ZTHA 2A59A 2PVPA 4H1UA 1CQZA 16PKA 1VA4A 5G4LA 2QTFA 5AIBA 1P80A 3CUKA 3N2ZB 4EIWA 4I1UA 1MG5A 5DCUA 1TEZA 4W99A 4AP9A 1E1RA 3KXIA 1L5HB 1GLNA 1Q0ZA 1S6YA 3V34A 4DBLC 3GDOA 1WXDA 4DMCA 4ZRMA 1XZLA 4RX1A 4YJKA 1AV7A 3QXGA 4I36A 3JQ9A 3U7JA 2ZJBA 1B2LA 1I24A 1ICEA 4NHOA 4QYTA 5F51A 3VNUA 2H85A 1E2UA 3F1LA 5C7IO 1ZZEA 3O4GA 3OP4A 1GZ6A 1VYHA 4PQGA 4D0NA 1BWQA 3AVQA 3OAAA 1IHYA 3JQQA 2VK1A 1KFBB 1YB4A 2C97A 4M1WA 5T4HA 3ZCTA 5LXTF 4JI5B 3IQEA 4PFKA 3ZE0B 4W5OA 1V5EA 4S2UA 4BNTA 1DIGA 2JBWA 2QVBA 3Q3JB 1HYGA 5I8WA 1V5WA 5EP1A 4YMIA 1R15A 4QO8A 3O8QA 4CJXA 2FX5A 1SRQA 3N2KB 4AQYB 4IFIA 4IDOA 1Z13A 3EZ7A 4XGQA 1R18A 2ASVA 5JD4A 3PNYA 4H59A 3BICA 2C1ZA 1JVNA 4JXJA 5LYYA 2WUGA 3H3XA 1NNUA 1CD5A 1YGPA 2F3UA 1E7QA 1B26A 2VF4X 4YO8A 1FUEA 2GLUA 3OLVA 4ER0A 1WEHA 5KCZA 2CV2A 4BKPA 2P3OA 3WL5A 3ZDCA 2HA0A 2QQGA 1M2OB 4L16A 2Q6VA 2EAUA 5ECYA 2WWWA 5KI6A 5EL0A 3UW3A 1P4AA 2EQBA 4NDAA 4H1TA 1FX0A 3VHQA 3WRVA 4BO5A 4ERNA 1C9NA 2XUOA 3PE3A 1SPXA 1U4NA 1HEUA 2DPGA 2GM3A 2RD2A 3NS7A 3R0QA 1X7YA 3IQXA 4F9EA 1P9LA 4C6HA 2D1FA 2Z58A 4NU6A 1X8JA 2RHRA 1KEVA 1OA1A 1ZNYA 2G5GX 1GADO 1JLLB 2WSSD 3IXLA 4U2FA 5H82A 5HNKA 1NVKA 3IAM6 2FJUA 2QDKA 2G8NA 4RF4A 1JU9A 2G76A 3I28A 3JATA 1L5GB 3TFQA 4CCYA 4EPTA 5TQVA 5C4MA 3VOSA 5JWRA 4XARA 1Q2XA 1K3UB 3W1EA 4ZCQA 1U5AA 1R0CA 5P21A 4TT3A 1HFEL 3NHBA 1VTKA 4NZYA 4R3UC 1E32A 4B0OA 2JLWA 4JQCA 5EZQA 3RIXA 1EBUA 2AR9A 4Y1RA 1N5KA 2R751 3MRTA 2VA9A 1R9GA 2C9ZA 3EZLA 3H9GA 4RTOA 1K8YB 2QL6A 4KFRA 3RS9A 3U49A 5B6IA 1ZAKA 3F8SA 3EQ2A 1M2NA 3AF6A 1JVBA 1H1LB 3L8EA 2Q3FA 2EEPA 3FNGA 3LHDA 2XKJE 2Z9BA 2AOTB 1UJMA 3N7UA 1TCUA 4X9XA 3VNVA 2JBAA 1O08A 3VSEA 1T36B 3SKVA 3F4KA 3FCCA 3VYWA 2WPDD 1N2IA 1DCKA 1A3CA 5IMBA 3HSYA 4I4TF 1YVPA 2DQSA 1N57A 2IBTA 3KOUA 1NLZA 3KYJB 1SOUA 1PD1A 4JBWA 4K9RA 3UHPA 1N6OA 2YXPX 4ZO4A 3K9FC 3PNLA 1ZKMA 4DXDA 2R5FA 2ZIXA 4J2OA 4V3BA 5IKEA 3K1ZA 1YDHA 4LGVA 4MUKA 1Q14A 2V5UA 7AT1A 1RM3A 1JUDA 2P9QA 3ESQA 3HB0A 4LX0A 5L3QA 2QM0A 4D43A 1HDRA 1V8ZA 1ZW6A 4RETA 4C4OA 1YOBA 2C5GA 4RZ3A 2JLXA 4RF2A 5KIAA 2V8OA 1L4LA 2HLPA 1Z83A 3KD2A 3HYNA 2H07A 4UEQA 4KR2A 3Q87B 4CQMA 2JFBA 3F97A 3MLBA 3EA4A 3K1YA 2O14A 3L7BA 3OTHA 4NV0A 5BMVF 1PLKA 2I3GA 5IXYA 1RBYA 5A7HA 4BFLA 2C2GA 1RWWA 2QLJA 3EA0A 1YZUA 1UUFA 4OA5A 1CS4C 4RPCA 1MXFA 1E9DA 3E0QA 1O89A 1F6BA 2V7BA 1SUPA 3D8TA 1SHKA 3D3NA 3HMQA 3M3HA 5HVNA 5K01A 1RM0A 4F60A 1S2NA 1E9VA 2WF5A 3GMTA 4YB8A 1TB4A 5CD1A 3PSHA 3P71T 5DBEX 3SM9A 2OAGA 3PCTA 1OA0A 1R4NA 4FLFA 4MYUA 4BYGA 3K96A 1EX6A 2AR0A 3VGJA 2OMKA 3HYSA 5HR5A 2Q5HA 1XK7A 2PSEA 4KXXA 1E3IA 4BZXA 3SGLA 1H9CA 1IN5A 1JQ5A 3VVLA 1Y4SA 3UGKA 1WXXA 3COSA 4FYXA 4DCTA 1EUZA 1PT7A 1FP4B 2WE7A 3KDSE 1ULSA 5IMSA 1T6NA 2QVZX 4FCWA 5FHRA 1TKAA 2NLOA 2NUBA 4QE3A 2EZ4A 5AKXA 3PFKA 3ERCA 2QM7A 1TYZA 5G0TA 3TRJA 3WSTA 10MHA 1JHUA 1UOEA 4XX0A 1N5OX 1XCLA 2NT4A 3DLIA 4CU2A 4ZN6A 2XIJA 2DWOA 4LV8B 3VPGA 1XCJA 4C30A 2LCIA 1GDHA 5HJ5A 9LDTA 4KHZA 2CY0A 3DHYA 4KX5A 5L40A 1ZMRA 1YDWA 1UQRA 2GNPA 1QMPA 3LRPA 3W5VA 1L6IA 3G68A 3NFRA 3D43A 2R66A 4G1EB 1W5BA 2IY7A 3RRBA 3L0CA 5FBLB 4RK1A 1Y9DA 2D2XA 5F12A 3RYIB 3BBLA 1XF1A 3SICE 2ZZKA 3GVIA 2XGOA 2I2WA 3G2PA 4P38A 2IU3A 2ARKA 1LLUA 5BMOA 1K3TA 3JAKA 3BTUA 4Z51A 1T2NA 5BSMA 4QELA 2C2WA 3IP1A 4CKXA 1DV1A 1XFAA 2IW1A 4N82A 1EU1A 1Y3FE 3CF6R 4QHYA 4HVLA 4Z8YA 4YRAA 1XQYA 2Z3WA 3BD9A 3GZNA 1C14A 4Q1DA 2IYLD 5HIAA 3TNLA 3LPCA 3EFOA 4MINA 5GJWC 1YB6A 3ETCA 3I8XA 1KDYA 2RDMA 4ZU3A 2R1UA 1YCHA 4LYAA 1W0KD 4Q37A 5K0GA 4D25A 4R68A 3ZE9A 2Q5EA 3L0PA 1J1ZA 1B2RA 1UH5A 2O1EA 1P3DA 4CDGA 4D0LB 1ESEA 5KTKA 1ML4A 1ZHHA 5E2IA 4LDRA 4RCVA 4YRMA 2C92A 5T64A 4Y2XA 4INAA 1DEAA 2Y0BA 1LLCA 3EN0A 1I7QB 4URWR 1JILA 4XIGS 2DPHA 1ECGA 2FQ1A 1LW6E 1MJGM 4GOXA 4GZ6A 4QD3A 2B7LA 4RPKA 1W5TA 1YDFA 1GSOA 4ALJA 4S05A 1JPVA 5CFMA 1JG6A 3MPOA 3VR5H 5JJKA 3FLAA 5ALMA 5EXEA 3E9MA 5AHRA 3UT5B 3FTEA 1ISMA 2OGSA 3P9RA 5DDIP 1HK7A 3BIXA 1HPLA 3E9ZA 4KKVA 5AK3A 4AJ9A 5KYXA 2WHYA 5D5HA 3TYXA 4N3GA 1ABBA 2ZREA 2EBWA 2PRYA 3O7MA 4JR1A 4QFDA 5C81A 4Z2AA 3WDKA 3SHWA 5BW8A 3CW2A 3HXPA 3ZGOA 1ND6A 2OFPA 4LJ7A 2QD1A 4CEHA 3SR4A 3EZ9A 1L8LA 3QQPA 4GQAA 2HAEA 2PZ8A 3STUA 3IP9A 2AEFA 2ZRPA 1MKYA 1N4DA 2B4AA 3IB3A 1NKVA 4OSEA 3T0FA 1MAAA 2CFRA 2W8BB 3I09A 4X3PA 2NVBA 4FM9A 5JE8A 2O50A 3IDQA 5TX7A 4F6LA 2WF9A 1RQGA 1TT7A 3E3MA 3GLTA 1X1RA 1UJ5A 2O3RA 2AHOA 3AIOA 2ZT7A 3HXQA 5I7FA 3AONB 3FVQA 4QHTA 2ZXFA 1DFIA 5TGTA 2ZIWB 4OX9B 3IA7A 2QRNA 2X41A 3A1TA 3FHTA 3QXJA 4CR6A 1JG7A 1RI5A 1EGHA 3C2QA 4DIMA 2YW9A 1KC1A 2B2NA 3H5TA 4ABYA 3L6EA 4OXQA 5IF3A 2ZZMA 3FGPA 2I9PA 1F0YA 2Y6UA 3WXMA 5LP6A 1Z9BA 2O59A 1Q21A 4TYNA 1XDWA 1TT5B 3Q5DA 4RMNA 2GEFA 4FS3A 1MEEA 3H04A 4NLLA 1YBVA 4B7CA 5BUQA 1ISGA 2Q50A 3AJRA 4WZZA 2VHJA 1ODCA 2D4HA 4QASA 4QXMA 4XB6B 3ZWWA 2TMGA 5KTYA 3BWDD 5CA0F 2ZI7A 2OCBA 1UAAA 1NYTA 2ZBUA 4NBNA 4BIMA 1MQSA 3TXXA 3ZWQA 2ECQA 3KQHA 2PH5A 4MAAA 2IHNA 4H3SA 3JYNA 2FSPA 2J7PA 4DRXA 5HILA 5JAHA 221PA 4C89A 2Q5JA 3H2KA 5CA1A 1BX1A 1E1MA 1RPNA 2I62A 5BOSB 4J1TA 3TAHA 3P2EA 2HYIC 3IRUA 1P6UA 2NO0A 1PHRA 5I4BA 3SWWA 2WTUA 1EXDA 3LX4A 1DADA 1WW2A 1F8UA 1MJ5A 3KQPA 3OM1A 3PNSA 5FD8A 3RU9A 2DLDA 3UENA 3AZQA 4D9BA 1DQNA 2K4MA 1AQLA 5AKZA 3GZTB 2FW7A 5ALFA 2NUAB 4B7AA 3EPKA 3O3MB 1FFXB 3GRKA 1ULZA 2OLEA 3WS7A 2CBZA 3GCWA 3NTUA 5K4HA 1Y34E 4TS9A 4PLGA 1KP9A 4X6YA 5DX0A 4K9OA 3LLUA 3AJAA 1ORVA 3S5JA 4X91A 1IEXA 4GDFA 4LRWA 1ZGCA 1M8GA 3EIHA 3QFSA 4TQ9A 2ILTA 1OZ0A 3TZEA 3S0JA 2IH4A 1WUJS 1LJUA 4YY3B 5HQTA 3H11A 4J3JA 3RE1A 3UV6A 5B7QA 2AUTA 1KOLA 5FB3A 2Y76A 4R2IA 5IP5A 3AF5A 2C4WA 1MZVA 2J4FA 5HK9A 4MV7A 3IE1A 3PFCA 3U7EB 1II8B 1MEJA 3OFJA 5T7BA 4MP8A 2OESA 3A4MA 1C3OB 4CKEB 3EX7C 4TTRA 3X1YA 1IWBB 3V8RA 1A2QA 2UXCB 1ZRSA 4TXNA 2ADFA 1QE0A 2C82A 2HQBA 1LF5A 1C50A 2I5PO 3L92A 4TV8A 4AKHA 2GF0A 2Q0HA 1RXYA 1XHEA 1MJFA 4HL6A 2OGUA 3H9JA 4JLBA 3L8GA 4NZOA 3AFNA 3PPYA 1Q2UA 1N75A 1KEKA 3LP8A 3ABOB 4IP0A 1JFLA 2C2OA 1N3BA 4YH1A 3ZI0A 1B23P 5GY7A 5JYDA 1WBBA 1CXZA 1G5RA 3QLUC 3E9QA 1AO3A 3UUGA 4AMUA 4HNGA 1GFZA 1ZOOA 1HG1A 2E4WA 5EJGA 4KIJA 5FNVA 1JTFA 3UQYS 2Z3ZA 3T1VA 3ABQB 4WOKA 4U5XA 1MHPA 3IVXA 4CM8A 3ADCA 3T9CA 3MWDB 1GIAA 2OT3B 3B1FA 3RYFB 1UM8A 3TR0A 1I7LA 2DOKA 2XF2A 3K9LA 3CXUA 3EUEA 4BFUA 1TMKA 4DTCA 2V6IA 1HTTA 2CYCA 3KTFA 4KCGA 4W1SA 5DNAA 4DT1A 4QFBA 1C8VB 2J7KA 3CR7A 4HVTA 4DXHA 4YMHA 2XUHA 1NVUQ 3P2JA 1A5BB 4Z9BA 2ORIA 3E22B 3W6NA 1PJZA 4N54A 2BMWA 1WZ2A 3IUYA 4YXWD 1U1FA 1Y98A 1CLEA 2WHXA 1YL6A 1W30A 4R1QA 4D0SA 1P2VA 1NVFA 5FBKA 1RLJA 2O2CA 1QTIA 3EJWA 3FUXA 5AVQA 5BYKA 5HUJA 3L4EA 4M38A 5FFFA 1JPNA 3AYZB 4KR7A 1CR1A 4ND6A 4GOLD 1MMFB 2QNRA 1OLXA 1IE3A 1OPRA 2SECE 3VISA 4HAOA 5K0SA 4D9HA 2OORA 2QE6A 4BQPA 2HPVA 2V03A 3P9YA 2P6NA 4C9BA 2BDEA 3O21A 4CDMA 3GJ8A 2H18A 3P9CA 1G6KA 5CVTA 1HQCA 4CUJA 1NMZA 2IEZA 3D7KA 3FPAA 2VNJA 3C3WA 1XI2A 2O5VA 2JGEA 1T6BY 4M2LA 4F84A 1TIPA 4GT1A 1YRLA 2WM9B 1YR1A 4N7RA 4DSUA 5KTSA 3IHLA 2A9FA 2BH9A 2PXHA 1TVMA 2X0FA 3WFZA 1YUMA 2H00A 3I34X 4D3XA 4A73A 4I5EA 4TLCA 2BZGA 2UYYA 2WWGA 2GK3A 2OAEA 1UMCA 3A0UA 1R5BA 1DG1G 3DOOA 3KJFA 1I51A 1NATA 1TO2E 1K7CA 3FWYA 1BXRA 3P9QA 5FPTA 1VE1A 2H31A 4Y0NA 4XQCA 1R1DA 4QBKA 1CVIA 4K6MA 1E7RA 4RIHA 2HKIA 1X80B 1OZFA 2EWWA 3NRJA 1M6HA 2PGJA 3BAFA 3R5XA 1O9BA 4MWZA 4OHUA 2OOSA 4BPRA 3F2VA 4GP7A 3U9SA 1F8FA 1DAKA 1HQYE 5DGCA 3ZCUA 3LP6A 5FULA 2AJCA 5A3SA 3E2MA 1U0RA 4MROA 4GUAA 1A7JA 3NATA 5KDLA 1WXWA 1NM5C 1RQXA 4LFAB 1X74A 2OR3A 1L7BA 1AQUA 2F3RA 1BXGB 4YALA 2P5UA 4ILEA 3WRWA 4DE5A 4GSYA 1N6IA 2DUUA 4U7TB 3WJ1A 3U6KA 4BGVA 4CNQA 3GT4A 4Y1FA 4MOWA 4YPOA 2GK4A 3MK31 3PHLA 1VLLA 2MINB 3LZ6A 1JJAA 2H1SA 4O2BA 4RKWA 1CUZA 4ZCPA 3T3HA 4N9WA 3ICOA 3O74A 5J9FA 4BLVA 4BO4A 4C2AA 1TM3E 1ZI8A 3AWDA 1UBFA 1N6KA 1J97A 2F1JA 1O8BA 2P1ZA 4F3NA 3U37A 5GZ3A 1DO8A 2UDPA 4EHJA 1V7QA 3W6ZA 2C07A 2RJNA 2VNSA 3AUKA 1DMRA 3P20A 1UDCA 1TCVA 3MGBA 3RG8A 5D87A 1P8JA 2FSGA 3WIBA 4V0OA 5CLQA 1Z26A 1VYVA 2XB8A 2PSDA 4PZLA 4EFNA 5KJ6A 3T1OA 3I61A 1C7QA 5LQAA 3H9EO 3UK7A 1ZHOA 2GNOA 2XSZD 1Y4ZA 4G1UC 1QORA 2QTVB 3HPRA 3VPXA 5AVKA 2XA1A 1VI6A 2EZ9A 1P7PA 1HZZA 3LHKA 4BMYA 1PJ4A 2X8JA 1JN0A 4RD1A 3WIUA 3JSAA 1U7XA 4G0ZA 1KF0A 2ZGVA 4L3OA 5DGXA 3S44A 3TDKA 4MW9A 4TMVA 4M55A 4DG5A 3CF2A 3IUBA 1AKTA 1ZW1A 1AGYA 2PZLA 1GV1A 1TZ2A 3IYLW 3Q6MA 4GPTA 2IYNA 3VNQA 2FQYA 3VHXA 5LIPA 1FP6A 1OWMA 3KRTA 5TMEA 5CJPA 1UFRA 1G5FA 1MO2A 3IUJA 1EVJA 2I99A 2NADA 1JKJB 2C0CA 2ETVA 2VWQA 4WA7A 2FPGA 4WCFB 1QCCA 1OH5A 1DKUA 4TWRA 4ND2A 3ZQUA 2D06A 5JFTA 5AM2A 1E8MA 4U02A 2NSHA 1DPGA 2NTNA 2OENG 3GCXA 1UPFA 3FAZA 2F9LA 5FADA 2VYVA 4N8EA 5KVVA 4U6QA 1QOPB 1MH1A 2KYRA 2Y99A 2VWHA 2I76A 1XQ1A 3FY4A 4JWTA 4X7PA 3R8CA 3TVTA 4WBNA 2YYYA 2ZBRA 1KZ4A 3SVTA 1ZMOA 1RWBA 2ET6A 2J3HA 3AXTA 2BUBA 4TZTA 3RVNA 4Z4EA 1T9GR 4LY3A 4MYHA 4EARA 1ZOPA 1VJ1A 3MPUA 4IIDA 1U0HC 1ZVJA 1E58A 1XD2A 3FOBA 4M21A 4M1QA 5HCNA 2EJVA 3BFVA 3KYBA 3NHZA 3ZIAA 1VBMA 2LTAA 4U4AA 3ZTTA 1O54A 5KNDD 1V8FA 1QX4A 1ZICA 1TF5A 3IXQA 1TKRA 4O4JB 5C35A 1O97C 3PHJA 3TR5A 4CR7A 1U5BB 3PGMA 3VKGA 4JUDX 4RLSA 1ODKA 1JEYA 1A8HA 3RUPA 2BEVA 3PJDA 4Y9TA 3IPLA 1EFUA 2GXUA 3OSUA 1AK1A 4BO9A 2H08A 2XVXA 2LIVA 1SQ5A 2Q4OA 4RW0A 4WQMA 4D81A 2Z8XA 3QX9A 3WGOA 3IEPA 1K4MA 3JV7A 4N5LA 2EDCA 4CLRA 4KO1S 2RH8A 2R3SA 1K7SN 1FDIA 4AF6A 4AJNA 3OIGA 3RTGA 3LHSA 2WWHA 2J0VA 3PDJA 4JOSA 2X9VA 1Y7TA 1BS1A 6YASA 2AEEA 3UJNA 3U44B 1B8UA 4GOND 3CPJB 1OHHA 2AWOA 2DBVO 3MWFA 4AU1A 2GXQA 1WXIA 2Y68A 4DIFA 5IJXA 1XRSB 3W5CA 1EJ2A 1TU4A 1U3GA 4MVJP 3ZH2A 3STHA 1OV4A 2V3WA 1H3EA 1EE2A 3CF0A 3MCZA 4KXWA 2ZSIA 1SO8A 4POAA 3RSFA 1SBCA 4YAWA 3AV0B 4D79A 1OTXA 1CEXA 2ORWA 2YRXA 3AR4A 4JT4A 4URXR 1JMVA 3FTFA 3BXPA 1NZJA 3L8CA 4BVBA 3S1AA 5KNBA 1LPPA 4U6SA 2KLBA 3H2IA 2HCFA 2OSVA 3JARA 2V0GA 2WF7A 2RB5A 3H7IA 1X7DA 4MO9A 4L51A 5E0OA 1H2HA 3AL3A 1T9AA 1SCBA 5A5EA 1A27A 2W6NA 3OKCA 3QYPA 2C9YA 5JJIA 4HRAA 1BC5A 2PN1A 3STXA 3ZNNA 3LC0A 2Z09A 4Z5XA 4U7HA 3TB4A 5KVCA 5LLDA 5DW0A 3QFTA 1Y5LA 4KDEA 1ZA1A 4N7BA 3ZLJA 2H52A 1BEZA 2PRIA 2VT3A 1LBHA 1ODTC 4LYHA 2JLCA 3S2IA 2E1RA 1L4HA 1YIAA 1YB7A 1YGYA 1KZ9A 1F2DA 1BJTA 2VSYA 1XJWA 4GD3Q 4OHFA 5EE5B 5FDFA 3HKBA 2OZLA 5C53B 3CUTA 3SQNA 1ZM2A 5A02A 2JFHA 1L5MA 2I78A 1YS1X 1LLDA 1ZYUA 3MCUA 3PWSA 2VJBA 2BEUB 3NASA 4UHEA 5JJ5A 3ZNQA 1CJSA 4N6GA 5TDHA 4H4DA 1NUSA 3UMYA 2CVFA 4Q6BA 4DQKA 1V6CA 3D5TA 1JDZA 1G2IA 2NXJA 1U8YA 3DHVA 3MQ4A 5AJTA 1VE5A 1Y8RB 1K7FB 1ZHFA 4CMKA 1R9MA 5EZYB 4JJGA 3WLEA 4M8SA 3IUNA 5LQUA 2XCUA 3K70D 1XEWY 3NALA 2JCYA 2XPCA 1CUWA 1XU7A 3AOEC 3FAKA 3OE5A 4R1UA 5FR1A 4LMAA 1CK4A 2FB9A 4FR0A 3WQRA 4BS9A 1N6RA 3DBIA 1E1LA 1QIIA 1UBGA 2HK8A 3ESRA 3DYIA 3HBJA 3OIUA 3PQDA 3HSKA 3K1JA 2O6LA 4GGOA 3P0RA 4XVHA 1U8ZA 4ZV9A 3GFFA 4LJYA 5HZGA 3U3KA 1BTOA 3IPYA 1E2MA 1LD3A 2QUKA 3QVMA 1TYEB 2J3DA 4M8LA 3KSBC 3ZWOA 1ISFA 3T3IA 1U0LA 2I54A 4MX8A 1NNEA 5M7EA 2C94A 4FHFA 4P3XA 3HABA 3A6KA 1LWNA 2H7YA 2Q1UA 3SZ3A 3CKKA 4QU5A 3FNRA 3TNDA 4OHPA 4GKBA 2AV6A 3NNSA 4OFBA 5AJXA 4MHSA 4MB2A 3CZCA 1VLHA 3HCAA 4ZU1X 3HI4A 3BL5A 5FORA 1Z45A 2FWAA 1DINA 3A3PA 4PAGA 3X0DA 4DQUA 3WHIA 4AIRA 1DQPA 1AG9A 1W85B 2ATEA 2JJ1A 2LDBA 1FW6A 3QW4B 2Q4TA 1BHO1 3WRXC 4JK3A 3BIFA 2WZQA 1N1MA 2WNHA 3HP4A 3I9LA 2X77A 3LG2A 3MWDA 1LPNA 2BCGY 2PFGA 3N53A 2GAOA 3T5MA 4A10A 4PCVA 3V6LA 2IYXA 5FOSA 2GAAA 1ZIOA 1CY1A 2ECKA 2YVLA 4BJHB 2HI0A 4PAMA 3JW8A 1O95C 3H3FA 1JEYB 4ZAWA 1DAIA 1GSHA 1P7ZA 2M98A 3EGXA 3X1JA 3GL9A 3PUHA 3QBVA 1U0OC 2H92A 4F2GA 5J1SB 4K8RB 3DW3X 2X8BA 5BXQC 4W7HA 5DGDA 3UHFA 1Z7EA 3KKZA 4KG7A 2AK3A 3N8NA 1Z82A 1ZK1A 4BNMA 2ZQZA 3A6GA 1JAIA 4Q9KA 3VAYA 1UWLA 1TGYA 2W48A 3T3DA 1GQ2A 4YRNA 4G1BA 5FBQB 5HFNA 4CKEA 3BSWA 1JDVA 3UZUA 1YU9A 1NXWA 3NYRA 4HXEB 4RL6A 2PBLA 1ZL2A 5A7FA 2CMKA 4C0WA 2I2FA 4ZT2A 2GR9A 4IOJA 4OFXA 5EMMA 5L4LA 1ETUA 2ZJAA 1TYBE 1Y8ZA 2CMFA 3NVMB 5JJLA 2VJLA 4OH1A 1TLTA 3A1DA 1PZFA 3I0MA 4KRGA 2XDYA 3I1IA 1RAHA 2D74A 4BRWA 1ILWA 2ID7A 3NTVA 5JD3A 3RYTC 1DEOA 2W2OA 1KQOA 2JRLA 2Z8ZA 3TZ6A 1XZQA 2B0CA 2JKYA 3IJRA 5JDIA 4UEJA 4NJEA 2VRCD 2V7TA 2R6ZA 1NA5A 1UJ2A 1OY1A 1THMA 3FNIA 4EK9A 1J9EA 4F2WA 4CKWA 5MN5A 1T1JA 3WL8A 1CR0A 4FN4A 4NV3A 5HKKA 3L8DA 1SIOA 3P1JA 2QROA 4I50F 5EE9A 3T7DA 1ZOSA 1UMCB 1AVTA 1ZSYA 1BCSB 3C70A 5GONB 3IURA 4WK0B 1SBHA 3HB4X 3JWEA 3NIBA 4EGJA 5BMVB 1PEKE 4JU8A 2WW8A 2H3EA 3WQSB 4QGAA 2SCUB 5K0CA 2FN8A 2J3JA 4N0PA 3WNZA 3B2EA 1ZPDA 2JIMA 2WJVA 2LP4Y 4DS3A 3HADA 3C5EA 1MC4A 3W5UA 1FTGA 3KEOA 3WDSA 5C0OE 5L51A 1I5OA 3PTAA 4V38A 2GHRA 5LQSA 4ZGBA 5JCZA 2GJAA 3HBLA 3THWB 4OX9Y 1NN1A 3HXMA 1XQXA 4FCTA 1I0LA 1SELA 3QW2A 4IZOA 3H6KA 5T5QA 1IQUA 3ADDA 1E2EA 1V43A 1D4OA 2ZAGA 3GLQA 2AQHA 2IV2X 5LP6B 5JI2E 1OLXB 2Y0DA 4M76B 1QK5A 3SYNA 3FYUB 1PN3A 1J8MF 3VR6D 1C41A 2XZTA 1Q1AA 1T2DA 3A6JA 3ZBQA 2PM8A 4FW9A 3ESAA 3VMMA 2XCOA 3K9HA 1WZIA 3SC6A 2PQ6A 3I01M 2WHPB 1EPUA 3H4MA 4M46A 3ROPA 2WP0A 3CG0A 4TYQA 4YV7A 3J80A 2VAPA 1Q91A 2WTMA 4RH0A 2HZBA 2ZWPA 1QJCA 4HFMA 1DRKA 3GA5A 3I53A 1C1DA 3KXKA 3QV2A 2BRUA 3GQBA 3RFXA 4KITB 4QYXA 4EO7A 2A78A 4R2JA 3QEMA 3DXYA 4LS3A 3QY9A 5IKXA 4TUYA 2PUDA 1U98A 3I9NA 3KBOA 4JLNA 1KAEA 2DHCA 4B3CA 3Q3HA 4P4UA 2X6TA 3WWEA 1AQYA 1JDUA 1RWQA 3ZE1B 4DMLA 3GLHA 4A5OA 2QPAA 4TLAA 1E3LA 2GETA 1G19A 1NVBA 1EA5A 2WWTA 1IIRA 4J8PA 4J16A 5DH9A 2J33A 4ZO9A 3DT8A 3UK6A 3S2GA 4DNXA 1FP2A 5JD6A 1OIVA 2JJQA 1XRPA 3ND9A 3ORQA 4HZUA 5TS3A 3EEOA 3D0KA 3ID6C 3CRNA 4FW8A 4EW2A 2R6CA 2X3FA 5JAPA 2E5WA 1EDDA 1LB1B 2DPLA 2XLCA 3SBEA 4I8XA 3C8MA 3B6IA 2B4QA 1AKRA 2RHHA 2W7TA 1KEUA 5AOBA 4ZT6A 4AX4A 2AXNA 1DTEA 3DV0A 2BEJA 3BK2A 4G0UA 4RQAA 2J30A 4DY6A 1V4BA 4RDXA 4II2A 2UVQA 2OA0A 4R7TA 4G5XA 4O4LB 4J29A 1G8AA 5EXSA 3LI2A 1VA5A 5IT5A 1RRGA 2Q3HA 2J67A 5ILGA 2F8LA 2X2EA 2QE7A 3LT4A 4IJ5A 1C30A 3I9MA 2QSJA 1X7GA 4HT3B 4QUHA 4LV5B 1E79A 2GCEA 1T5BA 1G2OA 3E22A 4LA4A 1NMEA 5FL7D 2WB4A 1AA9A 4GZMA 1EVYA 2Y0PA 3KT0A 4YMVA 1IY2A 1SOVA 1MQ8B 3F46A 1KZGB 2W2MA 2IU0A 4LUCA 3J81k 4ZP1A 1VL8A 3BGVA 3AOGA 2Y2UA 3CH5A 2P5TB 2PZGA 4EMUA 3VQTA 1FFXA 3MGKA 3BZBA 2R65A 5ALDA 1Z5VA 1GU1A 1O87A 2IQIA 2QYHA 3PDCA 4PFSA 1OYWA 4ZAGA 3WX0A 1ZGGA 2IXAA 3RYCB 3KSDO 4L85A 3FHOA 1E8NA 3BILA 3DR3A 5ENZA 4AN0A 4YRQA 2OCYC 4XGNA 4DB4A 1E9FA 2FMIA 2YXNA 2H4FA 4DRXB 1I2CA 3JQBA 1L4YA 3MGGA 4QBTA 2X0JA 1Q0QA 3O9VA 5CAEA 2UU9B 1LJ8A 3SHQA 5BQ3A 1P7WA 3JYHA 1M1ZA 3P0JA 1MAUA 2FG6C 3SZLA 4BUJA 3LX5A 1DBVO 2XB9A 4HQLA 4HAYA 4KODA 4MVXA 2AI2A 1M2KA 4LI0A 3W5BA 1YKSA 2NZVG 2ZRMA 1QG2A 4JP5A 2XZOA 4OSPA 3MMXA 5CXXA 3TK1A 5DASA 2QRZA 2J5BA 1PD0A 3MRVA 5JLJA 2W98A 4Q9AA 4QAJA 3A9WA 1RS0A 2R97A 5GGXA 3P7MA 1A9QA 1TMGE 3TFOA 1AGXA 3CBGA 2G0NA 3OH8A 2A57A 3Q9SA 5FKJA 2C3OA 5EA2A 1GXSA 4DWVA 4DN6A 1PVDA 1L7OA 3ZGLA 4MVJE 1W581 3B1YA 3QYAA 4CLDA 5CDHA 4BNVA 2CGEA 1FU8A 4H7EA 1UOPA 3KKNA 4OYYA 4Q34A 4BE9A 3K71B 2ECFA 1FMFA 4RFSB 2Q3BA 3KOZA 4D74A 3TGLA 2ZANA 1R8JA 2V7EA 4RULA 5A4IS 2XIQA 1DJPA 1U7WA 2RKBA 3A37A 4J7CA 1JYSA 4C14A 2YZNA 3QRWA 4XFKA 2PU7A 2C2XA 3LCVB 2ZZNA 3PDUA 1TTHA 1BYUA 1COWD 3ETHA 1GGNA 1XP5A 3BD6A 3NHMA 1IWPB 3TL2A 3N8DA 3FFTA 1SK8A 1MP0A 4QBFA 2QAGA 1QJ4A 4B6OA 1THZA 3NHRA 2NUTB 2HA6A 2H4YA 5FAKA 2PWBA 3EF3A 3ELDA 4LTDA 4JBYA 5TT1A 2ZITA 1LSUA 2CFIA 4WWHA 4ZZ0A 1WSWA 2QQFA 3HM2A 4QQNA 4HGQA 1S3IA 4RF5A 4Z4FA 2YQZA 5LMZA 2GTHA 4OLAA 2WQ7A 2MSDB 5JVDB 2IIVA 5F5XA 3ZE8A 1AHPA 3BMOA 2O8FB 4Q4JB 4AJOA 3NCHA 1FYXA 4UBKA 5AW1A 2BHNA 5ALLA 4D3SA 2XE4A 4GBJA 2GWHA 2WJ4A 1Y0BA 4JSTA 3ACDA 3IBSA 3OC0A 4I55B 2PX4A 4O6VA 4OLBA 1P1KA 3FNEA 2QIPA 1DG3A 1GU0A 1ZN7A 3VKUA 5KB3A 4JA2A 2WHPA 1ODIA 1ZUNA 3ES9A 3PNOA 4BVJA 2FZLA 4JUBA 2FPPA 3KVRA 4BX2A 1ENPA 5FPKA 5LQMA 4FOPA 5F52A 5KYWA 1PNRA 3AEQB 5IAEA 4DEYA 4HB0A 5BR4A 5GJVC 3M4YA 2DZDA 2GN6A 4L8VA 1VHWA 2XB4A 3I76A 2XLBA 3PFWO 4HPJB 4NOMA 4Y18A 4DDTA 4Z49A 3GLGB 4MCAA 3RVOA 3UJAA 1V35A 3ZBTA 1Q1NA 4OAPA 2CZCA 3DTYA 3JALA 1MJGA 4Y2PA 8AT1A 1PFYA 2ZM6B 4LYJA 3FUVA 5TQ0B 1MW8X 1YRHA 4MR9B 2H8GA 2NTJA 2REQA 3KPVA 3LCMA 4KEAA 4UNIA 1SBYA 3CVWA 2FUNB 1ZIDA 3G9ZA 1H1DA 3W3AD 1A8IA 4NBSA 2YJTD 3PXEA 6GPBA 2I80A 1P9RA 1NN0A 1OREA 4TSRA 5B2EA 3FPLA 4WKOA 2WM8A 2QW0X 4FGUA 3GAZA 5AOVA 2FDRA 4RVUA 1U0EA 1SC9A 1EG2A 1RRFA 2P2CA 3MCAA 2QVLA 4JSRA 4OXRA 4UDXX 4X6XA 1CFJA 1KQGA 1FLVA 3A70A 1KEZA 2G5CA 1EDEA 1SUSA 3MBKA 3HA2A 4AG5A 2DTDA 4DA7A 1NOKA 2OBBA 1E0JA 2J9FB 3FSJX 1W9HA 2HJGA 2KB0A 3MVEA 3KTDA 3NAQA 4RD0A 5EG5A