3GRYA

Crystal structure of the complex between s-adenosyl methionine and methanocaldococcus jannaschi dim1.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 89
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gryA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gryA01
4QQNA 4RVGA 4BLVA 4NECA 1Q0SA 5E1DA 4RTRA 3K0BA 2O57A 3P2EA 1P1BA 2AOTA 4EKGA 5GIPE 1SKMA 3KQVA 2QE6A 3X0DA 3IV6A 1WS6A 3M6UA 2UYCA 5EPEA 1KP9A 5JUWA 1INLA 3LDGA 2IH5A 3G5LA 4PYJA 5ICCA 5K0BA 2B3TA 2YTZA 2P35A 2ZIFA 4HGZA 4LWPA 2P40A 1NKVA 3FPEA 2CMHA 4RTLA 1JQEA 3B7PA 2ZBPA 4FP9A 5DXJA 5CCBA 2XYQA 3P8ZA 5FCDA 5K0CA 2IH2A 3A25A 4A6EA 3FUTA 2ESRA 4YV1A 4P7FA 1FJXA 2EFJA 4JXJA 1VP9A 4AX8A 5GINE 1Q0TA 3P9KA 5HIKA 4OA5A 3P97A 1EQAA 5H02A 4RTJA 2QY6A 2QM3A 5FWAA 3KQQA 5BP7A 5LR6A 5DX1A 2UYQA 5LQRA 1QAQA 1L1EA 1IY9A 2R3SA 2XYRA 3KQOA 4FSDA 5P8WA 3B3GA 5DTQA 5E1BA 1DUSA 3B89A 2Q41A 1WXWA 3MQ2A 5M5BA 9MHTA 2PKWA 4HH4A 3DXXA 1FPQA 2V7EA 3HCBA 3DULA 3PVCA 4GOMD 1XDSA 5DM0A 3CGGA 2PT6A 3O4FA 2O07A 3GJYA 5T6BA 1KIAA 3HCAA 4DCMA 3NWBA 3UA4A 5LQNA 1HNNA 4RVDA 3NW9A 3QOXA 3PTAA 3EGEA 4DA4A 1L3BA 2OY0A 1M0EA 2EG5A 2AS0A 2YR0A 5K8VA 2FK8A 2ZLBA 3I9FA 4HGYA 5K0LA 3M6XA 1KPGA 3V8VA 4Y30A 3FTFA 3A4TA 3VSEA 3LX6A 4DQ0A 4PYMA 3DR5A 4ER3A 2ZIGA 5KVAA 5EC8A 3ER8A 3BGIA 3DMFA 5C0OE 3ELUA 4HG2A 2PVCA 2OYRA 4C04A 3FPJA 3O7WA 2VZ9A 2IIPA 2HV9A 2OO3A 4HTFA 4PYLA 2ZULA 2AOVA 2GAFA 3LHDA 4A6DA 2P1DA 4BLUA 3LBYA 4M38A 4BY9E 5CIYA 3A27A 5LQUA 1BHJA 1M6EX 1NBIA 3KQWA 5KQSA 1O54A 1QAMA 3I64A 1G55A 3DH0A 3KU1A 1XCLA 2ZW9A 3NDIA 1N7IA 4KW7A 4MWZA 1EIZA 3FYDA 3AXTA 5E9JA 3CJQA 2QRVA 3SXJA 2PXCA 1VPTA 3TM5A 5K05A 2OB2A 3I5UA 2PJDA 2BR3A 2Y1WA 2ZZNA 3GO4A 4PYKA 1I4WA 3BZBA 3GRUA 4FR0A 3AJDA 2P41A 4FT2A 5K0NA 1Y8CA 3EMBA 3LPMA 4OBWA 3T7SA 1G8AA 1X1CA 4OQDA 1Z3CA 5EZQA 3MTEA 1AQJA 3FUXA 5CVEA 1TPYA 3PT9A 1RI1A 3R6TA 4QDJA 5DLYA 3SSOA 3SGLA 4P7KA 4DF3A 3ELWA 2PY6A 1KYZA 2H11A 2ZTHA 4RV9A 1N7JA 5BW4A 1JQDA 4CKEA 5FQOA 3ELYA 1F38A 2VP3A 3HA3A 3OU2A 5LQCA 3HP7A 1BOOA 1D2GA 2GA9A 1V39A 2PX2A 5DT2A 2GPYA 3G2PA 5CVJA 3RIEA 2Z6QA 3G89A 5GM2A 1XCJA 4RTMA 4X60A 1WXXA 3RW9A 4KIGA 3GRVA 3IHTA 1X19A 2PXAA 3FUWA 3BWCA 2FHPA 3IYLW 2C7OA 1WZNA 3KPJA 1YUBA 3JWGA 3PFGA 4M36A 4RYLA 3P9NA 3VC2A 5K09A 3LCVB 2VDVE 1JTFA 2UYOA 3SSMA 4BP1A 4YMHA 1NE2A 3C0KA 5EIWA 1VBFA 5HILA 3KR1A 2H1RA 5FTWA 5HIJA 5HIMA 4H0NA 2PX4A 3ANXA 3SX0A 1D2HA 1VLMA 5D1HA 2O06A 4RX1A 3KQTA 2WA1A 2XYVA 3EMDA 3KPUA 5FULA 3FPFA 3PB3A 4RTNA 3HVHA 1YF3A 2B25A 1DL5A 3MAGA 2CL5A 4LECA 5E1MA 1ZKDA 3MB5A 4GEKA 5DRTA 4WVLA 5E2BA 3U81A 4POOA 4RTSA 4QDKA 1P39A 1XDZA 4WXHA 5E8RA 4RTOA 3PLAE 2GH1A 5DPMA 3FRHA 4QVGA 7MHTA 4M37A 2O0LA 5DWQA 2OBFA 4AZVA 3EPPA 3MERA 4GOOD 4KWCA 4E32A 2FRXA 1BKYA 2Z6UA 2XVMA 2DULA 2P3OA 2AZTA 3NVKI 1KHHA 4PIMA 3EVZA 2ONYA 2PX5A 3P9IA 4ER7A 4EKIA 3C6MA 5T67A 2KW5A 3GXOA 3OZRA 3OZSA 2JG3A 4E2WA 4ER5A 8MHTA 4FS8A 1MJFA 5EMLA 4E70A 3VYWA 5HOQA 3T0IA 2WA2A 4KDRA 3KPYA 3FTCA 2AOUB 4AUKA 5EOVA 3OCJA 5FHRA 2UZ4A 5GP1A 4YUXA 4E33A 4MHTA 1EG2A 1X1DA 4E30A 3LECA 4MIKA 3M6VA 2K4MA 3DMGA 2JHPA 3L8DA 2BM9A 3GU3A 3CCFA 3UZUA 3THRA 4ER0A 3FRIA 3UJCA 5LQAA 4RVHA 2I7CA 3CVOA 5GOZA 4X1OA 4R6WA 4PYQA 5K03A 4V0QA 1FP2A 3DTNA 5E1OA 5BW5A 4DM3A 1VQ1A 5GM1A 3AWIA 2NP6A 3BWYA 2DPMA 1ZQ9A 4FT4A 4O29A 4R8RA 4X63A 1RI2A 3LCUA 5FA8A 5FWDA 3UJ9A 2NP7A 2N47A 1JG4A 1SVUA 1X1BA 3HM2A 3SM3A 4B17A 2AR0A 1XTPA 4R8SA 3T7RA 3ER9A 5CM2Z 3KPWA 4CTKA 2NXCA 5FUBA 1EJ0A 4ER6A 2HWKA 3IEIA 5E9QA 5EHGA 2C7PA 3LKDA 4AZSA 2PX8A 3BWBA 3E7PA 1ZG3A 4EK9A 3R24A 4GOND 3OPNA 1O9HA 4PYOA 3GDHA 4QQKA 3LSTA 2GB4A 3ERCA 2YVLA 2IP2A 2FK7A 2OXTA 3GRZA 4P7JA 4GC9A 5CUQA 2ADMA 1JG1A 2I9KA 5IH3A 3UJ7A 3UJ6A 3TM4A 1NW3A 3MTIA 3TMAA 3LBFA 4CWAA 2HNKA 4K6MA 4V0RA 3RODA 3WSTA 2ZWAA 3EEYA 3HVIA 3GCZA 3LDFA 3DXYA 3UBTA 1KPHA 3TKYA 4YUVA 2UYHA 3QOWA 1L3CA 5GIOE 3JWJA 4RWZA 1QAOA 2IBTA 1JSXA 2ZZKA 4CKCA 3R9XB 1XJ5A 3KKZA 4GUAA 2B2CA 3G88A 3TR6A 5LSAA 4HRAA 2PWYA 1MHTA 4OBXA 3HCCA 2YXDA 1H1DA 3EVGA 2BM8A 3DLCA 1XDUA 1WG8A 2YXLA 4HTFB 3TPZA 2FCAA 2AOXA 2YX1A 2PBFA 5C1IA 2CKDA 2JJQA 2JHAA 5K0EA 5LQKA 1KPIA 3BUSA 4YV0A 5EMMA 4RTPA 4OQEA 2P3LA 4PGGA 3OU6A 3I58A 2IH4A 4IKPA 5EMJA 5EVJA 5F2OA 3TOSA 4CXMA 2NNWB 1L3IA 3CJRA 3FUUA 4PIPA 4GC5A 4ISCA 2FPOA 3MHTA 2XVAA 3I53A 5EIFA 3REOA 4GBED 1I1NA 3HVKA 3HCEA 1NBHA 1TW2A 3ORHA 4M7RA 5CCXA 5FQNA 5HFJA 2BZGA 3GGDA 1P91A 2PLWA 3E8SA 3PX3A 5EZSA 3HA7A 5EQJB 3TFWA 4DMGA 2PSSA 1JR4A 2ZZMA 3C3PA 1UWVA 3FUVA 1IXKA 1QYRA 3HCDA 2A14A 2ZSUA 3KQSA 4EQZA 3Q87B 3UJAA 3DMHA 2ERCA 1AF7A 2CMGA 3BKXA 4YV2A 3MCZA 1RI5A 3DUWA 3O31A 3FYCA 2OZVA 3LL7A 3OU7A 4UOEA 3G8AA 1NV8A 4R05A 1R8XA 5EGSA 2I62A 3MCTA 1NW8A 3FTDA 4IWNA 3UFBA 2ZFUA 1OR8A 1WY7A 4Y2HA 5CVVA 2YQZA 1P1CA 1U2ZA 1DCTA 1YZ3A 3KHKA 5E9WA 2BH2A 4YMGA 3DP7A 4EVIA 4HSGA 2G72A 2O05A 3A7DA 4YUYA 5T64A 3C3YA 3KQPA 5IKMA 1NT2A 4YUWA 3SMQA 4LG1A 4Z2YA 2ZIEA 1IM8A 2PGXA 3G2QA 5HZMA 3HA5A 3P9CA 3R3HA 5F2KA 2PT9A 4X61A 4E31A 2XBMA 3E05A 2IGTA 1NV9A 4PYNA 1HMYA 3BT7A 1JTEA 2AOWA 4RTQA 2LD4A 4X41A 4F85A 4XCXA 3KPVA 1G60A 3EVEA 3AXSA 3G2OA 1N2XA 2OB1A 2B78A 3EVFA 1YB2A 2B9EA 2BR4A 4MTLA 2VS1A 4BP3A 2OKCA 4CKBA 5F2NA 3B5IA 1AQIA 4XUEA 3G2MA 3HCFA 1R18A 1O9GA 1TW3A 2ZBRA 4KVZA 3UJDA 3CKKA 2ORED 2ZBQA 2JH8A 2ZVJA 4QPPA 2G70A 3K6RA 3GIWA 2V74B 3ME5A 4C05A 2IBSA 3CBGA 3HEMA 2AVNA 2G8NA 4HC4A 3LCCA 5K0JA 3UA3A 1RJDA 1JQ3A 3OFKA 4LWOA 4PINA 3SVZA 1ZHFA 3MGGA 2NXEA 4ZTBA 4C4AA 2P3QA 3BGVA 4C06A 2EX4A 3F4KA 2H00A 5MHTA 5FA5A 3R0QA 2G71A 2ONZA 3P71T 4RTKA 4C03A 3P2KA 2F8LA 5KQRA 5D1NA 5K0FA 4AZTA 1T43A 4GQBA 1VE3A 1BC5A 3UJBA 3PX2A 2FYTA 5E2AA 3B3JA 1X1AA 4F84A 4YUZA 3EVBA 2YUIA 3ELDA 3C6KA 4DZRA 1QZZA 1R8YA 2P7HA 5DM4A 5EKUA 2EJUA 3S68A 3TKAA 5C9ZA 2HR1A 1JG2A 4GOLD 1SUIA 4P58A 3KQMA 3EVAA 3A7EA 3Q7EA 5JR3A 4G56A 3EEOA 3LDUA 4RSRA 3BXOA 4FSXA 4FGZA 3GWZA 2C7RA 2E5WA 4F86A 3BGDA 3E23A 5HIIA 3D2LA 2HTEA 2GS9A 5K0GA 1VP3A 2NXNA 5DSXA 2NXJA 1R74A 4ATNA 5CD1A 5CVDA 3NMUF 4OX9Y 4PGHA 2JH9A 5DSTA 5B1SA 3DLIA 1XXLA 3UJ8A 4CTJA 5FHQA 3AY0A 4E2YA 2QYOA 3OE5A 5DX0A 3THSA 1R00A 5HEKA 3M70A 3DOUA 2QRVB 5ICEA 3T7TA 1RI4A 1SQGA 1AV6A 4PONA 3EGVA 3TLJA 2OPBA 3M33A 1NW5A 1RJGA 4QPNA 1G6Q1 3FTEA 4QTTB 5GWXA 4P7GA 2EJTA 5ICFA 3BKWA 3SR4A 3M6WA 1B42A 2AOUA 1JG3A 3V97A 1R6AA 5DRYA 4C08A 1KR5A 4KDCA 1L9KA 2Y1XA 5G02A 2P8JA 3OFJA 1QANA 2BR5A 2IDJA 5DM1A 3OZTA 2NYUA 3LGAA 5DXAA 3H2BA 4PCLA 5DM2A 5EHIA 1XVAA 3KR0A 5LQJA 4DKJA 4PCAA 3LKZA 5DTRA 4E2XA 1RI3A 5E8JA 3CJTA 4AZWA 2ZCJA 3A26A 3HNRA 4IV8A 4KRGA 3PFHA 3FZGA 2P7IA 4XUCA 2PWPA 1F3LA 1G8SA 2YXEA 3TRKA 4QTUB 4QVKA 3JWHA 10MHA 3KQYA 4E2ZA 2C7QA 1D2CA 1RJFA 3DXZA 4RVFA 3SSNA 3NWEA 1JSZA 2AN4A 3M4XA 5ICGA 1UFKA 3FPGA 4GF5A 3VC1A 3GNLA 5K01A 1SQFA 5DTMA 5FADA 5EG5A 2WK1A 3ID6C 5KS2A 5BXYA 3G5TA 1EJ6A 3EGIA 3HVJA 4IV0A 3KR2A 3G8BA 3GRYA 1YFJA 4FZVA 5ERGB 4PNEA 2IDKA 4MQ4A 5EKXA 2VDUE 1KYWA 3QV2A 2PXXA 3PS9A 4XUDA 5EEHA 3JWIA 1PRYA 2VDWA 2IFTA 3NDJA 3NTVA 3FPHA 4L7VA 2GLUA 3GRRA 1I9GA 4DCGA 1UIRA 2HMYB 5KYGA 2Z6AA 3P2IA 2AVDA 2CWWA 1ZGAA 3BWMA 3EVDA 3G7UA 3OE4A 4PYIA 2PV0A 1YFLA 3KR9A 2R6ZA 1ZGJA 2AN5A 3HTXA 3NVMB 1RJEA 2JHCA 1FP1D 4BLWA 1VIDA 1EAMA 1VL5A 1SUSA 3EVCA 3TQSA 4R6XA 4EMSA 5EMKA 1ORIA 4OA8A 2I6GA 3NJRA 4U7PB 1SG9A 1NW7A 3CC8A 1G38A 4KIFA 4C07A 2IPXA 1KXZA 5CVUA 2G1PA 5EEGA 5U4XA 2ZWVA 3UWPA 1PJZA 2AOTB 1M6YA 1ORHA 4U7TB 1NW6A 5DX8A 3B3FA 1FBNA 1YZHA 2AN3A 4PWYA
chains in the Genus database with same CATH superfamily
1KH3A 2KNAA 4FDLA 1FFHA 5AJWA 1IBMM 4RPGA 2FPPA 1RYEA 4NE9A 3MJSA 4L2IB 4DL9A 2FEMA 1KSFX 4WE3A 4JLMA 2FRDA 3QI7A 3UN1A 5IBPA 3IOMA 4DR4B 2R2AA 1LJUA 5IXJA 3P32A 1S3GA 3ZHCA 2I1LA 3LLUA 3K73O 1T0JB 2ISSD 3D0RA 1ECLA 3JQDA 3MT7A 2GZ2A 3QVMA 4HLQB 4BP8A 2BCEA 2O5VA 3ISVA 5FFFA 1CETA 3PXAA 5H82A 2ZSFA 5NULA 2V5UA 4RJTA 1OB2A 1PV2A 2ZBPA 5AIBA 3UHFA 5FCDA 1QIFA 5IHXA 4B3JA 1Y0BA 4C3UA 1V4VA 4YV1A 3OCWA 3H65A 4R98A 3RR2A 4L5JA 4U3JB 1PVOA 1YSYA 2Z5FA 4NR0A 4M7OA 2PD6A 5C8XA 1ZMBA 3NDPA 2H7CA 4ZAYA 5KB3A 2BMJA 4IQFA 5DX1A 5BOSA 1KS9A 1XVLA 1YZQA 1MENA 4QPZA 4QTYA 3SIWA 4FSDA 4JUCA 2AI2A 1L6RA 3JX9A 4R40A 1V3VA 1LGYA 4IBBA 5B6JA 1TK9A 4LXQA 1APBA 3PVCA 1WR8A 1KO7A 5EXPA 5DM0A 4N47A 2F64A 1Q1QA 1TVKB 5LBTA 4B3CA 1TC1A 1U0NA 2WYWA 3B53X 3GPYA 1QZMA 4PR0A 3D6FA 4PZZA 4YK7A 5FIUA 4FCTA 3TLGB 2Y0TA 4R9SA 3GZNA 4PAWA 3T15A 4RVDA 5KYVA 1U31A 3J7AC 3PTAA 1OD6A 5AKYA 3H1PA 1PVVA 4YWJA 2OHJA 4G5HA 4C6SA 1MU5A 3RYCA 2NPIA 5K0LA 3K0CA 1NRIA 1DMSA 3PUIA 3SJCA 3GRFA 1DBQA 3MRSA 1U1FA 3LXMA 3GL9A 3DR5A 3AKCA 5EC8A 5FP0A 3EC1A 3SXPA 5ICMA 1N2CE 5A3SA 4DXHA 3N0RA 1NW4A 2QYTA 4MZDA 5H4HA 5KC8A 3NP7A 2W8BB 1BDBA 1QDTA 1XRPA 2EU8A 3GEEA 1ZD9A 2ZE7A 2F9MA 3N8NA 1E5DA 3KU1A 3TRKA 1XJCA 1PLJA 1T5IA 5LN1A 3FYDA 2BM0A 2AMFA 3U1TA 4XDZA 2XZTA 3QE0A 5JJCA 5K05A 4HGRA 4YDHB 5C31A 5LU9A 3I6IA 2REQA 4G8CA 1NM5C 4A8JB 2JJYA 1ZM2A 2R6AA 1ST3A 5C1BA 4PYKA 5CT8A 5JAHA 4J3FA 2X2EA 3M9LA 4R5MA 1T8YA 2WVAA 1DGHB 4XGKA 2JBHA 4DQDA 1D6JA 4W7IA 2ZJBA 1UC4B 2C3YA 1EE9A 1K68A 2B2XA 2CK3A 2HT6A 4KK3A 1N2HA 5DLYA 4F4DA 2AJCA 3E3LA 4M9CA 4EX6A 1KVUA 1DX6A 2EIHA 2YL2A 2ZDHA 2BTQB 3AVPA 1Y6RA 1YQXA 3AHFA 3E3AA 4Q6BA 4E09A 1E64A 3OTOB 4EZIA 2D13A 4RKEA 4MMXB 1IN1A 2FW9A 3SEFA 1GVNB 1LRJA 1HBJA 2Y1OA 4H1TA 1RXCA 2TYSB 3ZYCA 2XZLA 4LXXA 1JPJA 4QUBA 5ISMA 3TQCA 2C98A 2APLA 1DG9A 3X1XA 4IJVA 5ER9A 1KYQA 4UHKA 4FMCF 3ZZMA 1O4WA 2IV2X 2VSQA 2WHYA 2D59A 4NOKA 3EF1A 3I04M 4AG6A 5K5EA 1CJMA 4BRZA 3G13A 3GDOA 4HQKA 4IF4A 1V9LA 1Z7BA 3PD0A 3PEFA 3HB1A 4RDCA 1XKQA 4NXMB 1NOKA 1HQCA 4QXQA 1OREA 1FFXA 5TPZD 2H51A 3PDIA 3GR6A 4OBEA 1T2VA 2ADOA 2GZMA 1JHUA 4LX8A 2BGIA 2XUGA 4RJJA 3I30X 4XYEA 2X8BA 1XEXA 5HIMA 3AL0C 1JQBA 3I8OA 4EA8A 3VHQA 1H2ZA 2R00C 4DB4A 4JXZA 3UFXA 1E6WA 2EFCB 2R45A 5J59A 1HL7A 4B6OA 4ZJZA 2SCUB 2HJHA 4MGYR 1I3MA 3K6SB 1TMOA 3OCUA 3MJHA 3NTOA 4GEKA 4POOA 4WVLA 2LBCA 3CTWB 1X7ZB 2GYWA 3EXG1 4QDKA 4XLZA 2CWDA 3I1IA 5K4GA 3Q6IA 4MB6A 1G8HA 5AW8A 1T4GA 1VCNA 5EA2A 5ESRA 5BVGB 2X8JA 1UDWA 3BZUA 1JLKA 3VR4H 2GJ8A 2B0CA 3A1SA 4IKOA 5FFMA 1PGJA 1II9A 1TK2A 3CSSA 1TTQB 3NM5A 3A3PA 2H92A 2H4JA 2NOAA 1EDBA 5BOVA 2RGOA 4B3RB 3ILYA 5AYVA 3HFGA 3JRNA 4PZ9A 3VJLA 5JS7A 3CRQA 1S96A 1OV4A 1NRXA 2QP3A 2GTIA 2RCYA 3I92A 4JBLA 1VECA 1IM5A 4X5OA 3UHAA 5JYDA 1RC8A 1XZCA 1M1YE 2WPDD 4IQGA 2Q1SA 2YZKA 1GWNA 3PRJA 1ACJA 1X1DA 3CRVA 4I9HA 5JFGA 1ML3A 4J7UA 2XTZA 3DUFA 5AW6A 1SU8A 4OXRA 3BIFA 3UKDA 3DT6A 3D31A 3WV4A 1YDMA 2RHRA 1KFVA 4ND3A 4YAKA 2FRDC 3LFUA 3KP0E 5ALLA 3WOHA 5AM3A 3O4JA 5F1PA 1ISPA 3KYBA 3VHXA 2O2JA 5E1OA 5ITSA 3R2JA 4HQLA 1D0KA 5KEIA 1QF6A 2RB5A 2XRMA 3FNBA 4D56A 2ISQA 4M60A 2XNSA 3L49A 4KMOA 5CT4A 3U3ZA 3MRXA 1KQFA 1V5EA 3EIEA 2R1TA 3NHUA 3QLJA 1CNEA 1J24A 3DOJA 1LI5A 1LVGA 3FMOB 3WLNA 3Q2IA 2FZEA 2L17A 2PA0A 3RWOA 5FYQA 4PG8A 2F1OA 3BWBA 2PO5A 1YE5A 3ANYB 2Y0QA 1KORA 2BWJA 1SUWA 2IUTA 4YFVA 2Q3HA 2GB4A 2O7QA 4KYVA 4R9NA 1PDWA 3EXG2 5I01A 2PVSA 5T4FA 1R4ZA 3PFIA 5GGXA 1F0KA 1GDTA 5H80A 1FYWA 1GFIA 2HGZA 2OSBA 4LCEA 1Z39A 4RESA 3IP1A 3R6DA 3IVMA 4LRQA 4NFLA 2VJPA 3I12A 3LGXA 2JLYA 1KGDA 1E32A 2FQXA 3MK6A 1GRQA 1CK4A 4LFBM 1W6RA 4RL4A 5D7BA 4DR7M 2VJNA 3ESZA 1ORYB 3PF8A 3G23A 1MNQA 2Z4TA 4ZOQI 3R9XB 4BN0A 3TW4A 2FG5A 3I8XA 3VR6A 1YQQA 5B7PA 2CW5A 5F7ZA 1E66A 4ANFA 2CFSA 1XRLA 4L3WA 4TKVB 2HHJA 2XDWA 3UM9A 2X0KA 3LPLA 3L25A 5EUMA 2AFIA 1XMQB 2BJVA 3WNVA 1PEDA 2MHCA 3M83A 2E4VA 3HBJA 4TUYF 2XYGA 2UXCM 5DYYA 4Z53A 1RKXA 2D1TA 1W9MA 2JHAA 4GOXA 4EI2A 4JA0A 1GPH1 3EMKA 3AFHA 2P3LA 3P19A 2X40A 3O75A 3LT0A 3LW5F 1UBRS 4E03A 4RD3A 2PMFA 4CTOA 3JAMS 1ORVA 2CNDA 3TWKA 3RIGA 4QOGA 2HDWA 4GC5A 1Z26A 2WU4A 3O1IC 2CJPA 2Q7XA 3SP1A 4D4KA 3PQCA 1OXKB 5FBQB 5HTKA 2E4UA 2HRQA 3V3KA 4B81A 3AVXA 4RE6A 4F1KA 3KM0A 5KPJA 4R2XA 1JFLA 3PC6A 4JJZA 3RC3A 3ABQB 3W1EA 3PX3A 1FFAA 3WHIA 4EY7A 4YT4A 1Y1KE 1Z18A 1VG9B 1Y42X 4P3KA 3CLRC 2ALJA 1Z0SA 3KNZA 3L7LA 3TFWA 5I8WA 5IJWA 4U9IS 1E4OA 3NEAA 3NAMA 4J49A 1SPXA 4RADA 1FFSA 2W4IA 3DPUA 2ODPA 1JP7A 1YE8A 2QUBA 1Y8ZA 2OXIA 3VZCA 1YKGA 3OQJA 3FLBA 1OAAA 4LOAA 4WK0B 4G23A 3JARB 1A9QA 2MINB 1V4BA 3I6ZA 4QTZA 4RHCA 3IERA 4PG4A 3RJ5A 2QJTA 5H4GA 4JI0M 2G8LA 1TT7A 3FFAA 4UMVA 2O59A 4EG0A 1LDGA 2V6GA 5GV7A 3T4PA 4F04A 1WMBA 2C9DA 5DYNA 1D5WA 1U0HC 2F8SA 1SKAA 4CIWA 2BI7A 2V45A 3OFND 3RK1A 4EVIA 2YVAA 1UJBA 3E5HA 3IRUA 2GD1O 3GJSA 1EVYA 4YUWA 3GLFB 1GJSA 2QX7A 2ZIEA 3AU9A 3FPSA 5A4JA 5HZMA 4GPTA 2JLUA 1CJSA 2HCTA 3TDNA 1KEWA 1BMFA 1T9CA 4PFKA 1SQ0A 4YCJA 1ZVMA 5K3CA 1ZITA 5A1JA 1IXYA 4UCXA 2QMYA 2NT3A 2JCVA 1BIFA 2OQIA 4O4IB 4Z4IA 4X97A 3G2OA 5IFKA 4M8LA 3HN7A 3KS8A 1IHPA 3TS1A 4B8ZA 4YJ2A 1YB2A 2H07A 3DZCA 1XMXA 3KCQA 2HRBA 3V1MA 5BVHB 3CZRA 4KVZA 2ZGVA 1TH3A 3I52A 4QPPA 4RQAA 1E6EA 1PHRA 2DPGA 3BULA 4UEOA 1MT3A 1YIAA 1RKUA 2JI8A 3AHDA 2EAUA 1ZOSA 3U13A 2SECE 2P27A 3AM3A 2PD3A 3G2LA 3EFOA 3G7NA 5K0JA 2BEUB 1KJQA 1GARA 2REQB 2W0SA 5CTJA 3SVZA 4A8JA 4BZXA 2ZQYA 3RTAA 5CRIA 1NM5A 2BKXA 1ZK0A 1EFRD 5KPDA 4RUKA 1EXWA 2V9PA 4RH1A 1RLOA 2A9OA 4PLGA 4ZYWA 5FA5A 1A8SA 1R0SA 3S7TA 5AUPB 4JVOA 3ZE6A 5KPTA 1NBEA 4Z4FA 2EBFX 4JLSA 1W19A 5DHQA 5D1NA 3IILA 1VKRA 2GEKA 2AMYA 3LF2A 3N0WA 3QW2A 3B3JA 3VU3A 3CUUA 1DC3A 1GILA 3I0MA 5HBRA 3E6AA 2OAQ1 3FYUB 5DM4A 3GAFA 3TX2A 5K9ZA 1DOZA 2R47A 2I34A 2IOQA 4EF6A 3DWEX 4BE4A 1M5RA 1REQA 1JPUA 3TI7A 3STUA 4WESA 3PKJA 2HI0A 4KPUB 4MINA 4OBBA 2YBEA 3KEMA 4LJRA 4WUTA 4RSRA 1KVRA 2BM1A 2XLJA 1JIQA 1QYXA 1UEXC 2H2GA 2Z2IA 3FYTA 3GWZA 5FEMA 5ILOA 3BGDA 1IPHA 3DZ8A 3D2LA 4Z9AA 4M3NA 3EGXA 2E4YA 5DSXA 4B5KA 3PWTA 1WY5A 1DCFA 3PXEA 3PWZA 4TTRA 1GFSA 1Z63A 1NURA 3FKEA 1G18A 2ZB7A 3DLPX 3QPVA 3QEKA 1BH6A 3TL6A 2WTUA 3CEPB 4D4MA 4M99A 2XZOA 1JQAA 2DT8A 4K6GA 6CHYA 3L5OA 3AY0A 1CDDA 4ARBA 3CEMA 2B4YA 4BN5A 1TAUA 5HM6A 3DE2X 5CJ2A 4PNHA 2C3OA 1Z33A 2K87A 1FJ2A 2VXBA 1LLQA 3GXBA 3O5AA 2PZJA 4HLDA 4CT0A 1OUMA 1IUNA 1T0PA 4RO0A 5FLXA 1KNXA 4GICA 2ZYRA 1V41E 1GGFA 1M2VA 3D7MA 3LVRE 5EWLA 1XXHB 3BWEA 3FTEA 1WV1A 2W6ZA 4EPWA 1RXVA 4GVLA 4X6YA 4HCJA 1W0JA 1DO0A 3LTNC 4OYRA 3W4IA 3N58A 4YP9A 1JFTA 5BSEA 4LAFA 4C08A 5JAPA 3ZW8A 2O6LA 4JLWA 2JAXA 4RHEA 2FW7A 2Z09A 2P91A 3EXIA 3IAHA 3ZCTA 3VPXA 2NZVG 4OMFG 3ZWMA 4L0QA 3H5IA 1ZI9A 1U63A 2JGIA 3EB9A 1X1TA 4DFDA 3A06A 1R6DA 4U7GA 1GGNA 4XLTA 3U3JA 2QRMA 2VDWB 2Q4OA 3H1AA 5IZCC 2W6PA 1BXRA 2YFKA 1ISJA 2YZGA 4MHSA 4A2WA 3SWWA 1VDDA 1UC9A 1CY8A 1SRQA 1Z13A 3AERA 4OQFA 3VYSB 3CO0S 1PJIA 3A6LA 3DHNA 4YTEA 3QFCA 2MSDB 1T0UA 4YRPA 1SQFA 2MSLA 4BE7B 3QX8A 4GHLA 2B6NA 3U3OA 2AYXA 1NMZA 5I45A 1N5JA 2X0JA 1P19A 3HKBA 3G8BA 2ERYA 3JASA 4XD2A 4C5CA 4GKBA 4PNEA 3LPCA 1GAEO 2O7SA 5A3RA 1KYWA 3UXEA 5KYWB 2ZR7A 4IO1A 6ADHA 3VHXB 4DR2B 1K4KA 2ZEJA 1SXJA 3FPHA 3G5MA 1TRKA 4IX9A 1KI7A 2ZXFA 3GEPA 3L1IA 4IGIA 4Q1VA 4DR5M 2PV7A 4JEUA 4M6WB 1IVSA 5TLSA 1W76A 1YNSA 2PV0A 4IINA 2ZJ1A 1YB4A 4ZANA 1EE2A 2ZBKB 1L5HB 1QKJA 1ZJZA 2BN4A 3AESB 4DAEA 3ANMA 1RQRA 3QXCA 4R6XA 1QH1B 2HIHA 2J9FB 4MGKE 4JLNA 4Q4HA 3TTVA 2V6MA 4U7PB 3A0UA 4YCMA 5BV1A 3D5TA 4DM7A 1CB7A 1USUA 4KIFA 2QLNA 4LWZA 4XQEA 5DLEA 2G1PA 1P4JA 1KAMA 1HX7A 1E3JA 2V4MA 5CFNA 1F0YA 3VJKA 1DEXA 4BIMA 4HEJA 3JQFA 4S1WA 4TKUA 3AQ4A 2GETA 3ZHBA 3MWYW 4WZAA 1RJ9B 4PZCA 5HK8A 1DAIA 1EEXB 2OQ2A 4BLPA 3BM5A 1ZCAA 2AFHA 2XCUA 3L7KA 2WG0A 5IKPA 2O0JA 4ZO8A 4JN6A 1UBTS 3H1TA 3K15A 5LQDA 3T1OA 1IZ0A 3C98A 1JEEA 3KQVA 1RHJA 4CLRA 1CS0B 2JY5A 2I7VA 3HR7A 4B3TM 4J0FA 1LC3A 1JX6A 3RTEA 1MB0A 2OBNA 2PL3A 3HDQA 4QC2A 3UWOA 2BCJQ 3FPEA 1C4XA 3QFHA 2FF5A 1JQEA 2IYVA 4DSTA 2H1HA 4TKVA 2DPLA 1MB4A 1OHHA 4PHHA 4GKAA 1V8BA 4HYYA 4PPFA 3O6VA 3JQEA 4YR9A 5JPDA 3ZD6A 1THMA 2EFJA 2XECA 4FXPA 1HE2A 2G9UA 4YP1A 1CF4A 1SKYE 3NHBA 3TSYA 1HI9A 2PLAA 2OCAA 1A69A 1QHIA 1CUUA 4BQQA 4OB8A 3ICEA 3E22A 1SCKA 4TYQA 3RT7A 2F5QA 3JQCA 2ORVA 2XTAA 4U8GA 3VDRA 2PQMA 2XJ4A 1QAQA 4KPEC 1X8JA 2A94A 4K28A 4MYUA 2R97A 5P8WA 5CG1A 4ZYUA 1QKIA 3LQKA 2MR9A 4DSOA 3NUGA 2C9YA 1MN6A 4H7JA 1RC0A 2J33A 1O0BA 4P4SB 1ID1A 1WDTA 3RTBA 1WZCA 1ZK2A 1VMIA 2QTRA 4OF4A 1NVXQ 5DI3B 5ALNA 5EFOA 9LDTA 1RRMA 1PK9A 1SNYA 2V4UA 3A2LA 5JYCA 1W8IA 3SR0A 5DGHA 3WIEA 4G1BA 2NU9A 3U7QB 3ZWCA 1QIJA 1FTSA 2D0PB 3NC0C 3SEQA 1ENPA 3QOXA 2DR2A 4DA4A 4GHAA 1JE0A 4L57A 1EHYA 1I4EB 1OX5A 2VBGA 2XNDA 1M0EA 1EK5A 4A0QA 1RLTA 3C4VA 2NZUG 2GJAA 5FEUA 1SBZA 3VR3D 1LPSA 3ACCA 2Y9PB 3DZDA 3AERB 1VI2A 4MKRA 1K3WA 4JROA 1Z5VA 1T4MA 5HDQA 3EPRA 5A4IS 3GP5A 1XTIA 4FN4A 3G59A 4RZSA 3UKJA 4HG2A 4BFXA 1JU4A 2WYOA 5F3DA 5JWRA 2HV9A 3BXFA 4HTFA 1MB3A 1MXFA 4HN9A 2IYPA 4H59A 4HNGA 1O6BA 3H42B 4EITA 1DO2A 1MPXA 1GAWA 1QCYA 2P1DA 3AEQB 3IDAA 4FHZA 4FQ8A 4GGPA 4L5IA 3GHYA 4YYZA 5KX5F 3QMVA 1YVDA 4BNXA 3G68A 1GKKA 2OV1A 1GQQA 3DH0A 2ZW9A 2WD7A 4OG2A 3AXTA 1B74A 2YN0A 5KOIA 2YW2A 2VDMB 4CW7A 3A31A 3KOUA 2A35A 4MOWA 4JI1M 1M2GA 2R1VB 2E2WA 1PG2A 3NC4A 2KRUA 1UMCB 2XUHA 3U80A 3UW1A 4C5BA 2ZRPA 3AHGA 3GFVA 4ZGWA 2Z58A 4IFIA 4JD5A 1MO3A 2H17A 2HSWA 3KOMA 3RC7A 4BNTA 1E6LA 2J3JA 4I1SA 3O3MB 2W42A 1R4AA 1Y3FE 4HBZA 3R7NA 5KVCA 4ALKA 4HX9A 2W8BA 4CL8A 3GFFA 3LLSA 1GCIA 4CU5A 1EVJA 2WNHA 4GX5A 3SSOA 2L6OA 4DUGA 3BCUA 4IUCS 1OPXA 1QHHA 3CF4A 1GADO 3CR8A 4MQ5A 5TPZA 1Q1BA 3ZX4A 2P4UA 4OK6A 4M54A 3OZGA 5KCZA 4G0WA 1U3CA 4TYYA 2IY9A 2GARA 1SC9A 1W9HA 3EIXA 3DYBA 2P62A 4JUBA 1S7CA 5IJZA 3EPJA 3H4IA 5BRAA 1EQ2A 4IOKA 2H65A 4OXIA 4MWTA 2W93A 3BBPA 4R68A 1H9BA 1CUIA 1GA6A 2H4YA 1XA3A 3EIFA 3KZXA 2PT5A 1EWYA 1NR5A 3GGGA 3L0IB 3WRVA 3P0IA 3C97A 3HBFA 3IYLW 4E94A 3D6AA 4Q7KA 4RYLA 3G9UA 1DQPA 2B37A 4A6XA 4AICA 4V0ME 1MW9X 1FTQA 2NYVA 1NE2A 1MP0A 4UU0A 1FVHA 1Q44A 2VQ6A 3N6XA 3OEED 3PXXA 4DY6A 5C4IA 4DCTA 1P29A 2REBA 3M4JA 4ZU3A 3O1LA 4OGFA 2A5LA 3FB4A 2PX4A 4OJKA 2R5WA 2GCGA 4O33A 2JDID 4I3GA 3B60A 2AX4A 1GRCA 2MSWA 4OV6B 1FJGM 2GCIA 4P4TA 4HDAA 3W90A 4D9JA 4ZHQB 5AJUA 4NPCA 2WKQA 4K3VA 4RIGA 5C7IO 4TVBA 4D3ZA 3Q8MA 5E1MA 4S1VA 5LWHA 4MB7A 4RTSA 1XHBA 3ESRA 2YMQA 3A2MA 3F7OA 2I2XB 1WZUA 3D43A 3DFMA 4HXEB 1CJBA 5BN4B 4NABA 5A6SB 3CLTD 4DADA 3KAPA 1EE1A 2F43B 3S40A 1H5NA 2PMKA 5LCXA 3T3GA 5I7WA 3B85A 4R8MA 2OAEA 1KI2A 3OHMA 3CZCA 3U9TA 2PX5A 2RIPA 2HFJA 4OEHA 4PN7A 5T67A 3JR7A 1ZGGA 1UEJA 1E69A 2VZ8A 3L7BA 2C61A 3U16A 4N0DA 3UFXB 4WW0A 5BPVA 1NR1A 2Z9DA 3QBJA 5HOQA 4OP1A 3DOCA 5KYXB 4NCJA 4P81A 2NUPA 3DBVO 4I1OA 5FHRA 3Q8GA 4B0OA 2JZ1A 4MQBA 3NNNA 4MUBA 1EG2A 3TZQA 4JXXA 1FFYA 4MIKA 3C8DA 3DTVA 2HSDA 2Q3LA 2BM9A 2WQ6A 2AI1A 2GI4A 1NBME 3ROMA 2FSVC 4Q93A 1XPRA 3LP5A 4RPCA 4WECA 1TLLA 4R71A 1PGQA 1VLVA 1G8PA 2DUJA 1QV6A 1C8VB 2DQ4A 2ZBUA 2IYRA 4G09A 4IJUA 4LVNA 1QQ7A 5J2TA 2EJSA 1R9GA 5DNCA 2BFPA 2HYDA 4DR4M 1P7WA 2P2LA 1RW4A 3HP4A 2DQZA 3WIBA 2ACKA 3EZ7A 2P4SA 4DWWA 4B4UA 2WNSA 2VHJA 1IN7A 1V16A 1WB5A 1X1BA 3JARA 4AP5A 5KSZA 2X9GA 5LKRA 2ZIZA 1XTPA 2UUAB 4LXGA 4ZQEA 3ILHA 2WBLC 4EJ6A 3DE7X 5TGZA 3AI2A 3OOEA 5DBHX 5ED4A 3H9EO 4X1KB 1Y6FA 1K63A 4Z8XA 1FU8A 1R2QA 3IKMB 1GLNA 2WG1A 4ANRA 4S0XA 1JIXA 4QQKA 4LBWA 3QUQA 1ECCA 4MV6A 4RELA 2HF2A 2FZ5A 5HJ7A 3HB0A 3NKLA 1BXGB 2VJDA 3IUSA 5A9SB 2WIJA 4UM8B 2IV3A 3G82C 2LPMA 3QKRA 4JQCA 4MGHA 3R3ZA 1DLJA 3NJ8A 1ZJYA 2I3AA 5GY7A 3D02A 1EFDN 1FP6A 3I2KA 4RY8A 2Y0EA 3LDFA 5JIBA 5KVVA 1KPHA 1SK8A 1U2DA 2O48X 3EF3A 3ZZ0A 4ZV4A 2CLMB 2X2PA 4G37A 6ABPA 3LHFA 1HE4A 1XP5A 2WEKA 2ZZKA 3S99A 3RPEA 3SIXA 1DQYA 4AJKA 4AYXA 1EVIA 2E85A 3PNMA 3UT6A 3BTSA 3N8IA 4KOEC 1ZZGA 3A4YA 3CIFA 4J94A 1MD9A 5BR8M 4XJXA 1RQXA 4Q00A 3U6CA 5B5SA 1JSRA 2XCTB 1UMKA 2FCAA 3IQDB 1VYHA 4G1CA 2GBGA 2B4KA 3JCZA 3VH1A 2VUUA 4H31A 3BVPA 3I5AA 1C3EA 3DKKA 1KPIA 3SKYA 5K0EA 5JZ9A 3LQ1A 4Y2UA 1OBFO 3NHLA 1Y3IA 4Q4AB 2XQVA 1KEUA 4IKPA 3HUEA 5EVJA 1NVVR 4AJNA 4EF4A 1IATA 1GO2A 1LSUA 2XMPA 3SC6A 4LTNA 4S0ZA 1ORWA 4I5FA 3ZHRA 1FNCA 1D4AA 3KWMA 1QUSA 1B3RA 1B8VA 4F1IA 2XVYA 4Y18A 4JA2A 2J0SA 3GPXA 4BGIA 5FTMA 2QU8A 4Y6PA 1E58A 3HZRA 2P79A 5FQNA 2GVNA 2FSFA 3P0FA 3EUWA 3GVPA 3QXHA 4HWTA 4LMAA 2ZJ5A 3PNQA 5EZ5A 5U1PA 2QVXX 1T3SA 1PZFA 2FFQA 3T34A 1K08A 1UK6A 1ZVQA 1EXVA 2QORA 3IT3A 3ZI0A 1YHNA 3AG6A 1SVIA 3GCGA 4II7A 3KQSA 2R79A 3QBVA 4MQMA 2Y0PA 4MUMA 1DKRA 1LLCA 4L5YA 1YA8A 3N5KA 4WFIA 1EFLA 2VTBA 3P96A 4RPHA 4WJZA 3FYCA 3OC6A 1XU9A 1VC2A 5K8LA 2YJTD 4TVOA 3ROFA 3OIUA 3ZV5A 2YXBA 3BBZA 1CG6A 2EW2A 3N6RA 2JZ0A 4RFLA 3RFXA 4TV9A 1AVTA 4ABYA 3QU5A 1P1CA 1OILA 4UBLA 1F14A 4AM8A 3EPHA 1V9SA 2V58A 4HK4A 4AKSA 1UMDB 1TK3A 4JAVC 3DCNA 4BV8A 4C5AA 1D07A 2MSKA 1EUYA 3OSZA 4NH0A 2CMDA 3ND6A 4PLCA 1UT5A 1RXUA 2F4VM 2HXYA 2XDAA 3ZW7A 3KALA 1OH7A 4HLUA 3ZY6A 1FDOA 2F6RA 1QGUA 2QQGA 2RJOA 4CDNA 2WHEA 3BXZA 3RU7A 3E1GA 4I3FA 5ADUS 5JDCA 1TGUA 1IWPB 4H7PA 1TQ6A 1L1QA 3AXSA 4Q9JA 2H5EA 4JP8A 2D7GA 1AGRA 4Q7QA 4AY2A 3SS8A 3QYBA 5F2NA 4NENA 1T3HA 4OXYA 4DUYM 1TE2A 4E3ZA 1HE1C 2WHQA 1EFUB 1C30B 1M3SA 3A2KA 1NQOA 2WKWA 4F9EA 2GLXA 3GUHA 3G85A 3DMRA 1TAHA 1U9YA 1TQ2A 1KOJA 3ZE1B 2Q1TA 3EBPA 4CQMD 4B3DA 3UPUA 2YH2A 3GFGA 2HJGA 5A6VA 1W8DA 4K9SA 3N39C 3ILVA 3Q3EA 3A9WA 2ORYA 2F9FA 2Z7JA 3JATB 3W5JA 3CVWA 1CUKA 4Z9YA 4QXOA 1KAHA 2PUAA 3TSOA 3MOSA 1NJ1A 4ETIA 4TV8A 4UVIA 3QI2A 3RV3A 4JLUA 1Z7WA 4M0KA 5CPBA 2RKBA 1V2GA 4B3RM 1NJ2A 1QZEA 2MSNA 4AS3A 1N1DA 4LJYA 4N8SA 2BGLA 1O89A 1W36B 1R9MA 4A2PA 2QN6A 4KNYA 5B64A 1GSHA 1O94C 1SVKA 1DUVG 4NV1A 1IHDA 2P7HA 4KE9A 4ZU6X 1QH0A 3TKAA 5C9ZA 3PR1A 4EFMA 3EUFA 4DLYA 1Y1LA 1Y81A 3DLAA 4PTLA 3Q7RA 2CJWB 3SF8B 2Z4SA 2WIKA 2V7QD 4BN4A 4G89A 1SWVA 3FJYA 4FGZA 2GDJA 5JYEA 1F6WA 2FW6A 3RIYA 4ZICA 1SO8A 2C2YA 3GO8A 2OCPA 3OKFA 3R5XA 4Q3NA 3VTZA 4H6WA 1WPRA 2JFBA 3D59A 5DHAA 4XEUA 2NXNA 1R74A 1M6VA 1IN5A 4QHSA 2FEXA 2YS7A 3DS8A 1YS9A 2WE7A 3CH5A 5DSTA 4BJHB 4UM9B 4FMBB 2R6CA 3MBKA 4CV0A 1SZDA 4MCAA 2VXCA 2ZPUA 2BFDB 3E4RA 2ETXA 4IGAA 2EXXA 1EFCA 2PAFA 1MA0A 1JHYA 3QTTA 2Q1UA 3JPYA 1R00A 1B3BA 2YBDA 5JCOA 5I7FA 2FDXA 1IBLB 5H8WA 4YY3M 3A45A 1M33A 5EJ8A 1ZL2A 2RAFA 2OXFA 5MGBA 1Z5WA 2QLLA 4OK5A 4A15A 3IHWA 3CVXA 2M2IA 1PZMA 3F92A 1NW5A 2OPBA 3MCWA 3ZZUA 4AF7A 2ID4A 3ZCBB 1Z45A 3TI9A 4UAGA 4DQVA 3EYAA 1XCBA 3H2IA 1LPNA 2V0NA 1FDTA 1T0IA 2XR1A 4UCWA 3UK0A 2HDHA 5IKXA 2Y1XA 1H23A 4DCVA 2W2TA 4FDAA 1PVDA 3LSYA 3EG5A 2PMDA 2PVPA 4OQXA 4TTJA 4WA8A 1Q1AA 4YGXB 4A0FA 4P2BA 4PCLA 1EZ1A 3CS3A 2XHZA 3BH0A 3QP9A 3A26A 2RHGB 5FBKA 4ISBA 4PRKA 2YFYA 4XD7D 4MO9A 3RWMB 2PSJA 1WF6A 2AL7A 3I2IA 3NEJA 4E2ZA 3LA6A 5KYXA 1AA6A 4EGCB 1M2JA 3BXWA 3I34X 3L4EA 4EM6A 5G0UA 3VR4D 4EG6A 1I7SB 5JSHA 3WO0A 5KQPA 2QL5A 3R9XA 2JB9A 2Q5JA 3Q8XA 1LBHA 3HRIA 3K9QO 1ZM9A 3OEEA 1S4MA 5ITXA 1Q7TA 1F2TA 4QGAA 3PUZA 5T4EA 4IIXA 2ZTVA 4RF1A 4B7AA 4X64B 3V1TC 1G8JA 1K9VF 4G6ZA 4NCBA 1N0VC 1TOAA 2DFTA 4M46A 2Z8ZA 1MQ9A 2Y1FA 1VHJA 3TPFA 2E1PA 1G9XA 2HMYB 2HXGA 3KQKA 1WIVA 2P6UA 3LXUX 1D2AA 1ZI6A 3IDOA 3DBIA 3OE4A 1GAJA 5K3FA 3WDKA 4LF5B 3WIUA 4YJ2B 1ZGJA 3SI7A 2RHWA 3CO5A 3UUGA 3LP6A 1QH8A 2QAIA 3ZI7A 1C9NA 1A7KA 2X8WA 3HKBB 2QMOA 1P8AA 1G5IA 4IX1A 3JQ8B 3M3DA 1GCUA 3COVA 1KE1A 4G25A 2G80A 1XRSB 4RY9A 2J5YA 4EECA 3C43A 3LH5A 4ALJA 3FVQA 3COYA 4KUGA 3WYAA 1JECA 3H5WA 3TGPA 5KO2A 4OHMA 1CR2A 3KRTA 4DN6A 5IK2D 3PITA 4GT1A 1SRRA 1UXJA 3WIOA 3T3EA 5JAMA 1CUWA 3C2QA 2IS1A 3EXHA 2HWUA 2XEXA 4DAOA 4S05A 4LE1A 2HMSA 3W0FA 2IS4A 1QF9A 4KR7A 1XCMA 3FSJX 3ZJTA 4FLFA 3TR0A 2Z8XA 4DLNA 2KZSA 2HA3A 5JUWA 5CK5A 4B7HA 2AR9A 2YIVX 3K70D 2OORA 1XZLA 4FNMA 1LEHA 4BWYA 1UOPA 2VAWA 4HGZA 1P8JA 1W36C 1NKVA 3D2CA 5EJAA 3HXKA 2ZTMA 1QHNA 3GLFA 4FI3C 5G41A 4YT8A 2JC3A 4FC6A 3U19A 2H1WA 4ZOCA 4JVMA 4BPRA 1PU2A 2GBPA 1MC5A 2AFHB 1P0FA 2GASA 2I7XA 2YWRA 3AFGA 3CWZA 4O2LA 1X70A 5D5HA 1DQZA 5HYVA 4C6RA 3H7AA 3SYNA 2F1KA 2VTVA 1E5VA 2JFWA 3FKSD 4L9SA 4DC0A 1PV4A 2AN9A 4MVJD 3L8MA 1GM5A 1DX4A 1VLLA 4UM7A 3B78A 4OQMA 2HAEA 1IY9A 3K0FB 4PF1A 4B2IA 3OTWA 3WZ2A 5D84A 3THGA 2XRYA 3GUUA 3HHPA 5JPCA 1YJAA 4P1ZA 1CRZA 5EKSA 1A9PA 4FGUA 5H1YA 3WBJA 1RC1A 5FH9A 5A7FA 5GQSA 1V7ZA 4JYBA 1F2DA 3RFWA 4YPFA 1J7JA 3P5SA 4UFOA 3W8DA 2PZ8A 1NI4A 5AVQA 4KI7A 4DNFA 3ORSA 2Z57A 3PJEA 3Q2KA 2DWMA 1HEUA 1L4KA 3D4OA 4NY1A 4UREA 4KFCA 2D2IA 2QRNA 4XRRA 5T7BA 1EESA 1JJFA 4A3VB 1A7AA 1I10A 2BV3A 3DVAB 1P9RA 1NSYA 1OWMA 2BF7A 2Y2UA 3GCDA 3H1EA 3H9GA 3I9FA 3QITA 3V8VA 5MN6A 2WTBA 1OXBB 4RJIA 2HWJA 4WI1A 4WN3A 4KR3A 4MSUA 1UJ6A 3H1GA 5EYPB 5KQMA 2ARKA 1X7ZA 5BMOA 1ZN9A 3AU8A 1C1HA 1ZK4A 3A58B 2YDXA 4FIDA 2PVCA 4QLOA 3V2UA 1PP4A 1J1IA 1TZBA 1TUBA 3V80A 4C04A 5B58C 5HUHA 5KMGB 3KYDA 4ID3A 3SC2A 4DMCA 2HHHB 2NYRA 2AMLA 2P0EA 3O4GA 2HYIC 2XOEA 4CEJA 2PXHA 3VR5D 1RLJA 1P18A 4UDYX 3CMCO 3WYEA 2REXB 3H1FA 3O8BA 2F1RA 3PUYA 4MWZA 2QT1A 2OLJA 1M1NB 3GC6A 1JB0F 4RK1A 3SXJA 2P4QA 1JEQB 3H17A 1JXQA 1C3JA 1BHSA 3E4CA 3UANA 2XUZA 3FNHA 5BT8A 3G2HA 5J5VA 1ZNQO 4D41A 2P9TA 3VPDA 4M98A 1JAYA 1N8SA 2O2XA 2P41A 2YNMA 5JVDB 3UT5A 3K2LA 2H9YA 1YULA 1QG4A 2VA8A 3KP1A 4MXDA 5AK0A 1RI1A 4ENVA 2IYNA 4GM4A 2GXUA 4IRMA 2OFOA 1I3CA 3WAGA 1AKNA 1XZPA 5ES3A 1WIWA 1QCCA 2JGJA 1B14A 1UBUS 2OUIA 4AK9A 3FZNA 1VSTA 4LFCM 3FPLA 5FUWA 4MROA 4NSNA 1W88B 2XQGA 1JQDA 2H48A 3ELYA 1VHDA 5LDGA 2C0PA 4YASA 5JD3A 4LJSA 3EEQA 4L22A 4DLZA 3ZWNA 1C7RA 2DFDA 2BTEA 2VUTA 4K7JA 2X49A 5KOJA 3A1NA 4KACA 1EUQA 1T1IA 2GEUA 1O95A 2AEFA 3RW9A 1QLJA 1GZ4A 4IDAA 4RA9A 3VTKA 1N57A 3MTDA 1VMKA 3A6HA 3PRKE 5AI6A 4QDTA 2C83A 3GH1A 4DGQA 4L8LA 1TEXA 5DM60 2W2KA 1RYYA 2RARA 3WMFA 1N5RA 3DLHA 2R65A 1VBFA 3PTZA 2H1RA 1IEWA 1KI4A 1NN0A 2H31A 3FGZA 5ITZA 4NMHA 3GGJA 2FZLA 4B4KA 1N2CB 2CV2A 1THTA 4AZ3A 2O5EA 2F67A 2Q5CA 3I05A 3INNA 5A4KA 1ILEA 1ICEA 5LMNB 5IVHA 3RFTA 4LK3A 3MUNA 1MABA 2J45A 4WK6A 7ABPA 1PR5A 1WSAA 4JLKA 5DNVA 3WLEA 4KMMA 3UB3A 5EN4A 5JSFA 2JIDA 3HEAA 3INYA 3C6QA 3OE7A 3DHYA 3Q9UA 3U81A 4D45A 4BY9E 1FLNA 3OCCA 3C45A 3ZWVA 3FRHA 1FMLA 1XZGA 3R0XA 3C41J 2H0RA 3DFIA 4KHZA 5DWQA 1YDHA 4DLTA 1T0BA 3LUHA 1KYTA 4CPDA 5DNYA 4NBRA 3NPMA 2FN9A 1NJGA 2MJLA 4KEAA 3KQUA 4KRFA 4B6SA 3E2IA 1Z5ZA 1FA9A 1Q84A 1C3OA 1WQ4A 3N3AC 2MSEB 4YJ3A 4CHTA 4E2WA 2JG3A 1L5HA 3WBFA 1FFCA 1TC2A 3D3JA 4G9BA 2NO6A 2XDQB 2WAYA 1GT91 3NKFA 1BE1A 4EPTA 4O2AF 2V9ZA 2RGAA 5GP1A 3SBEA 2YYAA 1T9BA 3WLHA 1JQKA 1IONA 1S8OA 5E7MA 1A04A 5F1OA 3KYJB 3WLSA 1KMQA 4JUIA 3GRPA 5LU8A 3EEFA 3QU7A 3QVLA 3I4CA 3VR5A 4FM9A 5GJBA 4IGEA 1IXSB 3FHTA 5EIHA 1YZYA 3E61A 3FE2A 4II2A 3OESA 3PEYA 3U6MA 4L85A 1X3LA 4HNTA 2UXCB 3CVOA 1FU4A 4EFLA 2AFRA 1PFYA 2NADA 3O91A 1O4VA 1UDAA 1XLWA 3A6DA 4FEYA 2OP1A 2PSDA 2Q8PA 4BO7A 1LZKA 3CNHA 1EAYA 1LQUA 1XI2A 1PTJA 1U7ZA 2GCOA 1ZRNA 3BWYA 4FQ5A 4N0EA 4X63A 2QRUA 1PYOA 5A62A 5I9IA 5E95A 2VPXA 5JQGA 3BRCA 3WWOA 5GZ3A 1PHPA 3K7EA 3VVLA 5AW4A 5KYTA 4AJPA 1N33M 3N9IA 1YHYA 4LJLA 1GDDA 4GX1A 1AGXA 5E3JA 3WG9A 2C7PA 3CX4A 1UOOA 8ATCA 1KMHA 3EZNA 1U7PA 1U7TA 2OQRA 4MWGA 4RIFA 4IBJA 3ZWWA 5KSOA 4IS2A 3J81A 2B9VA 2HCFA 3R0ZA 3RU3A 3GPBA 1XJWA 4RSMA 4MUAA 3GJ6A 1DLIA 3FROA 4KYTA 4QYIB 3TL2A 1T2EA 2PUTA 1ZD5A 1UFRA 2WJWA 1SB8A 1HQKA 4I5DA 2QSYA 3EEYA 2IHBA 4D02A 5BOSB 2QM8A 2PMCA 1Q7EA 4BAZA 2I76A 1UAAA 5F1YA 3T0GA 4BO4A 1CLUA 1JFFA 1RBYA 1Z5NA 2E6KA 2VRWA 1RNLA 4DIEA 3RSCA 4Y6LA 4GIBA 3IT2A 5HOEA 4MVJF 2CLSA 3H2HA 3H7IA 2ODTX 2FN7A 3IURA 3KKZA 3FYHA 1NJFA 2GRJA 4X00A 2EKFA 1QMGA 1JNYA 1D4ZA 5LYJA 5MN5A 4UXIA 5CHYA 5FUQA 4BMNA 1SIBE 4ZDWA 3WGMA 1XDUA 3D3KA 4KH1A 3T52A 5EUCA 4IMJB 4Q5IA 3IKVA 5CG2A 1E0JA 1SFRA 4L50A 5TX7A 5DEOA 2N35A 4BWGA 4RTPA 5SYNA 2GA8A 3RSQA 3WLTA 2BHNA 1XMVA 5GVRA 4JL5A 1F4LA 1A8HA 2O1SA 1RKVA 2OZLB 2V7BA 1QHGA 3JQBA 1NVKA 4TWJA 3V6LA 1VRVA 1QUFA 3IPLA 4LPSA 3SVTA 5HZHA 1A77A 3SQDA 4YMTA 2AIRA 4P34A 3OE1A 5TF4A 5K8UA 1FQWA 2AXNA 1X80A 2P5YA 3H1BA 3KXKA 3MAAC 4GOJA 4F3YA 2X86A 1CDZA 4BO3A 3CRNA 3OIVA 3NDBB 5FBZA 1O87A 3GGDA 4X6UA 4JNCA 4ZTZB 1LK5A 3RJMA 4F4CA 3QXSA 4X1YA 5FJJA 3HJAA 3A3KA 3CB2A 4IICA 3WKEA 2ZUDA 4HRVA 4CKYA 3AF2A 5LIPA 3H5NA 4HY3A 5GJVC 2YWDA 1SD1A 1UC8A 3QEMA 4KBFA 1NVEA 5IKOA 1HMPA 2PZAA 2R1VA 1BMQA 3RKSA 3LA8A 1GEGA 2C5GA 3MTJA 3N8DA 3PYXA 4JSRA 4MPDA 4CFYA 2JVJA 4DEYA 3ESYA 5KX5A 3MIIA 1M2NA 1E96A 3LL7A 1XNQB 2G9RA 3G8AA 1NV8A 1V8OA 2PRKA 3FDZB 1KYIA 3M49A 1M1YB 4ITUA 4QSHA 4GWKA 1IM2A 1N1MA 2NZXA 2R9VA 2QRQA 5SYMA 1ST2A 1Y7LA 4I5EA 3TG2A 3ZBPA 3T1HB 2K0BX 1YZ3A 1BS2A 3OG9A 4KSBA 1Y3CE 1GPMA 1NUHA 3LBIA 4HI0E 5EJFA 2AC4A 4HSGA 2PNJA 3CE6A 4AFNA 3WA7A 5AKGA 2GEFA 3ABOB 4S1NA 1ZESA 1P45A 1Q12A 4ILKA 5JDCC 3TZ6A 2LXEA 3CW9A 3IPRA 4UE3S 3Q3HA 1DEHA 2X6RA 1NJ6A 4M22A 4RGYA 3GN1A 3R3HA 3SX2A 3SZLA 4PRZA 4UDXX 4P7BA 3E05A 3WK5A 4EKNB 1RPTA 1HMYA 4M9ZA 2BHSA 3MJRA 2RHJA 4N6GA 1PR1A 1XWIA 4IBKA 2BFMA 1NHGA 1XJQA 2FW1A 2JGKA 3BXPA 4OM8A 1HFWA 2Y6VA 4CRWB 2M6KA 4JI2B 2C9OA 1KY3A 4KCGA 2MCFA 3OTOM 5AVUA 4E1VA 4MKXA 3W2EA 1TCUA 4OHUA 1AQUA 3IUJA 4G0NA 4CKBA 5IJ9A 2EQAA 3B70A 3FG9A 1L5KA 1UKBA 2YJNA 3BILA 1JV2B 2JAUA 3FYSA 3M7IA 5EUBA 4U7DA 3OP4A 4HR7A 2XZPA 3LVWA 3TW0A 3CVYA 1EWQA 3F6SA 3M89A 4L4ZA 1VIYA 1EJBA 3D1VA 3K6RA 4O4JF 4RY2A 3NT5A 4MAMA 5GJWC 2QTVB 1RPAA 1X6VA 5ALEA 4EFKA 2R0QC 2R6HA 3ZOZA 1BWQA 3A70A 3C8UA 3OLZA 3UA3A 1GP2A 2ZJOA 2P2ZA 3OFKA 4TTVA 3ICPA 4ZGGA 5L4LA 1N8TA 5CR9A 1LTHR 4UFPA 3BGVA 4C06A 1G4UR 4LF8B 1P73A 4YJHA 4NYIR 3WWZA 2V0CA 3NVAA 3GNSA 1EFVA 1U2GA 1RAEA 2PBZA 3ZLTA 1C30A 2HJVA 3CUKA 1I3OA 4GYYA 2GQ0A 4DV2M 5BWCA 1DC6A 4QEKA 1RJWA 3G5AA 4MPPA 4MJXA 4LHWA 3REGA 3NEYA 2ZJ6A 4A23A 2J3EA 2HF9A 3PT5A 3L93A 4JT4A 4AP6A 2RGHA 1OXUA 2V03A 3D6JA 2LUOA 5J2UB 3HJUA 1VSBA 3OICA 3AMVA 4O4LB 3CR3C 4D9IA 2YCLA 2CVZA 1S2DA 1VKZA 4O2BF 4YI3A 2P5UA 4B8YA 5KOHA 2HJ9A 2AG0A 1VP3A 1GQ2A 2CZGA 3GP1A 4CMIB 3ABIA 1BE6A 3UXYA 4C20A 3PUJA 2ZUVA 1CRLA 3F5DA 1QC5A 5B1SA 3VPBA 3FGNA 3OZIA 3R0VA 1QV9A 2O6HA 3BX1A 4AT1A 1Q1GA 4NONA 4D3XA 1Q1NA 1XA0A 4D80A 2WJPA 3DKPA 4WX2B 1JXOA 4BWFB 1NNI1 4YVFA 4FNGA 5FI3A 1C8LA 3SF8A 2X23A 5EJ5A 5ICEA 1ID8A 1SQGA 3L0BA 4QOEA 5BSTA 4J9UE 1S8FA 1Y9ZA 3HZJA 1SUAA 2VHVA 3ML1A 4JN6B 2YWCA 4FHGA 3A9RA 3N1UA 5HRCA 2DXIA 2ZI9A 4JNKA 1P44A 1N1EA 3EAQA 2J0VA 4WACA 1ECFA 4C30A 3FSEA 3NX4A 3GW8A 4PX9A 1ZCFA 2O8NA 3O73A 1U8AA 4M9UA 4PU0A 2GSWA 1H5QA 2XW6A 4KX3A 4BASA 5B6IA 2O01F 2HA2A 1RADA 3HWWA 2EDAA 1SXQA 5DXAA 5JXJA 1LLDA 2R87A 2I33A 4ENSA 1JHZA 3STTA 3LQQA 3A9TA 3ER6A 3HFSA 1WV0A 4Q7EA 3GP8A 4KRGA 3PHCA 4C6TA 3K0EA 5AXCA 2P7IA 3DMDA 1L5WA 3TSWA 1QG6A 1HZJA 2NZYA 1JPVA 1OC2A 3OT5A 5BSHA 3IC5A 4B73A 2DAGA 1D2CA 1UL1X 2G5PA 1RYNA 2PFKA 3DXZA 3UICA 1JAHA 2C2BA 2G5CA 2XZFA 3NGLA 3INRA 2ZSIA 3FXAA 3KZKA 3PI7A 4JCOA 2BC9A 4JZYA 3D6NB 1ZRHA 4XOIA 5EG5A 3KAKA 3P94A 2C5HA 2W2KB 3VGPA 4RV5A 5CBPA 4GWLA 3Q3CA 4R41A 1MJHA 2G4VA 1Q3CA 1OZ0A 3MBIA 1YFJA 2DHDA 2QRLA 2WF7A 4BECA 4IY1A 1H1LB 1CE8A 1QH9A 1IVNA 5CAEB 4XUDA 3TAXA 3UGKA 1NYRA 2ST1A 2NGRA 3LBHA 1HF3A 1SC1A 4HGQA 3O92A 1BVSA 2JJ8A 5KX5B 1F60A 3ASUA 3QY9A 5LZ4A 1J25A 1MX9A 3F5QA 2D7JA 3P2IA 1Q83A 1U4NA 3E27A 3OPMA 2R8OA 2KSQA 3VX3A 3VSAA 4BVJA 4DIBA 3CONA 1Z8FA 5J4KA 3ADPA 3U09A 2AN5A 3TK1A 1YKFA 4HXGA 1FLDA 3BFKA 4OHZA 2DHCA 4TS3A 4DOMA 2A3NA 2FDRA 1YR2A 2HDOA 3HJTA 4BQFA 5ALOA 4F3RA 4ZZIA 3LX5A 3ZLVA 3IIEA 1AJEA 5KMGA 3CC8A 2IEGA 4GWGA 3I2GA 5HRAA 4N48A 1TJPB 2GBCA 4QD3A 5DP2A 3UWPA 3RU2A 1YBMA 2DVMA 3MD9A 3UMBA 3VAAA 4G0VA 1JDUA 5A1TA 3DZBA 1TL7C 1PIWA 2JY6B 4FVMA 1SBQA 2YWFA 4UC0A 1YNOA 2IA5A 2BEVB 2HM7A 2Z30A 3GMTA 3EAFA 5IANA 3LUFA 2P5TB 3OFSA 1GL7A 3HV0A 4FYJA 4XGRA 2WT9A 4W5HA 3LRPA 2FP3A 2QD1A 2EARA 2HN9A 5JJIA 2ZJ2A 4EGJA 4DV3M 5ULLA 4K6OA 4XWAA 2DUUA 3VKWA 2O8FB 2IU6A 4MWCA 4LZNA 4DV7M 4QWWA 4E14A 4JFRA 5AOAA 3ZHTA 9LDBA 4A6EA 4G4SO 1G7CA 4R2MA 4E15A 4EO9A 4IJMA 2IXGA 2PGLA 2VVTA 3EQZA 4KXUA 4MLDA 3ZWPA 5LJLA 4UAUA 5HKOA 3FCCA 4NZPA 1N8KA 3R4VA 2F3RA 2J1LA 3SHTA 3HWX1 3WO1A 2X3YA 2YUTA 4JK3A 3BSYA 4C4PA 5DHPA 1GCGA 1F2UA 4JBYA 4DBLE 4D96A 2MJ5B 2Y0DA 2L2QA 3D7LA 1HORA 3NHWA 4MS4B 3S6JA 4PZUA 1G21E 2EVWX 4ZQCB 2V7VA 1QE3A 3DXXA 4TMWA 2KJQA 2CNWA 1NLZA 3FVVA 3GI1A 3QQPA 4HDCA 5LLTA 1D6MA 1TQHA 2JAQA 3WXBA 5JQWA 2W2PA 4Q3DA 4B7ZA 3CLHA 5E7JA 2JI4A 3GIDA 1LF0A 3HDTA 4J0JA 1TGVA 4JBXA 3HJRA 2WSIA 3R09A 3GRKA 3CSUA 4OQNA 1THGA 1D2MA 2UYYA 1KOLA 4QEDA 2BEUA 2B8TA 2AG5A 4EBBA 2XMBA 2ZJFA 2IKQA 3IH5A 3TUZC 3LWZA 4H7DA 3AT1A 1IULA 2AC2A 3BFJA 3GFBA 4J4HA 1V5IA 4N82A 4X1IA 3TXAA 1U81A 4X45A 4DR3B 4B3MB 1NHWA 3SEAA 3DVSX 1OI3A 2O5RA 3EZFA 1AX9A 1WB9A 3HU1A 2JAOA 2BJHA 3H5LA 2HHCA 3OJXA 2NQ8C 2JFHA 4HNHA 4DV0B 1T2NA 4ITVA 2K2QB 3U9SA 5JRZA 2GAFA 4HJXA 4IIWA 5DDIP 3TD6A 1GZ5A 4BLUA 3MS4A 4ETNA 1GR0A 3A27A 5DMHA 3M5DA 4HN4B 2OZLA 5HF6A 2Z4RA 1O6FA 4QLBA 2H4FA 1E1RD 1G55A 3SQWA 1KIMA 1XCLA 4DWVA 4GO1A 4NU5A 3F2IA 3M3HA 3ZVLA 2YV5A 2JA1A 1R5NA 1S2OA 3C1TA 3FBTA 4XARA 1R0ZA 1M8FA 4H7KA 2V8OA 1YUNA 3GDGA 1P75A 4TKUB 1F9EA 2W4MA 3PUKA 2C8LA 2C7VA 2P9JA 5FXMA 1CUZA 1LC0A 4BRWA 3AR4A 1X1CA 4ZCIA 1YB6A 4BZWA 2BFFB 2XNDD 3CLSC 2HSGA 2IPMA 1QPZA 4II3A 4AUMA 1CRPA 4QDJA 4CCSA 5BNFA 1GPJA 1T2FA 2VEOA 2MU1A 1E7QA 3AV0B 4P7KA 1XELA 4AY3A 4EFNA 4BMZA 4DR6M 2O50A 2ZTHA 1CUYA 1N7JA 2Z9BA 4KV7A 4LI3X 4EG7A 5LNK6 3UATA 3ZCSA 1RRVA 1T2DA 1XQXA 4F2WA 1W1UA 3DBRB 3DWFA 3ASVA 4N4AA 5HGJA 3VYTB 4CKEA 1EUDA 5C8VA 5C8YA 4A26A 3IQGX 4QLAA 3V00A 1HZZA 3I2FA 4ZAXA 4V0LA 5HS6A 2AEMA 4K2HA 3LCJA 3IALA 4UDOA 4ZDIA 2KW0A 4HYTA 1Z25A 1N6IA 2WMNB 2QTAA 4J16C 2NO1A 3T3HA 4GI5A 2PXAA 1ZC4A 3BWCA 2C4VA 4ARAA 3AP2A 2J0QA 4D57A 1L8XA 4M0PA 1EA5A 2PLNA 4G84A 1G5TA 3IMEA 3JVDA 3PUVA 4XTRA 5AHRA 3ZUPA 4AWXA 1AD2A 1YJQA 1CSEE 4HDOB 2DUNA 1E1MA 2QJRA 2M60A 2W22A 4Q02A 4ZEWA 4WBNA 1N2GA 4FR5A 5DCLA 4EJFA 2X0RA 2RBKA 4RK0A 2FF7A 4X93A 1FE8A 1ABEA 4B2LA 3IUBA 4X6XA 1IY1A 3OOHA 2ET6A 3IQXA 3HB4X 1SUBA 3CN7A 4ZI7F 1PFGA 1G5RA 2Z2YA 1DO8A 1U94A 2ZQ5A 1E9EA 3IJ5A 3N2KA 3A04A 4K03A 2IEDA 4F6LA 4G1FA 5DIZA 1VOTA 4B82A 2AFIB 1E4EA 2ZI4A 3AJ9A 2R11A 1ZH8A 2QG4A 4I36A 3GZNB 1M6WA 2J5RA 2Q3CA 5DYWA 2OEPA 1JDZA 2NVBA 4BTEA 1O94D 2ZAOA 4M37A 3HCNA 3N2EA 3AGPA 2ZK7A 3MERA 5AOVA 5MN4A 1AZWA 2N3ZA 3X2EA 2Z6UA 5JO9A 2YFHA 4R31A 5IH7A 4I5GA 4UMDA 3J7BA 4UEJA 3KE9A 1V6SA 5JRJA 1K7YA 3GZ4A 5ITWA 3JQAA 1QO9A 2KW5A 3OPYA 4MGIR 3H6KA 4ER5A 1V9CA 1G64A 2H5IA 2QS9A 3IUPA 1H42A 1C4KA 4QFBA 4URYR 1ODFA 1PR2A 3VUEA 3VDPA 1CZOA 3FTCA 2RK6A 2WJGA 3A37A 2JS7A 4A9AA 5JCZA 1PK7A 2ZJYA 4PO3X 3ZLBA 1NIJA 2QX9A 3AFIA 3LECA 4K9PA 5AW2A 2D4AA 2JHPA 3VZPA 4HAYA 3UZUA 2ZANA 3ODPA 2H29A 5I9SA 3R7FA 4AJOA 4CQMA 4JVNA 4LV6A 3LTEA 2P6OA 5JD5A 4FCWA 1PJ2A 4Z4GA 1T6YA 2XB2A 3B1KA 1FMCA 4JBWA 3TMYA 1K82A 4GX2A 1THZA 5BQOA 3DOOA 1AK1A 3U7FB 3FHOA 1V34A 5DTIA 2C92A 5GM1A 5LOVB 1ZQ9A 3F6PA 1L7QA 3QGMA 1YO6A 1RI2A 2IEAA 4PAMA 4TLCA 4WBSA 4D43A 4IEFB 5LXTA 1JG4A 1RLIA 1VB5A 4MYCA 1SVUA 2A9RA 3FDZA 4IJQA 4IBIA 3FJOA 1JBKA 2WVJA 1E3WB 3ESBA 1XTBA 4ZPJA 4CF5A 4QJ5A 2JD1A 5I3CA 2F17A 4HUJA 3WQQA 1I51A 4EHFA 2G06A 2X6QA 3RUEA 4ER6A 4EVQA 1CQWA 3TLCA 1W0JD 3IP8A 4ZARA 4ZK6A 3LO5A 1GVNA 1PFKA 2PX8A 1PT8A 1HA3A 2QUJA 4QGFA 5HBGA 3V4PB 3WJ2A 3EGCA 2K5UA 1QFYA 4PTZA 3OPNA 3WGHA 3ANLA 1Q0ZA 5DYTA 3OURA 4LHVA 1NNJA 4OHKA 3FDJA 4YRDA 3S70A 2I9KA 1AS0A 2QVBA 4URHA 3HG7A 5IH3A 2C2OA 3RVKA 4DDUA 4G0UA 3ICQB 1GTZA 3SARA 2JFZA 4PLYA 1HT3A 4AUEA 3RODA 3C8ZA 1Z12A 2ZWAA 3JVUA 3GCZA 3TE7A 4JV5M 2Q5EA 3UBTA 1OWNA 4YUVA 2A58A 4B3SB 3F3KA 4B76A 2YN4A 1NQTA 5IW8A 3HHZA 3R75A 3UMRA 5GIOE 1FFXB 4LE2A 2WTMA 1JLSA 2NPOA 2VPQA 3CPHA 3ETCA 1XJ5A 1YS4A 2W6JA 2ZPAA 4G4GA 1U8TA 3N76A 1TUEA 1ZAYA 4NNPA 5DJ5A 2ZOSA 2C8KA 1YIOA 2YXDA 4ZAZA 3KVWA 1Z8DA 2HFKA 1N0WA 3PGA1 1QGZA 1TM3E 2OCDA 3LQ2A 3HY5A 4MW7A 4Q19A 4PY2A 4ZVOA 4C76A 1WAMA 1F8FA 4EMUA 1ADBA 1HWYA 1UM9B 3RSGA 1T36B 4V24A 1WUHS 1A1VA 2FRVA 3PE4A 3W5UA 1G9TA 1NPTO 1VFNA 2QZZA 3DKVA 4TV8F 4NS1A 3LGSA 2HLPA 3BJMA 3SQLA 1LZLA 1W52X 2YMPA 4AO8A 4W9NA 5FL7A 1DWQA 4QUAA 4BO9A 4H3HB 4D79A 4YRKA 1HDYA 4A3SA 3I51A 3JQ6A 3AV0A 3KOZE 2IZ0A 2HU5A 2F5NA 3KYDB 2YICA 4QJ4A 5SICE 4DLKA 2R0IA 1DC4A 1ESMA 1TCBA 4US1R 3WL3A 3USZA 3H0KA 2WD8A 4KBGA 3PGMA 3GY0A 3HKDA 2H63A 4O5AA 3ITDA 4RLSA 3W7BA 1Z83A 2RH4A 4K1LA 3VOBA 5BSGA 1VHTA 2PSSA 2WM2A 4NFHA 2IIVA 1OLSB 5I9BA 1IXKA 2PD4A 1ANKA 4RFSB 3VHLB 1ZN8A 5DP1A 4YO7A 2FB9A 5EHQA 4UEQA 4ZVRA 5J2TB 2IRWA 1ZS9A 5AJHA 2AQKA 5IK2A 1EXDA 4JC4A 3UC5A 4LNAA 2JLBA 2PN1A 3LZCA 2XD4A 2YVUA 5DWVA 2JLRA 4QHTA 3SJBA 2ZFUA 4KGXA 4R7ZA 2JBAB 4WOKA 5DE3A 5EFZA 3ORQA 1HQYE 1R88A 4RAQA 4ZTUB 3PIIA 1GIAA 4JS0A 3JTMA 2AQHA 3K92A 5I3ZA 1CR4A 4GYWA 5IKMA 4KLZA 4LHYA 3SMQA 1GA1A 3NYWA 1ZJ4A 4FEEA 4ROSA 1OKKD 2KLBA 4LUCA 1IM8A 3G2QA 4Z2YA 3ZE0B 1YR3A 3GJ4A 4X1KA 4TV9F 5COAA 5ECYA 1RYZA 3HDYA 4ZYVA 5CNMA 1X7WA 2FQ1A 4JBHA 5JMPA 5HKLA 4PYNA 3UF0A 1JTEA 2UZ0A 1G3IA 1W49A 4Y9RA 5HM8A 3AIKA 2BUBA 1ZXLA 2FJ0A 1QOZA 3F6RA 3AUAA 2QR2A 2B92A 2GD2A 4DIDA 4GQAA 5JSZB 3ZK8A 2FLWA 1RVV1 3FNGA 1Z4LA 4MR9B 3V2HA 4U0JA 4WT7A 3OX3A 4UBKA 3ZOKA 4BCCA 1AQIA 4GXTA 4D0LB 3I62A 3D3QA 1PDOA 1T10A 1C5KA 3CKKA 2ZVJA 4I9UA 3R9WA 4TN1A 2GZDA 2G70A 3BWVA 3KU4A 2X8AA 1YJCA 4KRYA 4QXAA 3S3TA 3VAZA 1NXPA 3R76A 2PCLA 1JB1A 2MR5A 1UBEA 2W5UA 2ZUUA 1CUVA 4MS4A 5KYUB 3F9IA 4FWHA 1YTLA 4O8CA 4RPJA 1A76A 2OGSA 3T12A 1ZHFA 2IXFA 5HE8A 1J9ZA 1N3YA 3FCAA 5CXSA 3RF6A 2P3QA 3TQFA 4ZDJA 3T06B 2J59A 3G0BA 2DH5A 2DCUA 5IM4F 1JTVA 3H5OA 3BMNB 3W5DA 3KUKA 1H1LA 3ONEA 1ONOA 1KSHA 4YONB 1XPJA 5EXTA 4QPJC 4NJOA 5KU1A 2GPBA 5FA6A 1SKUA 4ND8B 1SHZA 2IK8A 3K4PA 4XASA 2GEBA 3VU9B 1PTJC 1QK5A 5FKJA 1MKYA 3ELDA 3MWJA 3RVJA 5DW3A 2EYQA 2IXEA 1Z5BA 2D1SA 2OO7A 4DV1M 3BCHA 3B1XA 4PRYA 5ITUA 3UMVA 1H8HD 4ERNA 1UJ4A 3X1WA 1ZGHA 4QARA 4ZVSA 2Z3XA 2GHIA 1MRZA 2C9BA 1N9GA 4O4HA 1UBMS 4TYMA 3ZCPA 4B84A 4DXAA 4ZQHA 1PCXA 1LU9A 3DMNA 4NJMA 3B2NA 1FX0B 4ZRDA 3OCYA 4TYWA 4D9MA 4MUIA 1XTKA 3DBHA 4BFTA 5CM8B 1C7FA 3WNDA 4G86A 2FFAA 5IT5A 2OA0A 1V3QE 5CLQA 3BAZA 1P62B 2B0JA 1RTKA 3EWSA 3BGSA 4G63A 4ZCPA 5H0IA 3WKAA 1MO2A 2X5JO 4MV1A 3WL8A 1E6MA 1Y6ZA 3D1JA 1R0WA 1HNXB 1N33B 3I5XA 2PUVA 3ETGA 4ONEA 2GF0A 2XUPA 3F8TA 4BQRA 2DFNA 4FGJA 3L7JA 4PICA 3NNSA 1P74A 4PONA 1T1GA 3BK7A 3LY5A 4KK4A 3KJNA 5LJIA 1SA0A 1ICIA 1ZLYA 2KNZA 4QTXA 1JG3A 2XKJE 2IVZA 4L51A 3K1AB 4B4WA 1L7NA 4TTAA 2GTPA 1EU1A 2I6TA 2WIFA 4ZVMA 5C5CA 4JB0A 4DBZA 3KFLA 4X85A 1BG6A 4A0HA 4BEJA 4KVFA 1XEXB 3THYB 3QQ5A 2QN8A 1M67A 3WDSA 1M1UA 3FTNA 4QO8A 4AJEA 1HNZB 4RAOA 1XDGA 4HDNB 3DZIA 3VSDA 5C46F 1DGFA 2CE7A 1BXGA 1NP6A 1GN8A 3KLBA 2GN9A 3QKSB 4J0DA 4KHPB 1FTGA 4K87A 4AO6A 4H7IA 1YK1A 3FVRA 3ZBTA 1QIEA 4INPA 2DSTA 2ZSKA 2AZDA 4Y9TA 1IAQA 3NWEA 4KH0A 3TRJA 4AWBA 1JSZA 5M3BA 3WRYA 1AZSC 1NTRA 2ZS8A 5K01A 3WIVA 4L75A 3TOZA 1SIUA 3WLJA 1TTEA 1P1IA 1U6IA 4PSAA 4AN1A 4EAAA 5HVNA 3E9YA 1JF8A 4JYZA 1DRVA 1V7QA 4CQMB 1EZZA 3SHGB 1OQYA 4KO2S 4OFWA 4LF5M 3GELA 3SZGA 1QP8A 2JLWA 3F73A 2Y76A 3CNLA 1HDOA 2QMQA 3QSYA 4I8XA 5KDOA 3DCYA 3GG9A 4ZI2A 3MFQA 3GJ8A 3K09A 1AIPA 3U6KA 4R69A 5DVZA 4AX4A 2NU7A 3G7UA 1LPAB 1JLRA 1H22A 1MDFA 2IZ7A 2C4KA 4YRLA 1R0YA 2PGNA 5GAJA 3N8KA 2V8BA 4AW9A 1ZCZA 5YASA 3KT0A 1JKJB 1HT2E 2O9JA 2IUSA 1EAMA 2XYPA 1SCIA 4TLAA 3T8YA 4NMWA 2OV2A 4NZOA 1JE1A 1QU3A 4JC0A 1D9XA 4C4ZA 1TMGE 3QX9A 1EFTA 2IPXA 1JDBC 5AVZA 2XEDA 3WP1B 4BIIA 2BZ1A 4QASA 1E99A 1BO6A 1WVIA 2HX1A 3RRYA 2QTCA 4ZKEA 3BTOA 2HKIA 2V54A 1F06A 2ATEA 1GQSA 3OZCA 4LZZA 1UBOS 3B3FA 2YXPX 4R05A 3SOZA 2WDZA 4JL6A 1T4CA 3GBSA 1W85A 1MOPA 1GKLA 3O8QA 3MWKA 4KQGA 5IYZB 4AJIA 3PNOA 4W1PA 4NECA 2B5VA 5E1DA 3W8EA 1AMOA 3TDKA 3K0BA 3PHHA 3RHTA 4IIVA 4QU0A 2C4WA 4RY0A 2GN4A 4G5QA 4H3VA 4RK4A 4WJKB 4AIRA 1LK0A 3H83A 1KU0A 4PN3A 2UYCA 1CX9B 4JI5B 2W2LD 1RM0A 4HVAA 3U6QA 1N9GB 3QRWA 4O4HB 1FFGA 3DV2A 3WWPA 5MDHA 1ZP6A 4TZ0A 4IMIB 4WMLA 5ADWA 3LMMA 1PZHA 1C14A 1FSSA 1RXEA 1KO8A 1OY1A 2J9RA 2JAWA 3FRJA 4Q03A 4ZMRA 3P8ZA 5A5EA 3N53A 4INZA 1ISSA 5TGTA 1ZOOA 4WGGA 2TS1A 2ZI7A 3OECA 4P7FA 4D6YA 4KSYA 2FZGA 5GINE 2N0SA 1QP4A 1EQAA 2IU3A 5DSZA 1EUDB 1JZTA 4RMIA 3STVA 1K98A 5C7YA 2RH9B 4ZA2A 4RJKA 4CGYA 5FWAA 2WW8A 5F77A 4N5HX 3U39A 1H4SA 1J2UA 2Q2OA 1A2OA 2CUTA 1FXUA 2KBFA 5H59A 1TVKA 3WYNA 1QCZA 5E1BA 5K3EA 2HT1A 4I8DA 4GL2A 2Q41A 1AK2A 5IARA 1ZMTA 2HIAA 4K3UA 1H2WA 3NEPX 5CA1A 4OJNA 1Z7GA 3QVSA 3DULA 3TZHA 4E1BA 3GOQA 4FJ2A 4U2FA 3UAXA 5BR4A 5FPYA 1BJTA 2ZDQA 3LW7A 3O4FA 4R1PA 5J4HA 4K05A 4LZWA 4DCMA 1I2ZA 1ND5A 1GYRA 3OJLA 3UA4A 2XE6A 1YAHA 3AG5A 5BN1A 1TU0A 1HFJA 1HKHA 1F2TB 3ZUGA 3L7NA 4A92A 1F2VA 4NXMM 1L3BA 4FFSA 4KNVA 1ZGBA 4FDUA 5AKXA 4IBEA 5G2OA 3T5BA 3ZV7A 3BQMB 2OLKA 1DKNA 4RQUA 3ZD7A 2UZ1A 4JIGA 4YDSA 1NQAO 4LQLA 5ANRB 4DYDA 1TMKA 4RF4A 3I61A 2DHQA 1B7GO 13PKA 2ONKA 4D42A 5J4YA 2AGVA 2E48A 1A0OA 5KQDA 4MRVA 2XKKA 3PCRB 3CVVA 1NVAA 3IIJA 2PUBA 5GPBA 4RFVA 2UAGA 4U7FA 2ZULA 4F45A 4V0NA 4M55A 5D7NA 3D4LA 3OP1A 4CIVA 3BTVA 5AK6A 3EA4A 1NVWQ 2XNCA 5LMNM 2B8WA 2JIBA 2PPVA 3ZGVA 3ZCVA 3T5PA 4J9VA 2UUBB 1W35A 4IMPA 3WIDA 4GP7A 3FNQA 5LSAA 2O8BA 4Y1RB 3WLLA 1ZINA 4LSGA 5EGNA 3TM5A 2NM0A 2R60A 1G6HA 4N8EA 5DOZA 4ZO7A 4YNBA 4UQPA 3KZOA 5ESWA 3FIJA 1E2BA 2YZ7A 4D8UA 4D3YA 1FRFS 2F3QA 4M0LA 4UVDA 3SIRA 3GRUA 1RHMA 4F38A 3UK1A