3GUVA

Crystal structure of a resolvase family site-specific recombinase from streptococcus pneumoniae
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
151
structure length
149
Chain Sequence
KIKVYLYTRVSTSIQIEGYSLEAQKSRMKAFAIYNDYEIVGEYEDAGKSGKSIEGRIQFNRMMEDIKSGKDGVSFVLVFKLSRFARNAADVLSTLQIMQDYGVNLICVEDGIDSSKDKLMISVLSAVAEIERENIRIQTMEGCIQKARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Site-specific recombinase, resolvase family protein
publication title Crystal structure of a resolvase family site-specific recombinase from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Recombination
total genus 56
structure length 149
sequence length 151
ec nomenclature
pdb deposition date 2009-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3guvA00
5C35A 3GUVA 3UJ3X 2R0QC 2MHCA 5C32A 4BQQA 1GDTA 3ILXA 1ZR2A 1HX7A 2RSLA 1ZR4A 1GHTA 5C31A 3LHFA 2GM4A 5C34B 3PKZA 3LHKA 3G13A 3BVPA 2GM5A
chains in the Genus database with same CATH superfamily
4UPDA 5ISMA 1URPA 4TWZA 2H0RA 1R4NB 2PFGA 2UZIR 5LLSA 1XRQA 2ZI3A 3RUFA 4FHEA 1ULTA 4HWTA 4DMKA 4HDKB 1GYQA 1YRWA 2P9GA 2XYRA 4XFJA 2PKQP 4JZYA 3TIFA 3TNYA 1LLUA 1WMEA 4LRTB 3OICA 1QGED 3H6KA 4G5OA 1I3LA 4Y2RA 2JAHA 5IDXA 4N8EA 3IHWA 2QYTA 4OHXA 3BUSA 3EPHA 1U8FO 3W8FA 4Q4JA 4EWLA 1UOEA 3CX4A 3LJKA 5JBIA 1XRRA 2B36A 3U2QA 1JAZA 4J16A 3AEUA 2QSYA 4JVSB 3O94A 5KVAA 2PEYA 1DBQA 5GWXA 2VWPA 5EXDA 2CHVA 4CKBB 4WY2A 5AKYA 2QZZA 1BHJA 2QJFA 4HMPA 5HCIA 1XDGA 1KEZA 4CMBA 1XMJA 1KPHA 5EJ9A 4IIXA 4CDGA 3P2OA 3UOGA 2IEBA 2JI6A 3RC3A 3R7WA 5JXIA 1JQ3A 2WTUA 1RWXA 2C20A 2QQ5A 1XRMA 4KUGA 2AOXA 2YS6A 3QENA 5FNVA 1DIRA 5I4CA 2P6NA 4GYYA 5L95A 4W99A 2V5VA 2OV4A 1R64A 3ERCA 5AKIA 2P2DA 2R6AA 2I03A 1T2EA 5L7TA 2OBBA 2XY4A 4QHTA 1JXQA 1JXAA 2HC9A 4JT9A 5CXSA 1SEVA 4DM3A 1FB5A 2LP4Y 1UINA 3AHJA 3HM2A 2O8BA 3AM4A 4CDMA 3PWTA 3VNUA 4MW1A 4BFCA 1R0XA 3D3QA 2J5XA 3F0TA 4JUIA 3GFSA 4JYBA 1KEEA 2J5BA 4B34A 4NXMB 1DPFA 1RPNA 4KQFA 3URMA 2Z6AA 1ZD2P 4B3GA 3TTWA 4P7FA 4BKPA 3HN2A 4FE7A 1EWKA 3V4PB 1NXXA 4PZYA 2XDQA 1Z13A 2I65A 3CXRA 4KO1S 4AI6A 1QFZA 1AUXA 5L3QA 3FVQA 3WTCA 3EXFB 4C04A 3JVEA 4MDFA 4Q3OA 2IYEA 3CONA 4TTVA 1ZK3A 4JQOA 1NAIA 4G01B 2V4MA 3VPAA 5CEJA 2H51A 1G6OA 1E6UA 1YK0A 2LUOA 2QN9A 3V9AA 3V4RA 1K7XB 2GEVA 4KH0A 3ZDFA 1WZ2A 3AWDA 3EC2A 1E9EA 1ZGJA 3IESA 1WUYA 3K5IA 4DS3A 2IHVA 4ALMA 3C3DA 4BLWA 4BFWA 2ZRPA 3TLYA 2NYUA 1XDUA 1M6NA 5TGZA 3R6LA 3UC5A 2HKIA 4YXWD 4UM8B 1OI4A 3EVBA 3JQQA 1Y42X 4PVCA 5BV0A 2MSKA 5JI3E 4MIOA 3DNMA 2BMJA 2PX4A 4AKSA 1WU7A 1N5RA 2H57A 5BUQA 1Q2XA 4HDMB 1Z56C 4JJEA 5I5EA 1FJHA 2ZWMA 2CJXA 4MQMA 1ADFA 4YO7A 5EN4A 5LJIA 3PQ5A 2JHAA 2SBTA 2R7AA 3UA4A 4PC6A 1PYDA 2P5UA 3QF4B 4YJ2B 2X0IA 1H05A 2YWHA 1HETA 3Q7PA 3ZI4A 9GPBA 2Y05A 3UMRA 3WKBA 4NJEB 2P2CA 4LXYA 4UE2A 1HWYA 1T8TA 1MRNA 3LDHA 1T0HB 4PGGA 2FSVC 2HK8A 4ONEA 3ZI7A 3ZJVA 3MTAA 1JGTA 2YDXA 2BM0A 1ZDMA 3ND6A 3QHPA 4QGHA 3P2JA 4E21A 4GNRA 1GTVA 2VYVA 2FZ4A 4ENTA 3CPHA 2HXSA 3PEUA 2H52A 4BVKA 3A70A 2ZRDA 1YB4A 4XEUA 3SICE 4YNBA 4YFYA 3QX7A 2BI8A 2N1MA 5CFRA 4EPRA 1OI2A 5BQ3A 1S0UA 1KMCA 2V7GA 2C96A 2Q0QA 4TZKA 1OYWA 4ZREA 5IKPA 4CM4A 3AY6A 4RA6A 1UAGA 3TECE 3U4QB 1JFFB 1Q83A 3WMGA 5CDUA 1LJUA 3L02A 3CBQA 4M7WA 1E2FA 4DR6B 4DIMA 5DXFA 4MWGA 1GPYA 1L7DA 2J32A 3NHJA 2CMFA 3REFA 2BDEA 1ADJA 4L4ZA 1VGVA 1FJGB 3BWXA 5E6UA 3HCEA 3WLTA 4L8WB 5M34A 2CJYA 4X3OA 1DZ3A 3PVZA 1QO7A 4P3XA 1SVWA 3S40A 3NAGA 3WXMA 4C3ZA 4RH1A 4TTSA 4WLFA 3T5AA 2BL4A 2WF8A 4RTLA 1SXJD 3TD9A 3HMKA 3UQYS 1O5TA 4MJLA 4RMIA 2FPIA 2D1YA 2J45A 4JYCA 5TV2A 4E13A 3EIEA 1VMDA 4X91A 2GWHA 4R2IA 4XSVA 4JR2A 1DRWA 4AZWA 3B3AA 3AVWA 5FIUA 2O3SA 3L8HA 4WXYB 3WS7A 4MARA 1W2WB 4BP8A 4K9OA 3RV3A 1O7JA 5CEEA 1ORTA 2I33A 3DEIA 1BVYF 2C2GA 4HNUA 3DXXA 3ANYB 4L6AA 1E3IA 2QKYA 2R6JA 2B4YA 1PJZA 3QI7A 3RVPA 1L4UA 2UYOA 3TIIA 1JR3A 4FBMA 4NYIR 3RTGA 3RQIA 1LBQA 3CIFA 2X7XA 3PPVA 1IZYA 3Q8XB 1G8HA 2NSLA 4KO2S 4QX6A 1O94C 5B1HA 5KOYA 1GRNA 2F1IA 3GGJA 3N2LA 3NCHA 4IHQA 1MJGA 4M38A 4MKHA 2CK3D 1T1GA 4R7GA 5I4BA 1LLQA 4BEBA 3HM9A 2C57A 2QEQA 3QIAA 1ZL2A 4EM6A 1EUCB 4M0CA 1N2ZA 3K1TA 2EHJA 3BMOB 1SVMA 1S7GA 3RT1A 2NO7A 4CF3A 5K0SA 4GR9A 3DWGA 3UV6A 4AUMA 2P9ZA 3H0KA 3NYWA 3ASVA 4YRPA 4MVJM 5K3AA 5AD1A 5KDDA 1MIOB 1WNFA 1E2PA 3KEOA 1ZN7A 2PVSA 3R5KA 4FNGA 1U7ZA 3ZWYA 2Z43A 2Q4BA 1EB9A 2R4TA 4JMLA 4B3SB 2IHYA 4Q48A 5TIIA 1HDRA 1PR2A 2XCTB 2HJ9A 4GUDA 4ZC8A 3AZQA 1EFTA 1U4OA 2NXWA 3ZWCA 3ZJUA 4IIHA 1T3SA 1JHQA 1T43A 3A1NA 1K9SA 1FU8A 3BWBA 3OHSX 3P9IA 4D9EA 4DYVA 5J4HA 2IEAA 1UT5A 1NIPA 2JZOA 1PQPA 2QN7A 1D4OA 4EBFA 2VRCA 4G23A 4D3ZA 4ETMA 1M1ZA 4N0MA 1KEKA 3JAKB 4RTOA 4PVDA 2IRWA 3RUAA 1KSGA 3A05A 2VPPA 2HTFA 4LC9A 2QY9A 5H02A 2XTJA 1XP5A 3PIRA 4TMZA 4X7MA 5ENZA 3SQOA 4BRSA 5BXQC 2EP5A 2GFIA 2PUEA 1G3QA 1Z0DA 2C8KA 2PZJA 3MERA 2JA1A 3O0TA 3B82A 4MW0A 1J22A 4JI3B 2RH4A 1RVV1 2A9FA 3ELUA 2IBTA 2JFNA 1A8SA 4UFOA 3GMDA 1EESA 1N1MA 2VJPA 3HWWA 3G8AA 3DBOB 4WZBA 1USKA 4DM4A 2QU7A 1O8BA 2QRQA 1RVDA 3PL1A 5FFNA 3ANNA 2BSXA 4IS2A 4DC9A 4GRDA 2PKXA 4R3NA 2QTHA 5HKLA 3OY2A 4IIDA 4CQLA 3ML1A 3T3IA 2PKWA 2JJ1A 3AR2A 3ZR4B 1G21A 1ZWLA 2ZB7A 1XA3A 4AICA 1F9AA 3MJTA 4GGMX 3CT4A 4LBVA 1MV5A 1N0UA 1E5DA 2WKWA 4IGIA 2R25B 3DOEA 5CH5A 2BBOA 3LYLA 3RROA 3TL3A 3IPCA 1G5FA 4Z53A 1EX7A 1JIKA 1NR1A 1TUGA 2QVXX 3KUXA 4RVDA 4EKYA 2DVMA 5JCPA 2JGMA 1L5MA 1U7XA 1DHTA 5CT8A 3W7VA 3BQMB 4Q82A 5IT4A 2ADOA 2CFTA 2EQBA 3KOXA 4YRMA 1NI5A 3EC7A 1NP3A 2AOUA 3CEAA 4L27A 4AS1A 4GMXA 3ZZUA 3HADA 3D64A 1T36B 3FKSD 5KYXA 1J07A 1EFHA 2J08A 3GAFA 4ND7A 3V4FA 2ATIA 1CB7A 3GG2A 3T9BA 1C30A 4O4JB 2R1TB 3L82B 5L4NA 1DGQA 3IB6A 3CVJA 4Q4AB 1MW8X 4LZNA 5ITWA 3L0OA 4M8LA 4J4HA 3QA3E 4KHPB 1R10A 2OCXA 4B4WA 3T95A 2AJLI 5C37A 1YKSA 4N01A 4J0EA 4D9MA 3D8UA 3H3FA 1C1XA 3ST7A 5CBPA 1HNZB 3LHFA 1NVTA 2CHQA 2Q2QA 3LLUA 3R9KA 3WYGA 1VDZA 3BMNA 4KWTA 5K9ZA 2PGAA 1CEYA 2FZEA 3FWYA 1XAHA 3RGWS 4F2HA 5AI0A 4BGUA 2R79A 1JI3A 4MLPA 1EA5A 1XJ5A 2PHZA 1LK7A 3B5EA 3JYOA 3TS1A 5FOQA 4HQFA 4KUEA 3CCCA 1KK2A 1GV0A 1WA5A 2FOLA 1NZJA 1Z7WA 3CC8A 4WLEA 2IEDA 4BFTA 5C18A 4DV4B 4TLCA 5K6RA 4KAAA 4MV7A 4WBNB 2P0AA 4P08A 3VGJA 1M7GA 2BI7A 3BWEA 2QM3A 4X1KA 2HGZA 5AKKA 1QIMA 3H1TA 1BU8A 1Z6PA 1A7KA 3AB7A 3QW4B 1IY0A 3RLFA 4Y6QA 1XZIA 3RREA 1H8HA 3DONA 2W6IA 3UEOA 1XMSA 4FS8A 2QRMA 4X61A 1PRYA 4WNAA 3IVAA 1E4YA 1GZ6A 1V0JA 1TYZA 2HNKA 2I3DA 2I2FA 4MI1A 1UPAA 4ER5A 3QPVA 1VPDA 1Y5LA 3C5HA 4IOLA 4DG9A 1RRCA 3E8MA 2IF0A 2B8EA 2C2BA 4NJMA 1DKUA 5AP9A 4B45A 5A2QA 5IVPA 3V00A 4C0HA 3E3MA 4OYYA 3TE6A 3ZWNA 2IHBA 4DWJA 1YZQA 1A8IA 2CBXA 3MWDA 3OWXA 5JADA 3GJZA 2Y27A 4ZYYA 4FFMA 4K05A 1R8YA 3GXBA 3L5OA 2H92A 2PUWA 2QD5A 4H7EA 4PQRA 1U2TA 5JARA 4IH1A 1OFTA 1PFYA 1L1RA 2Y1XA 3VGPA 1O95D 2P0EA 4NY1A 4TLBA 3F6RA 3TQTA 3BRQA 2YIJA 4R0NA 5T4BA 4BVJA 5BPHA 3CLTC 4B85A 5KMGA 2FG5A 1IBKB 4S04A 4DNOA 4E5DA 1VA5A 4B76A 1Q0UA 4IWXA 1MA0A 5EMNA 2WUVA 4ZQEA 3BMOA 4ILEA 4XVRA 4IDAA 5I7UA 5AK4A 1N4DA 1W0KD 5EUCA 2HPZA 3P97A 1U8AA 4REQA 4QDTA 5BR7A 3CF4A 1N0IA 3WWDA 3AKYA 1DKOA 4YAUA 2QUAA 3N5CA 3AEQB 4E51A 1IN4A 4MGIR 3SNHA 4YR9A 4FFSA 5FNZA 5BVGB 4W7IA 1G21E 5ITVA 3U7EB 1Z4PX 2XD9A 3O8LA 5ITZB 3H0CA 2O8BB 2O0HA 3G2LA 4EJFA 2RGAA 5KX5A 4P7JA 4DRZA 4W5OA 2V45A 1Z0KA 3BQNB 2W2OA 3QLVA 4XWOA 5CXQA 3A4LA 4CW7A 1IWPB 2JEYA 4AMZA 3HR8A 4HSEA 3PP8A 1R3DA 4MITA 2VBGA 5IKMA 3CF0A 2PEZA 1OZGA 3DBHB 3KJQA 3UFBA 3G3EA 1TT5A 1XA4A 1DO2A 1BA3A 3PNPA 4GHWA 2AXNA 2VTBA 4DMGA 4YRAA 2ZAMA 4C20A 1UBUS 3FPLA 2R6DA 4HS9A 3SX4A 2HLNA 3W90A 3T7DA 2VYQA 2B2NA 3MS7A 4PRKA 1NN0A 3EIXA 4MQEB 4TV9B 5FD8A 4RTJA 1GUYA 1Y9AA 4RK1A 5IKEA 2QQEA 3ESZA 4E0BA 5E1DA 2AR0A 1UDXA 2ZI9A 3Q3IA 4YH1A 3BD8A 3W1EA 3ZZNA 3O3OB 3VKVA 2O4CA 5HFNA 3KJXA 4O4LF 3NAMA 2BBWA 1AKMA 1KJIA 2V6JA 1T5IA 4RIIA 5AW2A 4GDFA 2Y1OA 3D6FA 1YIDA 1FYVA 1MHPA 1N2JA 4HUJA 5EAIA 1YS7A 4O08A 3PHJA 5CYFA 1BW9B 1J1ZA 2QGNA 2VLBA 3LL7A 3H7AA 1TLLA 2XNDA 5EQDA 1KAEA 1B2LA 2BKXA 3E35A 4PAWA 4PO1A 1JLLA 2EG5A 1X1SA 3P26A 1N25A 1WCIA 2GEBA 5GJCA 3SJAA 1HLPA 1NNUA 1WP4A 4CIYA 4AF7A 1VL8A 2PLFA 3CPEA 3DC7A 3IT0A 2GUGA 2P67A 1KQOA 3QVSA 4QGFA 3DMRA 3ZY5A 4XD2A 4R71A 5BMVA 2RHHA 3SSNA 4QM7A 1A04A 3LQYA 1G8MA 2Y1WA 3VDNB 5ALDA 1CUYA 3SVTA 3NUGA 3MYYA 4I08A 1P1JA 2XZTA 4HTAA 1H0KA 5IZCA 2RHWA 1TKBA 1O5IA 3PC6A 3G02A 4CRWB 5JD4A 1B76A 2YHUA 3HVUA 5LQDA 4U2DA 4MP3A 2AN1A 3AOGA 1ZUNA 3F67A 3LCCA 1R66A 2XQIA 4PYLA 1DELA 4WZZA 3VR6A 1Z8HA 3TAXA 1H1TA 2R62A 4Y1RB 4KI7A 3LT2A 4WH0A 4AP6A 4IQFA 1BA2A 2E1PA 3SOPA 1SUBA 1IZ8A 2GGSA 2JAPA 3GQBA 4I9GA 3A31A 1XVVA 3KR9A 2ZIEA 2IYVA 4RH3A 1Z4KA 4MS1A 1KK3A 4PINA 4QVIA 4JLOA 4KQ9A 1JEQB 2YYZA 2WTNA 3EPPA 3Q88A 2IZ0A 2JH8A 3CO0S 4TM8A 2M6LA 3W2EA 1X8XA 5HGXA 5HZMA 2B61A 3EVCA 3ZV7A 1ZW6A 1NJ6A 3CLRC 3I8SA 4MCIA 1TXGA 2ZIUB 3STTA 1JDZA 2HPVA 5JOQA 3QOXA 5BN3A 3GVPA 4QGSA 5JAPA 4DKJA 3PG5A 2J9RA 2ZYIA 5MGNA 2BH2A 4IO0A 2OFPA 1Y80A 5ADUS 1NF2A 2WAAA 2JIPA 2RDMA 3EWAA 3M8KA 4PYRA 5CB4F 1WLSA 1F8YA 2FGJA 4B75A 4CCYB 3LBYA 1XXHB 4X97A 1MIHA 2PV7A 2VYND 3KD2A 4F56A 3KKOA 1YV9A 4M60A 3A3PA 1L4LA 4JMPA 5JAMA 3AKZA 3NUZA 3ZZMA 1RRVA 4IBOA 1SRRA 4Q6WA 3WRXC 3E1SA 4BNJA 2O8FB 1REQA 5IUKC 3M7IA 3TZCA 4XYMA 3W05A 1D5CA 1NLMA 1X1AA 2VXBA 3X2EA 1Z0SA 1OGYA 3CGGA 2LD4A 2ZYRA 3L4BC 3K20A 1PDVA 3K6RA 1RPZA 5K3CA 1UKCA 3GYGA 3FLMA 4HJXA 2BBSA 1WXDA 1U7DA 2FXIA 2VN8A 3NBMA 3UC9A 4MUKA 2IP4A 1LQTA 4J1SA 1NQOA 5AVXA 1ZM9A 3RS5A 1TMYA 4Z4QA 2ZT6A 5JV5A 3FPGA 4DPLA 1YJQA 3JVDA 3NJRA 3AUKA 3RIXA 4EUNA 3UMJA 2BGMA 4KMSA 1G66A 1R0RE 5ALPA 4JJ7A 2JBAA 1Z2OX 3F9IA 1VJGA 3RG8A 2ZU6A 3K1JA 1U63A 3GBPA 4YACA 3F7NA 1XKLA 2YDYA 1N0VC 1JLRA 1SBNE 1UK9A 2YJ5A 3BXOA 4Y2QA 3VKHA 4B6PA 2Q6IA 4Q4CA 1NQVA 1YO6A 2C99A 1L7RA 3H9GA 3BSSA 4Q4LA 3I12A 5EKSA 5EJEA 2F8TA 1W2HA 2CXXA 1Y5RA 1W93A 3DYBA 5CVVA 5LUBA 3W8DA 4LECA 3B13B 3QF7A 4YBRA 3IL2A 1II8B 1JDNA 4JVNA 1G20A 1FLDA 3PFFA 4Y2VA 1X1CA 4MS3B 1O6ZA 4HXYA 2XQFA 3RIYA 3A6ZA 3LUAA 2PYIA 2P9BA 3HBJA 2UZ3A 4MB2A 4QKQA 5JH7F 3CRNA 3T3MB 1KVUA 3EFEA 5HZHA 3GLHA 3OLWA 1RC0A 4NFHA 3LDGA 2WZQA 3ONWA 3P2KA 1QRRA 2CUTA 4NU8X 1DDGA 2W4QA 2DECA 4OOFA 3EQ8A 3SX0A 4RFSA 2OFOA 1I7LA 5B3LA 5A3VA 4RD6A 2H0AA 1KY2A 3B6MA 5LBIA 4OLBA 3EIFA 4ZXFA 3GR6A 1E7WA 2VOEA 4KIGA 5JQGB 2HJGA 1B8NA 3NTLA 2MSEB 1HA3A 3KZXA 3B78A 1P7ZA 3OO0A 3ZHQA 5TMPA 1ID8A 4YC7A 4B7XA 3PV0A 1E8DA 3A9CA 5F76A 1WSAA 4EVQA 3ZXUB 1GTL1 1FMLA 2PA3A 1GHTA 2WHPB 2Y6UA 3K4QA 1TJYA 3CLUC 3OQPA 3PXUA 1R5BA 4FLEA 4N0EA 4RHUA 2V3VA 3OKAA 1NY6A 1IE3A 1SQ6A 5FP0A 4A1OA 3NHPA 4QYXA 4F84A 3GVCA 3RK1A 4EDFA 5JUWA 3MUOA 1O6BA 3EGVA 1XJ0A 2H1FA 4DBLE 1JA9A 2PMCA 2AFHE 2NX2A 4YIKA 5BNWA 5EQFA 3MGAA 4OU5A 2R96A 2ZSKA 5GQSA 2Q3BA 4D8XA 4FB5A 4S24A 4EA8A 1XCLA 2CJWA 2GHRA 3VR6H 1UBHS 1L8LA 2ZSDA 4FFBB 4HWRA 1CDOA 1E3WB 4UNQA 1SFRA 1NHWA 2AQKA 2E7ZA 3VYSB 4QZVA 1QQ6A 5KI6A 1FQWA 2FPMA 2IPMA 2G6TA 3DW3X 3BE8A 5HCNA 3TQOA 1VXRA 5FBZA 5BQXA 1TK9A 3DWIA 3RSHA 1E5XA 2FPOA 2JGRA 4EKIA 1QF7A 3WJAA 1ZSNA 4WUVA 5DCUA 2QUZA 2P1RA 1R9MA 2MCFA 2A4MA 4DTCA 1NN3A 4A9AA 2MOKA 5A3QA 3FM9A 4OPMA 4AX4A 4EB6B 1SB8A 4QUBA 1W5EA 2AHRA 2QV7A 3DVQX 4M83A 5K01A 2Z30A 5EINA 1GY8A 4G5YA 4R40A 2XYQA 2I2CA 4H17A 3U4GA 2Q2NA 4URWR 3RRMA 2V9PA 3HCAA 4HYTA 5DMHA 1NXVA 4PG7A 3GA0A 5J4LA 2CD9A 1VSBA 5H68A 1SXJE 5FTMA 2QN3A 1V7CA 3LBHA 5CAEB 1ZOIA 3HQ4O 2PS1A 2JLQA 5IAOA 4FQ8A 3VDXA 1GQSA 3K0SA 5E4FA 5TSDA 5DHRA 1K8QA 4MUBA 1E1QD 1KY3A 1E62A 1XEFA 1KZYC 1PD0A 1UP6A 2P9TA 3FTQA 3I4FA 3M3PA 4BQSA 4WN9B 1QP0A 2D6FA 1YRLA 5AT1A 3M4XA 1YRQA 1N5OX 3FYSA 1I7SB 2NT4A 4KK3A 4WJKB 4X1KB 5ELLA 4HZUB 4C43A 3OQVA 5TQ0A 3GXOA 5TF4A 5HQ3A 2VQFB 4Q34A 2QTWB 4RS4A 4XJXA 1NDHA 4TQGA 3TLGA 1C8BA 2JLAA 2ZJ2A 4KOAA 1RZ3A 2JJ2A 2NACA 2YMLA 1I1QB 3Q1LA 4FXPA 4WFKA 2O2XA 4H6XA 4D0NA 4UM9D 4L02A 1XTPA 4FEGA 4K46A 5CNMA 3H5IA 3T3NA 1RJDA 1IY8A 3BKXA 3W7BA 1U9JA 3AFOA 4NJMB 4WI1A 1K6XA 4QBKA 4RVSA 1W73A 1A4XA 3EDOA 1A9ZA 5E1MA 4GOXA 3E8SA 3WDLA 5LSAA 4RTKA 2BTEA 4Z7OB 3U7RA 2GNPA 1E1CA 1GZSA 2ZUFA 1KMQA 2AFIB 3C0KA 1G8SA 3LRTA 2F3RA 3ZJ5A 4IUDS 4C7VA 2V0NA 1DAPA 4ANFA 1TVMA 4UQPA 2X77A 4NXNB 2MYUA 4ENSA 3AF1A 4OSPA 3PNQA 2GRAA 3MW8A 1A5TA 3E7DA 1F2VA 4LNUB 5G0WA 4D5EA 5HKKA 3ZPXA 2PH7A 1SQGA 2P6MA 2ZIAA 3AFMA 3DFFA 4DW8A 5AVVA 4NJEA 3CNOA 2QLJA 5BSEA 4C7JA 1WUTA 1EXWA 2WIFA 1YNOA 1QMPA 1QQTA 5ALEA 3BCRA 1EFVB 4WVLA 2EW8A 3AIKA 4WZ6A 1XTRA 2PRKA 2OD9A 3AUFA 1JG7A 4KR7A 3DBHA 5ESDA 1K98A 2WYHA 1K86A 4IW3B 4R1MA 4WOPA 4OX9B 3M6UA 2PO7A 1HMYA 4OGGA 5AUQA 3T9EA 1T0BA 1CC1S 5HMLA 2QM7A 3QU5A 3RK0A 4TS9A 2XTMA 4ZEWA 4K9DA 4EATA 1H3FA 1RXUA 2PFKA 3HSYA 5KYUB 2PSHA 2ZBVA 4URFA 1PCXA 4EMSA 3WMEA 1KGSA 5C7YA 3P94A 5KX5B 2VHVA 1PJRA 2PLWA 1A8HA 2NG1A 3V97A 5EXPA 3UG7A 3FMPB 1UPUA 3OMWA 5D3ZA 2ODPA 3HBLA 4RGVA 3E3OA 3N58A 1GFWA 3F1LA 4K9QA 5D1NA 3CVVA 3HB9A 1YQQA 5ER9A 1VIYA 2LNDA 1I1NA 1W48A 5HRCA 1DADA 4W5TA 2BJVA 4HLUC 2WG0A 1XO1A 1WZUA 1P4SA 4XFKA 5B30A 3T5MA 1X39A 2B5WA 1UK7A 1JBKA 4H7KA 5IMBA 3ZX5A 1ODLA 4S3MA 3OC0A 3QY9A 1LBTA 2VDWA 1JDSA 3RIEA 4DLXA 4EHNA 4JI6B 1JEYB 3GRFA 4ZO7A 1I2MA 1NFRA 1TJNA 1ZH6A 3E7WA 3EY9A 3U7QB 4ZKEA 3WQRA 1UFOA 2CBGA 4AROA 1EDZA 5KNBD 1O3YA 4LJ5A 4BNZA 1E3WA 1I8TA 1R8XA 3KTAB 3NKLA 4RGYA 1RCUA 5FUXA 3S28A 3VSEA 1FFDA 4DREA 2W6CX 4XR9A 3BE5A 4ZXPA 6GPBA 2OZPA 2Q4RA 4UTXA 3ILSA 2DKNA 1PV2A 4XWTA 4L5IA 4MA0A 2DY1A 1ZMXA 2AC2A 1RLIA 3FPBA 4YP0A 5DK6A 2W2MA 4QREA 4C0BA 1XOIA 2X8WA 3P9XA 2BEJA 2ZWPA 1HM5A 2H3EA 1P2SA 2MMGA 3NVAA 1CRQA 1YZFA 4JFAA 2OYRA 3WB2A 4CXMA 1Y1PA 3DMTA 3L7JA 3N86A 4KO4S 3NR2A 3Q0EA 5LQSA 4AG3A 4L5BA 4ZT7A 1D6NA 1DEAA 2Z9CA 1N6OA 4GBED 3TFQA 1UCFA 4AWXA 4DG5A 1L7OA 1XZKA 4LGCA 4X94A 1ZD1A 3T7CA 1PK9A 4CT4B 3GT7A 5FUQA 3F90A 2CVZA 3G13A 3VSBA 5HR5A 3U4DA 3RV4A 1FXWF 1V7QA 3EHDA 1E0JA 2WC1A 4IILA 4L3WA 1XMXA 1KC1A 1Y7PA 2IQ5A 3O3NB 2IFTA 2WWIA 3QG5A 1KBZA 1HE2A 2RARA 4JUDX 2JFGA 2FSFA 5CUQA 4CE6A 4EJSC 1JKXA 1W6UA 2B7BA 3LLVA 4RE5A 4OB7A 5ECWA 1VG8A 4JP3A 2DFPA 3KTFA 4PGFA 3SQLA 3PJEA 4F8EA 2UYCA 1WRBA 2BGJA 2RJNA 3GN1A 1Z0UA 4HGQA 4J3JA 4QRDA 2GETA 3EIWA 4I2NA 5HA5A 2I2WA 2P7HA 4OUDB 2C4VA 5CA1F 3SE7A 2ZIVB 1EJ0A 3L93A 4M0FA 3SMVA 4ZOCA 3DOUA 5AUOB 2MDTA 1M2VA 3K0CC 3ZCXA 5K45A 3WBFA 1U4NA 3HP7A 4NG4A 2REXB 2WWWA 1XHFA 2GD1O 4NWIA 4OBWA 4HB0A 3ZLBA 1UKBA 4D0SA 3TUJC 4Z1MD 1E6KA 2J3MA 2X9GA 2Z2KA 3MAGA 5FPTA 1T6BY 4OJKA 3IEPA 4RIHA 3KTOA 3GFGA 5D00A 5E3IA 5EKUA 5B1SA 5I7HA 4PTYA 4DCSA 4K88A 3U3XA 2XKJE 4R1TA 2NUAB 2HNBA 3DPIA 1XTZA 2QI9F 3EZNA 4AUEA 1J06A 2HDOA 4R83A 3TLCA 4A6PA 3L0IB 1AOXA 5CLIA 1Z2NX 2HJVA 1JILA 1Z9BA 3KV3O 3CN7A 3I4CA 4PAMA 1GTZA 2D59A 3A37A 4MUXA 1ZIXA 1NYLA 1L1FA 3B9BA 4L1KA 1GSOA 4L8YA 4V0LA 2BF7A 3VO1A 2CNOA 4DOMA 4FYIA 4RFLA 1NJ1A 2GILA 5ARCA 3WA6A 3EG5A 2J7PD 2EKDA 5ILGA 4IDCA 1QMGA 3DFMA 1APBA 3OHPA 1OLOA 3FJYA 2DUUA 4PO8A 2FKAA 4J6FA 1UMBB 3NZEA 5CDFA 3GGSA 3LX5A 3RVQA 3WNZA 4LRSB 5KVVA 2NPFA 1KORA 4LPSA 4GQIA 3G9XA 5JZ9A 2QTCA 2VNIA 1T4CB 1BRTA 4QFMA 4KNWA 2YQZA 2YOHA 4PYKA 4C08A 4G89A 4KLZA 4D9GA 2AX4A 2XH8A 4JN6B 3ODGA 4Q9LA 4KMRA 2C8LA 4N3GA 5H5JA 1OH8A 1Q95A 2H9YA 3H2JA 1WQ1R 4RBNA 1S3FA 4IKPA 3L0YA 2ICAA 2V7PA 5ERXA 4ND4A 5KPDA 1CZUA 4DXDA 1ZICA 2ZI4A 4LZAA 1C4KA 4UVGA 1XLWA 3A1DA 1LI4A 1RSZA 3ZWAA 2Z9BA 3Q2KA 2IE8A 1XWWA 4R8KA 5AJTA 3R7DA 1FLNA 3AJ9A 3C87A 4LCEA 1AQ6A 2VP5A 3VNRA 4HVTA 4KR2A 1WZCA 5UKDA 2PJDA 1YQEA 5FUWA 5A0VA 5L51A 2QZ4A 2NNLD 4IH9A 5DHQA 5BWNA 1GCGA 4DDHA 2FX5A 2HV8A 3Q3EA 1EE1A 9LDTA 4WGFA 3HDQA 4LJ7A 3OOJA 4FDAA 3RU7A 3A32A 1G1MA 4GW3A 1NJ5A 3ITNA 2F1HA 2O8CB 3O03A 2Q49A 3RAFC 2F90A 3U61B 3E22A 4LRXA 2OBYA 2CXOA 1GYRA 3F7MA 3OHMA 4II2A 1NONA 1EJBA 2NIPA 3C6QA 4IJ5A 5FB3A 4ZVPA 3W5HA 3WLOA 1YF3A 1LDNA 1JB9A 3HR4A 3UXMA 4QUIA 3DL4A 2V7VA 1A8PA 1BJTA 2ATVA 2Q5OA 4EG6A 4ESHA 5AHWA 4ERNA 4BMNA 2RE8A 3OP4A 2N46A 5AHOA 4Y6RA 1V3QE 3GA5A 3WLQA 2DUMA 1IC6A 4AZSA 4TQUS 2M9MA 3OEEA 4PANA 1RXVA 3MJRA 3RIMA 4DA6A 3R0JA 2ANBA 2OFWA 3VYUB 1TYCA 2E6KA 2XMBA 4GZ6A 2NUTA 3V3TA 5TPWA 1CUFA 1DBIA 4S05A 3VPSA 4FVTA 4R69A 2ZIXA 5IAJA 4LYYA 1N2CE 3SZRA 3UV3A 4DSNA 1G64A 4G0XA 4XLLA 3R7AA 4CM9D 4S1NA 4ALNA 2O23A 5TJHA 1KDZA 4A8HA 3NWJA 2FMKA 4IZIA 1M34B 5KCMA 1QPZA 2GO7A 2Q5FA 4B46A 3OZDA 4PQYA 4Z9FA 3LHSA 1FDRA 2WF5A 3QNMA 3A4MA 1XNHA 3I9V6 5K0NA 3SHOA 4YMUA 4Q21A 1I3OA 4G1MB 4FBLA 4PZLA 1KDOA 1T9GS 3GDHA 4FHDA 3HCFA 1LSUA 3OZVA 1CS4C 2A9JA 4JAVC 4P36A 4PQGA 3W5VA 8LDHA 3IBYA 1XALA 1GAQA 4X93A 4OL0A 1QTQA 1I13A 2JHCA 2WLTA 4UHFA 1ZKDA 1WVGA 3T1NA 4W8OA 3RGGA 2KW5A 4E6PA 4UMEA 4J0KA 1E4VA 2JVJA 3I30X 3L77A 3R3WA 4ZYUA 1NN1A 4IQ4A 4MWSA 2GYUA 4NNOA 4AK9A 1TZBA 1U9ZA 2BMVA 3M6MD 1YU6A 1WBBA 4X8HA 3HSKA 3OFSA 4J0CA 4II3A 4RZSA 3DKKA 2ZB8A 3L92A 1I10A 1UXHA 3N6VA 5LQRA 3CVXA 5LDGA 5CB8A 2IZ7A 2VSQA 2PKYX 1LK5A 3DS8A 4RJKA 1N7JA 1BROA 1OVGA 5E4JA 4CG2A 4V1CB 5FQOA 1E9BA 3AV0B 3HR7A 3RSOA 5F5LA 2FN8A 1QIGA 4KQ1A 4AD8A 4PYNA 1A9PA 3IP8A 8ABPA 2HCTA 2I3AA 3E84A 4FCWA 1Z6TA 1C4WA 3DCNA 4IWNA 4Q7EA 4OBEA 1NP6A 2WU1A 1A82A 3TVDA 1RBQA 2Q9BA 2DUNA 2W70A 3EA0A 4WK6A 3HXOA 1J20A 1HLFA 3NTRA 1JEEA 2DFDA 4ZYTA 1YTLA 3F9CA 3ROFA 3FNGA 3OQOA 1FLAA 1JW9B 2CMDA 2CNWA 1Z4MA 1RBYA 3C85A 3M9LA 2YNMC 5JSZA 4PR3A 1PNRA 4BUCA 3KOOA 1UPBA 1OE0A 4DNFA 4NCBA 1ZBQA 4EA7A 3O8CA 4MLCA 2RJ3A 2GRJA 4U8GA 2IWHA 2XV1A 4WLOA 3QOWA 1DAFA 2XCUA 4I19A 3ANTA 2AQ8A 1PG0A 4D79A 1ZCAA 2QW1A 3SKXA 4EL0A 3A9UA 4CT0A 1A2QA 4XTRA 3DE2X 1AQUA 1YRHA 3WLJA 3ICCA 2FPWA 7AT1A 4UBLA 1M1UA 2PO5A 1U1EA 4LE0A 2D5AA 2H65A 2FN3A 2WF7A 2W0MA 4FOSA 2CUKA 4N18A 4QYIB 3TVYA 4A2WA 2XDAA 3DXFA 3FH0A 3GRRA 3QOYA 1WQ4A 3KVNA 1FQOA 3MXTA 4HDSB 3TMAA 3TRKA 3UK0A 3TSYA 2ZQYA 1GU1A 4DY4A 3UAWA 5IBRA 3SF0A 1GVNB 2VCHA 5ARDA 2KSQA 3R0ZA 4CFZA 2R7LA 4YGYA 3SEFA 5HYVA 1U0EA 2RH5A 1JQDA 1KC3A 2V8OA 3CF2A 2YWFA 3NQ41 4CKZA 3TLZA 2N3ZA 4QGGA 2WWVD 3G1UA 5FOUA 3ZWPA 1XZEA 4RNDB 1EVZA 4KIUA 3ID6C 2F1RA 3SZGA 1NRWA 3GFOA 3HJTA 1NMQA 1QG2A 3N2IA 2HF9A 4KQEA 4EJ6A 2GH1A 1MQAA 1WXWA 4IJWA 4ND6A 1CE8B 4QU8A 1YBFA 1GTSA 3R0XA 4NCKA 1FRNA 5LBTA 1ODTC 3HJHA 5D1HA 3WLNA 2CCJA 3IP7A 2YHIB 4D6XA 4K7JA 4EB6A 4IDOA 3GRZA 4ZAWA 5KU1A 2QL6A 3DB1A 5C8ZA 1D7AA 1EUYA 1VE9A 5I7AA 2W42A 1WMDA 3EODA 3LY8A 4KQKA 1V3UA 4H15A 1YDHA 1W5BA 3NV9A 3D0QA 4MXDA 5KOJB 1MGOA 1X14A 2CNBA 2Q4DA 4G4SO 4J7AA 4MR9A 1HDOA 1KF0A 5DTMA 1PIWA 3CXUA 3CT6A 1SKMA 2HXYA 3HGTA 4AZVA 1XNQB 2RGXA 2WVJA 4TKVB 3V7NA 4BO3A 3FWKA 2PX2A 5SZJA 1K08A 1S8NA 2CD7A 1WW2A 2CLEB 5D3MA 4ASUD 5ALRA 1PJSA 3C8DA 1QHFA 3NS7A 4JLNA 1JWBB 3CFYA 3DD5A 4BN4A 2H5LA 4D98A 2SNIE 1GPNA 4FGUA 2I78A 3R3YA 4FXOA 3AB8A 3RYCA 3KLNA 4U7WA 1U6JA 4ITUA 1Z4OA 2I4LA 4KAJA 1GR1A 1WNTA 2AV6A 1KRWA 2O2DA 4OQXA 4Z99A 4LZPA 3O95A 2GZ1A 4O2AF 1EIZA 2ZOSA 1SG6A 4JQSA 4K87A 4LXXA 5A71A 1PJQA 2VDJA 4EJSA 4N65A 1GQQA 3BK2A 2VHXA 1BCSB 4KR6A 2Q45A 3DZKA 1M5UA 2PL5A 4R2KA 3VOTA 4YCNA 3NU1A 2BWJA 3RU3A 2BBTA 5FI1B 4XQ0A 3IUEA 1J8YF 1NOJA 1PZGA 3FTCA 4OQQA 3GN2A 5L6MB 4P7GA 4C0JA 4C07A 1H2WA 4OQZA 2B4KA 3EC1A 3ZQ4A 3JQAD 1LPNA 4JI5B 4B6RA 5H3CA 1DLIA 2PZFA 1E3MA 2HQ1A 4G5XA 4F71A 2BCJQ 3ZDRA 3ILYA 1HE1C 1P0IA 2H1IA 3FA2A 5DLPA 4N3CA 1TYAE 4KYTA 2WSBA 5BYJA 3RVLA 5DI3A 5F2KA 5BY2A 5G3YA 1Q0RA 3ZWMA 4UHHA 3EXHA 1IDOA 1U94A 4OUDA 2Z3VA 3VC2A 3VO2A 1G20B 2DWCA 3TQSA 4C0KA 4WINA 4F5EA 1IN7A 4HDOB 3ZGYA 4DRXB 1RZUA 1LQ2A 4TLLB 1YR8A 4JI1B 2DWQA 2WJGA 2B6HA 4XGKA 2AMJA 3T7EA 1U5BA 4XUDA 3TI9A 1E3SA 2E37A 2FPKA 3TBFA 3IP5A 4WASA 1U65A 3A58B 5DTQA 3R5TA 3GDWA 2GCIA 4GOJA 3A6EA 1P3Y1 2EJTA 3RHZA 821PA 4RELA 3OIFA 3UKOA 1X92A 2BW0A 4RVGA 3DQPA 1Z2CA 5A03A 4B8WA 4RADA 4DSUA 1C7QA 2EQAA 4H3HB 1QFYA 1T9GR 1VSQA 2PT7A 3A6DA 3M1YA 2Z83A 5BSGA 1XRLA 3SU8A 1XAJA 4QXMA 3QK7A 3MXOA 1EEXB 4CQNA 4LJRA 2VQDA 3P2MA 5KS2A 1E2NA 4IXTA 1YQUA 3GJ6A 4XQ9A 1Y33E 4OB6A 4G8JA 3U4HA 2A94A 2DZDA 4GXRA 2GSWA 3L0DA 1PJBA 4G2TA 4AYXA 1II8A 3O26A 3PC3A 4K9NA 1ESDA 5K4HA 5CCEA 5FADA 1WY7A 2D0IA 2XYHA 4XB2A 3QGMA 2YWEA 5ALFA 1K06A 1JU3A 3JQAA 5K3OA 5A62A 1QS0A 5FA8A 4QODA 2VDWB 4C6RA 3GHHA 1QDEA 3CRVA 4QBIA 5JZOA 1C41A 5AVQA 1D09A 3FFXA 1B42A 1Z5ZA 4EHIA 2J5KA 2YZNA 3DOCA 4MAMA 3TI7A 1P61B 2R00C 3GZJA 2V5UA 5IDQA 1GAEO 4AYTA 2XUDA 5C1OA 1W8DA 2YRXA 3STUA 1HORA 4EG1A 5ALWA 5KTSA 4WRRA 3X3HA 1B26A 3DSRA 1DOHA 1O9GA 1UJNA 1L5OA 3FSJX 3JD2A 2FE1A 3RS9A 1J21A 1F2UB 3B1XA 3TSWA 3UZUA 4CT5A 1FYWA 3H5WA 5HPYB 1CE8A 3N8GA 4TXMA 4NZZA 1WF3A 1ZCFA 1SUWA 1RYBA 3GJ7A 4EPTA 3DM5A 5CA0B 1QKIA 1RU3A 2NZYA 4H7HA 3R9WA 2PQ6A 5D6OA 3Q7IA 1AMOA 5DRYA 2O9JA 3DEKA 4H0CA 4JWTA 3OG9A 4NI5A 3BH6A 4LA4A 3AC0A 1GGMA 4E3WA 16PKA 2IUTA 4JX8A 3OQJA 5TQJA 3W78A 3L4KA 1M5TA 3PX7A 3UJBA 3HDGA 2CCKA 4J75A 1NRXA 2XJ9A 3HCBA 3NBFA 3BD7A 4L75A 5E3JA 4B44A 4CQMA 2H1OA 3FKSA 2XCIA 2O1WA 2Q9CA 4YBZA 1DJOA 2GEJA 2QRHA 1VG1A 1SIUA 2Y68A 1DJLA 1HTBA 3P9YA 4FK8A 4RPKA 1NBAA 4M6WB 4TKUA 1BCRA 3S2GA 4W63A 4JYPA 4B6GA 4DFDA 2FF5A 4QXRA 2JFXA 2AI1A 1N2SA 2BI4A 4TLMB 1X7XB 3U48A 4GEGA 1TM3E 2JRCA 4IYJA 4MQ4A 1V6SA 1VHJA 4ZYWA 1THTA 5AW3A 2E18A 1S5PA 5EP1A 4EYSA 3AERA 2X0KA 1C4XA 4KODA 2PSDA 3R5HA 4HLNA 4ZO9A 5AKZA 3USES 3L06A 4Q9DA 1K8ZB 3VUEA 4YJHB 4LHEA 1RKVA 1UP7A 4DLVA 3WYAA 4ZANA 3W3AD 5ETJA 1EVYA 2EF0A 5CG1A 2OO7A 2P2GA 1E9RA 3WAJA 2BN4A 1ZJZA 1MENA 1OV6A 1TQDA 2G70A 2J3JA 4N1AA 2CXUA 4QELA 4ETNA 1NM5C 1X7YB 4LXHA 5K0JA 4URXR 4QUDA 4DLAA 5ITZA 3K0FA 3AF3A 4X1IA 3WSVA 2O2YA 2HYIC 4K26A 1G6KA 5L8VA 3U3ZA 3NAQA 3GJ0A 4H31A 3U19A 3M4JA 1KDTA 4UU0A 4EW6A 2PD4A 4P98A 5HIKA 1JV2B 2XIQA 3Q85A 1CUIA 2B92A 2HHAA 3JQRA 4Q03A 1YE5A 2WJ4A 3NXKA 1LF5A 3ZV4A 1SU8A 1WZEA 4B3TB 3G89A 3S2UA 3R76A 1ZM2A 2JAOA 4OK5A 1LBEA 3UT5B 3TMYA 1B3RA 1ATZA 3K0KA 4LHYA 1PBNA 1FP1D 5MN4A 1AGXA 3ITDA 5JE8A 3JAKA 2W6PA 4DNQA 2QMYA 3FUWA 3IT1A 3QWFA 1FNBA 4ZYXA 3EQ2A 4GT1A 3LI2A 3R8CA 1ST2A 5JXJA 1MF7A 1MJFA 4EMUA 4AM8A 4ZALA 4LYFA 3IDOA 4GLJA 3U7GA 1F6WA 2O0LA 3TNJA 3U7FB 1R1DA 3IQIX 2CB0A 4TZTA 3FETA 3E9CA 4E7PA 2CXHA 3QKWA 4N5MA 4QDXA 1CUVA 3EEOA 3PYMA 3COWA 3HB0A 3GUHA 4GL4A 2RIPA 4MIEA 2AVNA 2WB4A 4AY2A 4YJ3F 5AI9A 3N0VA 3AQ4A 4YWJA 3SQNA 4G85A 1WTAA 1G5HA 1U99A 4M37A 3BILA 4M53A 4RZXA 4OKNA 3A1TA 3M5CA 4HO1X 4EO9A 1TL7C 2VTDA 1ZQ1A 3LYUA 2KI5A 4HNSA 1K9VF 2JLZA 5CT6A 1Z73A 4PHHA 2Q5IA 2QIOA 3I0NA 4QTZA 4OREX 1BEUB 1X2BA 4C05A 2XMGA 3KVRA 4UHDA 5J47A 4MVXA 1RBZA 3HEAA 2B8TA 1DFGA 1QP7A 2I7TA 2B5OA 5ADHA 3HU1A 3WMWA 4FOTA 5BSWA 1Q44A 2A9PA 1AD2A 3WGIA 3QVOA 3NHWA 2C5EA 1VMAA 1XEWY 4X00A 2DQYA 1JQLB 1AF7A 5E7JA 5K1ZA 1X42A 1X74A 3G85A 4QVKA 3KL2A 5EJ7A 2ECQA 3E4DA 4FD2A 3F3KA 1KKMA 5BP7A 4OLJA 3HNRA 2WM2A 4FW9A 3ZHXA 1J56A 1ZGHA 2QPTA 3L8YA 1ZCJA 2C84A 5FH9A 2C92A 2NYAA 4TQ9A 1BDJA 1CKEA 1MLDA 4MRVA 1CUEA 5LLDA 2CZQA 4MRRA 3VNVA 1B16A 9MHTA 1LK0A 4FOOA 3NRCA 1T4GA 1XE3A 1SVNA 2G0AA 4I50B 3C2QA 2HLPA 4JB3A 3WSWA 3QY0A 2GYVA 3AVUA 5IDWA 2C3OA 4Z6KA 3SYRA 3LX6A 4JKYA 2ADFA 4P1ZA 2G88A 4B4VA 2DPLA 4TRRA 2HYDA 4XVHA 2H7XA 5EI5A 4YMLA 1JBQA 1M1YE 3EEFA 1M2OA 2ZSUA 4HAXA 3LC0A 1N8TA 4BVAA 4QYTA 3DBLB 1JI0A 1FW8A 5C8XA 4HNGA 2I80A 1YDFA 1C1XB 1GZ4A 4BKQA 2BEWA 1FJXA 3FI0A 4JX9A 2JFBA 3QPUA 2IHZA 1HUQA 4ND3A 5SYAA 3M6LA 2OV6A 1I3KA 4NBRA 4WNAB 3T7KA 2OK8A 3LT1A 4EI7A 5FOWA 2YYAA 4WOBA 1QHXA 3DHVA 2JAWA 1KSFX 3DZCA 2VYFA 3L0BA 4MS4A 4D45A 2BKVA 2BTOA 2R5NA 1VGQA 3ADPA 3KB6A 4NV3A 4R9VA 4RACA 5DI9A 2B1IA 3WK4A 4YCLA 1ZGBA 4C4ZA 2FUEA 1Q1GA 4NE7A 4PX2A 4BEJA 4IG4A 2CWDA 2WFLB 3H11B 4M46A 3R75A 2IYPA 2R7MA 3WMXA 5IZ4A 1VSTA 4FYMA 4E2WA 5J2UA 2HBYA 3O4IA 1K7YA 4TXHA 2DYKA 3VR4H 5CBPB 1SY7A 3LFUA 2Z04A 2EOAA 4R6WA 3P9SA 3KYCB 5A3RA 3KRTA 3R5FA 2NQ2C 1MCZA 5ADVA 3T12A 1CR1A 1DG1G 1FDOA 3R0IA 5G4KB 1CHDA 1W29A 3F73A 3K1YA 3HYLA 4DCGA 3VA7A 3ZGNA 4RDCA 2X40A 2O8FA 4YDSA 5A3SA 1QIFA 3N07A 1NUTA 4UREA 1Z28A 5CXXA 2AJBA 1I51A 4NFLA 5HIJA 1CY4A 4PNEA 4FX2A 2XVXA 1KZ9A 1R12A 1P39A 2PGXA 5BN5B 1QO0D 4B81A 5BSHA 1U7OA 1DKLA 1ORRA 2PDAA 3T4UA 1NL3A 2TMDA 4KRXA 5JSHA 4N40A 1UOOA 1P2GA 3KOMA 3NUQA 1UC8A 1Y8QB 3GNQA 3OJWA 2QT9A 2R11A 3HJGA 4X84A 1N4AA 2FP4A 4B4KA 4KCGA 4I14A 3BDAA 5JHGB 2ZB3A 4WK4B 5KHOC 2B7LA 4HNQA 3VKUA 1LDYA 4QOGA 2XXAA 4CTNA 5BOSA 3I8OA 1L5RA 2WYOA 1P6QA 3GWGA 3M2TA 1FUEA 3IAM6 1X7GA 2PWBA 4LI0A 1Y6RA 5FOVA 4ENWA 4ZZIA 3NWPA 3IXQA 3O4JA 2NVWA 3ZDCA 3P2IA 4HWGA 4IJQA 3TTUA 1JR4A 5AWFC 1E9SA 4INAA 3IEXA 2I4IA 3SHFA 2FU5C 1M8FA 2BT4A 4I4LA 1GU7A 1Q22A 1VL6A 2JBHA 4M87A 3PC7A 3FPSA 1JTEA 2A5FA 2HRCA 3B60A 3BA1A 2QRPA 1HGXA 2DCUA 4EHFA 5ICFA 3QFRA 5EZQA 4JDUA 5IDVA 5LMUB 1T2CA 3T3EA 3SFZA 2H0QA 2YN0A 1YMQA 3L7KA 3OKCA 1CRLA 3CYFA 4ZHQB 4I9UA 1JIUA 1Y4UA 4AMUA 4CF6A 2R3SA 4QPJC 3CW9A 3WWYA 3I6MA 4TPKA 2AUTA 4MDEA 3T1YB 4BKUA 1UEIA 2Y3IA 2D13A 2ZPTX 1ZMBA 2WVAA 3QU7A 2FWAA 4LYAA 1MO6A 3IC5A 1G8YA 4JJFA 1RAAA 4EX6A 1TX4B 5L3RA 1FDWA 1XR3A 4F3TA 3IP1A 1CYDA 3E5MA 3HNPA 5GZ3A 2JIRA 1MVNA 1Z07A 3IMEA 4YQFA 1S1MA 1TU0A 3IFSA 5E6SB 1RLOA 3P5SA 3LRPA 4Z4GA 4S1WA 1U3UA 5EJAA 3R3SA 3W2TA 3MB8A 2I0FA 1F2UA 3C6ZA 4IDFA 4Q18A 4OLFA 3UGQA 1UBCA 2VO1A 2YXBA 2RB5A 4TTTS 3W4IA 5JNRA 2YV5A 1P9LA 4YRJA 3UGJA 3TMKA 4X7PA 4YVFA 4NCAA 4DTIA 2B2CA 3B53X 2JFFA 2PUCA 3VHLB 2CHFA 3DV0B 1TCUA 5L7WA 4UASA 1AHIA 2D4HA 5BYBA 1GTG1 1W1UA 1G8FA 2AHOA 4LXTA 5HVNA 4D44A 4EYKA 5ICCA 4TV8B 5C5EA 2WUFA 1N7GA 1T5SA 1CY7A 3E7FA 4HXGA 3SS9X 5C35A 4PO9A 4L28A 2OILA 1VSVA 4EHDA 4PGAA 4JT8A 2JGIA 1QVRA 4CTOA 2VQ3A 3INGA 4HAYA 1JP7A 1KDPA 5A0FA 3BXZA 2GYYA 1KQGA 4TRMA 1A96A 4DV0B 4LSWA 3EBLA 3FWNA 3QPCA 3ZHBA 1J2JA 3IBGA 3UJ7A 2R00A 1NX6A 2BFEB 1CU1A 3BHIA 3ZDQA 4BFZA 8ADHA 1AQJA 5CIQA 4B5KA 5BWBA 4ER6A 1SVIA 4HFRA 5BOSB 1RKQA 1H2BA 2ZWVA 2AN5A 4ZJZA 3LTEA 3AG6A 2OG1A 4E1AA 2Q1WA 1XL1A 2NU6A 3TLMA 3V7WA 2KQUA 4YJFA 5CT5A 4BVFA 2FW0A 4V0KA 5K3FB 4GPEA 2V6FA 4ZIRA 1JLMA 1NVGA 2KHZA 3IILA 3GLFB 5LBUA 2XGSA 2FSVA 1MEJA 3K0FB 2V74B 3KEMA 4X1IB 3VC1A 1EMDA 2WYUA 1EHCA 2WMDA 3HKCB 4GM1A 4YDHB 2H85A 2HJRA 1PK7A 2C4KA 2DHRA 3DZBA 4R2HA 1Z6ZA 4G0WA 3WJ7A 3R7LA 4RJJA 3K9WA 2JDID 4J0GA 4YMHA 1MQSA 4RHCA 2UUAB 5FKJA 4CGZA 1KJZA 1R16A 2YR0A 2QLFA 3E7XA 3H9CA 3LF1A 1YAHA 2YVAA 2A9VA 1ZIYA 2ODEA 4Y2HA 3ZJTA 3ADCA 3OUTA 2MINB 1CDZA 3L7NA 4MEAA 1R4MB 3BB3A 4EPXA 1O54A 4CFYA 4HB4A 4HL6A 4JL5A 4GICA 5AIBA 2VPTA 1SR8A 1Y3IA 2RKWA 1C7IA 1NPDA 1M33A 2VDQB 4IV0A 3RNOA 2WJ6A 3RU2A 1FFHA 3FYDA 2QTGA 4PC7A 4C0WA 2R87A 3ZS9A 4EKDA 3A9RA 4DR5B 1QIKA 3MINA 1CF9A 4CM6A 3JZFA 4C7BA 2DTDA 2H17A 5MGBA 2QW0X 3AEKA 5LQCA 5DP1A 4B2IA 1I4EB 3GRVA 5DXAA 2QHXA 1N9GA 1QH8B 3B20A 1M83A 3WLLA 4E7OA 3RRJA 4Q9JA 3ETEA 3Q3HA 2X1HA 1I2CA 3WNCA 4BX2A 5KCZA 4J76A 3T9AA 4I1VA 3UUGA 4A5OA 1PF7E 1PS0A 4RQUA 5EWJB 4UAUA 3RS4A 5IASA 5DX0A 2YVLA 4FB4A 3GEPA 1LJLA 3U3RA 4BMDA 3ZU6A 4BUZA 1E0SA 1IHUA 4GF5A 4CMIB 4P93A 2H48A 3FNHA 4H59A 4DMRA 5K0CA 5JPIA 1T1JA 1GL3A 4CLRA 3C5CA 2Z1DA 3SXUB 3QXXA 3N2ZB 2VAMA 1TF2A 5DT2A 1RFLA 3ZY6A 3RI3A 4ARSA 2BGTA 2P40A 3HXQA 3MJDA 4YREA 1ZITA 5C52B 3FTEA 1FEZA 2R65A 2R6CA 1JB1A 5AK0A 5HP4A 3W8RA 2CEKA 4ZT4A 2F17A 1EVLA 1UBGA 3G2OA 3TW6A 3UMMA 1EFRA 3UKJA 4OHUA 3AESB 3NVKI 3WIUA 3ICEA 2XNHA 1R0BA 1ITZA 1CVLA 2GBCA 3E05A 3Q3GE 2VF2A 4MGKR 3K6JA 3N3BC 4BATA 4ZCRA 5BQPA 3NYIA 2I2DA 3O9VA 4RLSA 1H9CA 1Z0AA 4ZPXA 2MSNA 2H2DA 3QVXA 2ZZNA 3PUYA 4TQAA 3S5JA 3FIUA 5AVOA 4WJZA 1AS3A 4LGMA 4X1YB 3GFTA 4ZDKA 4IIJF 4ID9A 5LMCA 2JJQA 1N7HA 2PUVA 4PRYA 1GVHA 1FCJA 1KJJA 1B14A 2NOAA 4HG2A 2ZSEA 2ZR0A 1CY6A 1G2IA 1RPTA 4PNZA 2IEGA 1Y6GA 4AWAA 3X1KA 2WINI 4KFSA 4BGEA 2NSDA 4ERXA 4AF6A 5BNIA 3CHYA 4D43A 3FOZA 4J0QA 2FEMA 3KVYA 2ZUUA 2NP6A 2W2LA 4ZA2A 1VECA 3PIIA 1DWUA 4M1QA 2VHYA 1ID1A 5H7XA 2FP3A 2RGCA 5HRAA 2C94A 1TDJA 3C3XA 1NMYA 3EUFA 3ZH2A 5KJFA 2FHSA 2INGX 5BORA 3PICA 1GP2A 1SELA 3P4YA 1XKXA 3PXBA 2IPXA 5J2TF 5I3ZA 1ZM7A 2I7DA 4BXOA 1UDWA 1ZRMA 4K9KA 3CCFA 5DNUA 3OEHA 4RY9A 1U0TA 2IT1A 4J2TA 1W4BA 3GMTA 2VF4X 4DLNA 1DAGA 4UAJA 4TROA 1ML3A 3Q15C 1RYDA 4BWVA 2AZ4A 2XA1A 4MQUA 3LV8A 4Q05A 3E48A 3RADC 4EY5A 2ZAOA 4X6UA 1NU6A 2I2XB 1QU2A 2ES4A 2IX9A 4NZYA 4G0PA 2XNJA 1SBZA 1Y6QA 2D8MA 3NHLA 4MR9B 3KFXA 4WFJA 3SIRA 1BN6A 4E32A 1WG8A 3T9CA 1MABB 2X0JA 3D8TA 1NUAA 1TYBE 3QWBA 3AM3A 4NECA 3ROZA 2EARA 2A3RA 4BV8A 2V7XA 4YJKA 2ZYVX 1RRFA 1Y8AA 5DK4A 5LR6A 2QAJA 3Q2OA 1F9EA 2YHBA 2YQ4A 1NUPA 4YCSA 2L19A 4MRSA 5AHKA 1DUVG 1JJ7A 1J49A 1M0WA 3LFTA 4I5EA 1FTSA 3TCNA 2DSNA 3E18A 4C78A 1F6DA 2ZYSA 1R0SA 1U0FA 2HLHA 4OLHA 3A6LA 1WSWA 4LWZA 4MS3A 3OCJA 2Y4NA 3E9RA 3ANXA 3CMCO 3X2SA 2O57A 2VJLA 4MUAA 2A9OA 2XAUA 4DV2B 3QEMB 1C0IA 3OQBA 1YCFA 5ESXA 1RI1A 4BGDA 5BVGA 1S02A 2D0DA 4W6ZA 1GGNA 3OE4A 3PGKA 4QQRA 4S1VA 1X94A 4AAYA 1ADYA 3BE4A 3WZLA 5JROA 1L4FA 1B0AA 2O8DB 3EG9A 621PA 4BO5A 3PFGA 4OI0A 3D7RA 1YR1A 2I6UA 5KIAA 1SBCA 1P4HA 1UP4A 4UNPA 3FAZA 3M6IA 3N2YA 4GMGA 4JVOA 1E32A 1XZNA 2J9FA 4MZXA 4BAZA 5AW9A 1A9RA 1Z5NA 2DF8A 4X85A 5KPJA 2VDRB 3MINB 1C3OB 4H3KB 2DPXA 1HG1A 3KPJA 4M3NA 2PE5A 3AILA 1DCTA 5LOVA 2D5BA 4IMRA 2QM8A 3L05A 4K5QA 4CMIA 4RVOA 3QKSB 1PBTA 3PX2A 2OECA 5EY5B 4A03A 4DYHA 2A59A 4JKIA 4XVCA 2CDRA 4D46A 3FCOA 2QL9A 1YFLA 2CXPA 5EEGA 1WXIA 2MSLA 4F06A 4LOJA 1UOQA 2VRNA 1KOJA 4MUYA 3W5AA 1IWBB 1F2TB 4GXNA 2LDXA 3OPYI 2VJNA 2ZSJA 2O2IA 1SHTX 3DZIA 3EA4A 4V2IA 1T5BA 5B3JC 4P5DA 2PH5A 1YBHA 4R2LA 1KKLA 1M72A 1V43A 4ND8B 1NXWA 4MUIA 2CXSA 1DTWB 3F71A 3JZDA 3WQHA 3LZ6A 4E70A 1JRLA 2PT6A 2CHUA 4UKDA 3V1NA 5GGYA 2PIAA 1BFDA 1AV7A 5LZ8A 1QX4A 3GGDA 4H27A 2H8KA 1H6BA 2JLCA 1KP3A 2FJPA 3OWHA 5K4GA 3QQ5A 3FPJA 1LQUA 3QEKA 3RSLA 4Z4HA 2QX6A 4UUOA 2ONJA 1Y4AE 3PF9A 4P3PA 1Y3HA 2H2FA 3UKDA 3RSZA 3SC4A 3HFGA 4LGVA 2JCVA 4M0EA 1PP4A 2FUCA 1KI1A 3HB7A 2VUUA 4KJZA 3RT9A 1D1SA 3JWEA 2X58A 4ZT5A 4XWWA 4OGFA 1DB3A 2CL6X 1S6YA 4PR0A 3KOWA 1DKMA 5H59A 4CLOA 4DIUA 5DSZA 1I94B 3DXYA 4F7WA 4U4AA 2EV9A 4I1YA 3I9JA 2C3UA 3ZIUA 3LPLA 1EZZA 1UJ5A 1YOVA 3TZKA 3QE4A 4IEFB 4ALIA 4J4BA 4C0AC 1FS5A 3CF6R 2C31A 2CMHA 2RGEA 2OA0A 3N6RA 4CBVA 5JEEA 5LKRA 2OHGA 1PFGA 4CKEA 4PBRA 4XB1A 3PD1A 4X7RA 2Q1UA 3HSSA 4TN1A 1KZ6A 2NO4A 4P38A 5AW6A 4N8SA 4A6EA 2FW1A 4F1JA 3SIXA 5D3KA 2I71A 3OPNA 4KRFA 4L4RA 4P22A 3HACA 5EWLB 2W6JD 3T0IA 3ZJYA 2WIKA 1EGQA 1V7ZA 3HS3A 4D8YA 1NULA 2A88A 1JYSA 2EFJA 3VHRA 1ARZA 1MNAA 1ZINA 5HOEA 3KFVA 4OV6B 4C30A 2Z9DA 2FNAA 1FP2A 5EIBC 3AQIA 5JCJA 3T4XA 3V1KA 4WXHA 1ZOSA 2AC7A 3L9WA 4UTNA 4FQ5A 1YHYA 1V8OA 4F4HA 5ALQA 2JH9A 1MQ8B 1WPXA 5IH3A 4ARIA 5K2MA 2CVFA 4QG3A 3GLIA 5BV1A 2PSFA 4U8HA 1B8UA 4U3JA 2JJYA 2HJHA 1I7DA 2CGEA 4P7KA 1HYGA 2R6FA 3QX8A 2UUOA 5K0GA 1YJAA 3O8OB 2PX6A 3WV4A 2QX8A 4DIFA 2B99A 4Q5IA 2HHHB 1GPLA 1AA9A 3RSGA 5AVTA 5JLJA 4KG7A 1E4OA 3DOJA 4OQMA 2XW6A 4V0ME 4RTPA 3MHPA 3QWAA 2V6MA 5IJXA 3IP3A 1KJQA 3JQGB 1FUIA 1M1XB 3P45A 1NUHA 1P4GA 3UMFA 4EO7A 3AJRA 4NH0A 5LQNA 3AU9A 1RWVA 1SG9A 5CX4A 1MT0A 1D8TA 1EE9A 1V48A 5KSPA 3U31A 4CKCB 4UEOA 1LKZA 2IDKA 3BHJA 3UN1A 1QE5A 1FQKA 4FDUA 4ZWNA 4X7BA 4RGQA 4F4CA 3ZNQA 4CEIA 1KU6A 2E5FA 1IUNA 1JH8A 1YZGA 2QLBA 2B1RA 4F93B 4D9JA 2J9GA 3W6OA 1U0RA 2XITA 4YONB 3PWSA 4RAQA 2VP3A 4OYRA 5I9SA 4YUVA 3LQRA 1EX1A 4RZIA 1XZHA 4C1BA 2W8BA 3SHQA 5JCJD 1RFGE 1OZAA 3ZW7A 5I6DA 5E2IA 5KTOA 5TB5A 5FJIA 2B21A 1XTJA 2IZZA 3RH0A 1AHPA 4L0MA 2NV0A 2H2AA 3T15A 1G5PA 1RXEA 3G82C 4IIGA 1Y7TA 3PJFA 4XJTA 4BMSA 1QZ3A 2ETXA 4B3JA 2NTVA 2WDZA 4Q1AA 5LXTB 1YVDA 2POCA 2B83A 3DHWC 1CWUA 1IBSA 2R60A 4KZKA 4FONA 3HXKA 3PE4A 4LJLA 1XD9A 1ZJWA 5EE1A 3O7MA 1P75A 2OBXA 3RRBA 5D7BA 3WL7A 1TFRA 3K92A 4JB8A 3UA3A 3IAUA 1EG2A 1KS9A 4ES6A 4A2PA 1C1DB 4E31A 2P68A 3EGDA 3GAAA 2ID4A 1RI3A 1JFFA 2QNIA 1AS0A 4C22A 2J5RA 1WSBA 1DINA 1UKYA 2NYVA 3FPEA 2SECE 3LYHA 2QN8A 1C3VA 5T4HA 3SQDA 4AKEA 5IDYA 4MV1A 3PEFA 3J81k 2E5WA 1SGWA 3OE5A 3VU9A 1KARA 1WB6A 5ICEA 1L5FA 3F2IA 4KL8S 5LVAA 3LBIA 4XWKA 3PGXA 5EJ4A 1DL5A 3THXB 3AESA 4CUJA 1QVAA 2RHOA 2QYHA 2YJNA 3DV9A 3LVQE 4TMTA 5EFZA 3DMTC 1OX4A 4TMYA 3ZBPA 3DL0A 1LTKA 3CUKA 5BRJA 2NZ2A 4UOQA 2YY5A 2DUWA 1ULAA 2WD7A 3CUEF 2NAPA 3FAKA 4C0QC 3BMXA 3E1KA 4FU0A 2IHNA 2IXDA 2ODTX 3LW7A 3R9IA 5CVUA 4DHWA 4CMGA 2PNJA 4UQLA 3HY3A 3M9XA 2WR8A 3LUDA 3PYXA 3QF4A 1SOMA 4OP2A 4NDNE 4XOUA 3LG2A 2FH5B 5EZSA 1J1IA 2XRMA 3UH0A 1JDPA 1AV6A 3B8HA 1BGVA 4IVPA 2I3GA 3CH5A 3KQLA 2QU8A 3E58A 3EASA 3H2YA 3KU4A 3QW2A 1YH3A 3D81A 4G6ZA 3I39X 4A82A 5JFOA 4I6GA 2O8EA 2CXTA 1DAKA 1WX1A 2I9PA 3RJZA 1KY5A 2W2VA 4IDEA 4YCJA 2VNAA 1P62B 1USIA 3ND5A 3NIBA 2G17A 4EG0A 1ZLXA 2Z2JA 1X8LA 1W96A 5EE3A 4QATA 4CG0A 5K4AA 4I1RA 4E5VA 3DBRB 5A4IS 2UU9B 2JHGA 4GXTA 4EVRA 4UHBA 5BURA 2P77A 3DJFA 4RD3A 3JV7A 2NO6A 4ZO6A 3DE0X 3C3YA 3PBKA 1HOXA 3ZE2B 3CN9A 1NX9A 4QU5A 3RE1A 3LC7O 5AVKA 2PBRA 3KG2A 3TOXA 5DNCA 2EZ4A 4KI0A 3IMGA 3NASA 4AP9A 4Z5XA 5BWMA 5FWDA 5CA1B 1Z0IA 2FCRA 5GMOA 1IEVA 1FMTA 1NJ8A 1AU9A 1ZGZA 1W4LA 2G28A 2V3WA 2XRFA 1T5LA 3L4EA 4FINA 4PV7A 4UZFA 2AZDA 5G1OA 4UCQA 1TK3A 4ZDWA 3C3KA 2BEWB 1X15A 4YRSA 1DEKA 2OXCA 4CMCA 1Q57A 2BD0A 4B3RB 1CQZA 3H18A 2CLIB 3M89A 4Q6BA 3VOSA 1KFBB 3E81A 3MBIA 3S81A 2GEKA 1YQDA 2G7MC 2ROQA 2P9EA 4EELA 1GNVA 2OLKA 3PI6A 3RRYA 3P0IA 1LY1A 3FUVA 2GDJA 1GZDA 4ARUA 1ZUIA 1NY5A 4G0ZA 1EDOA 4QRHA 3X2FA 4JITA 3L43A 3OZXA 5H83A 4ZYZA 2X0NA 3LUCA 5JEDA 4RH0A 3K35A 5TQ0B 1PD1A 1UFVA 4GBGA 4RZQA 4TWJA 5HQ3B 2Z6VA 4YR7A 5AH0A 5K0BA 4P82A 2ZM6B 4AUNA 5A4AA 5BV8A 3GRPA 5FUVA 1XZMA 1YZTA 13PKA 3LT4A 2WF9A 4Q3LA 3QH4A 4UUAA 3IIMA 2XB6A 3EGXB 2DWOA 3EGEA 1V41E 3ZE1B 3IR6A 3VH3A 4DLZA 2JJMA 1PNTA 1TT5B 1P7CA 2Z09A 1PLKA 3GCWA 2JD0A 3KP1A 3OJOA 4G4JA 5SICE 3Q8LA 1NW8A 2XUHA 3BT7A 3U4MA 3KT6A 1Z4IA 1H0HA 2IP2A 3GP3A 4UULA 3V1TC 5KDOA 1Q1ZA 3TXXA 1CUXA 1E4EA 3LXXA 4RSGA 4A91A 1EK5A 2A57A 2WHEA 1GKKA 3PL5A 2H1SA 3SR3A 4BX9A 3IKVA 4YJ2F 3UICA 2F48A 1RKUA 5K6TA 3ROQA 2VUHB 2FRXA 5LZ5A 2JI7A 2XJ4A 5BR8B 1ZWKA 1SQ0A 4XKJA 3OURA 2JLSA 2Q29A 1M6WA 3FROA 3IPLA 5CHEA 1SXJB 2LDBA 1N6HA 3W0LB 3ZDBA 3EZGA 2JGFA 4DDKA 2XIJA 4LDAA 4G0MA 4UEJA 1EFVA 3RODA 2IIPA 5DOVA 4JBLA 3VRHA 1V6CA 2GN6A 2ZAGA 3EMDA 3ZV6A 1ISSA 2OBNA 3GJ8A 4D3FA 1MTZA 1Z2AA 3DV0A 3AYXB 3LC2O 2IU0A 3RSQA 4NKRA 4CMHA 1R2QA 1TLFA 1Y8RB 4A8JC 2PKQO 2PM8A 4HN4B 2COUA 4OAOA 4UM7A 1T10A 1AN9A 2C2OA 3A6JA 3JS5A 1UQTA 3RVKA 3N6XA 5DFAA 4BLRA 1RI4A 2YZ2A 1MC1A 3HCRA 2GFQA 5C31A 3V4VB 4B32A 1W36C 3LSTA 3TO5A 2NO5A 4ZO8A 5A2GA 4CI9A 4F92B 4YCBA 3DLCA 3C7DB 3I2KA 2QXTA 1I7QB 4UCXA 4GP7A 1E1DA 5ES3A 3SDSA 4KPFC 2VF8A 4RV4A 3T0GA 5LQMA 1SNYA 1V5IA 2RKOA 4K2HA 4FYHA 3GUVA 3FSRA 4YJHA 2B2XA 3BXPA 3KQVA 1POXA 1O9HA 3R20A 4RY2A 2QY6A 4QNMA 3DMYA 5COQA 3V1UA 1QZZA 4C88A 4DSOA 5CFLA 1FPQA 1U1CA 1IBMB 3AWIA 1S2GA 4Y6PA 4DLRA 2VHCA 2WTEA 1PWHA 1RD4A 3WSTA 3CO5A 3IUMA 1NBEA 5KNDA 1Z6XA 3I2GA 4LVCA 1HFKA 4TWAA 2HADA 4P34A 4L5JA 1M54A 1LRJA 3WDMA 4EB8A 1IN1A 2PWZA 121PA 3K09A 1QQBA 2Q0XA 3ZCTA 3CVUA 3UANA 3PGJA 2ACKA 4CGYA 3BDVA 1YL5A 2JLRA 4TTRA 1HK7A 1Z3CA 1SK8A 2CY0A 4MKIA 3DVSX 2MT9A 3KKQA 4LDZA 4B80A 2PX8A 4YRQA 3AHEA 2VHEA 4CKXA 4FEEA 2BGKA 4PC1A 4PCAA 2HU7A 1OBOA 2RK4A 1CUUA 5BPFA 1PT5A 4JUAA 3E3AA 1KFJB 4Y6GB 3THSA 1MH9A 8AT1A 5U9CA 1T24A 3JXEA 2ZTMA 3IMKA 1REQB 4BV2A 3QQPA 4D02A 1M6YA 2VJMA 4XTCS 2PJZA 2XR1A 1J2RA 3CLUD 2ZETA 3WGKA 3WK9A 1E1NA 1JR6A 1AS2A 2YW9A 2YYYA 2E4XA 2L18A 4UNNA 3TTVA 4TYNA 4I3FA 5KYNA 5KNCA 3PA8A 2ZDHA 3QKTA 3ZVNA 1Y7IA 4PSDA 3L1HA 1DQRA 2JCSA 2G0TA 1VI2A 4TS4A 3I53A 3MB5A 2PT5A 4U6QA 1KTIA 2F55A 2NVUA 5A9RA 2QLLA 1EUZA 3U17A 1R15A 2XHZA 5CNKA 4YI3A 1YB6A 4BLQA 1GOTA 4U2GA 1E2BA 3G8YA 2IYLD 4CN8A 3KT3A 1ZK1A 1SC3A 3LY9A 4FI3C 1GUFA 4HR7A 4HWOA 2CT8A 4GKKB 5C5IA 3A2LA 4NU5A 3AUSA 3GP8A 3NTQA 1WM1A 4QEDA 1T2UA 4TT3A 3G5TA 4XUGB 2SKCA 3C48A 4BMPB 4C7XA 3U3JA 4WEQA 1U0JA 1KMNA 2VNKA 3PTLA 4V0QA 3ESQA 4NEGA 4Y6OA 2B6NA 1OXBB 4AY4A 5KYYA 5BSKA 1UJ2A 1QWSA 1YKGA 4ND5A 3TRJA 3GVIA 2NU9A 2VRBA 4GZ5A 2HWXA 4MW6A 4PGMA 4CL2A 1ONBA 2BR4A 2ZUCA 1MB3A 4FFRA 4GPIB 2D3TA 4L5AA 2C98A 2IPAB 4KQGA 4MQFA 4YAKA 5J1SB 3EXFA 3RFFA 4D9BA 2RHRA 2VPZA 2VRWA 1PAUA 1FX1A 1JDBC 1XVAA 3AFHA 3DGFC 4G1UC 2ISSD 4D3XA 4Q9AA 1ZESA 3E9YA 4EF6A 4MVJF 2VBFA 3GUUA 5LP6B 1OLUB 2HHCA 2WHRA 4L5CA 2IUEA 3GO4A 4QT0A 1Q77A 2MINA 2Q6VA 1EQUA 2AG0A 2GM9A 3EF1A 3QV2A 3FNQA 4DQVA 4EF5A 3JQBC 1OI7A 4MNTA 4ISCA 4YCMA 5IJ0A 4ABTA 3HDTA 2A0UA 2X6RA 4MUNA 3BULA 3MQ4A 2J6CA 3BL8A 1P9RA 2BE9A 3DAOA 4C7OA 3EW7A 4MQBA 2HD4A 2H31A 2JVIA 2CZCA 4R4JA 1QAMA 1RJ9A 4WTOA 3MIIA 4LF7B 4JGGA 2ZWAA 1OWNA 2Z2ZA 4ARCA 2HW8A 2J3IA 1IG0A 2GERA 3K9HA 4KQHA 1F6BA 3ONVA 2ZT5A 1Y1RA 3ZZTA 1RHKA 4G0YA 5D7NA 4ZIRB 3IPYA 4IFBA 3QU2A 2AVDA 1P1IA 3UIEA 2A1IA 4HDRB 1VCIA 1XK6A 3VTFA 4OM8A 4MI6A 1GDTA 2FSHA 4Q1VA 4X44A 2CL0X 3HCWA 1WJGA 2NZJA 3IQDB 5C8DA 2Y0EA 3TBHA 3BZBA 3GC6A 2ORYA 1NW7A 4AJNA 3ITEA 3KKMA 3IT2A 4LX8A 3ZYCA 3UJ9A 5JAOA 1LI5A 4BCDA 4D4IA 1SHKA 4KQJA 3SC3A 1L5HA 3AR3A 1ZXBA 5T3UA 1GL7A 2B82A 1II0A 1YACA 4KXNA 4YQZA 5KJ1A 3H4VA 3UHPA 4X8MA 4TZ0A 4P53A 3ADBA 3PQ4A 4IRUB 1RNLA 4L6CA 2HHLA 5K3SA 3TQHA 1DO0A 2ZGVA 1GNLA 2DR2A 3KXDA 1YMVA 2BGNA 2LW7A 3NIFB 1X3LA 3O92A 2Q3HA 4JLAA 4M1WA 1L7MA 2DAPA 3BERA 4MZDA 2CLHB 1GUAA 4MUMA 2QX4A 1XKTA 3W9BA 4QWMA 2PRIA 1BVRA 1U2QA 2XXJA 1ISPA 3D9QX 2DHEA 3IELA 5EC8A 3PHBE 3SSAA 3LHDA 1LSOA 4DPKA 1YI0A 1FW6A 3ZDDA 1YR6A 1L5VA 2K2WA 3FGNA 1YZLA 3WGZA 5ES4B 4LF8B 2DBZA 1YZHA 2WWYA 3DUFA 1MX3A 4ZC1A 3VR3D 1X7ZA 2JEOA 4RU1A 1V9SA 2WWXA 1QOQB 1VC2A 4AJ2A 4F96A 3A9VA 4M1SA 4V39A 3RD5A 1Q1QA 3Q6IA 1NU8A 3GLQA 3P27A 5B1DA 4ENPA 1U9YA 1XRNA 3PNKA 5HK9A 4M1MA 4ZI7F 5AJHA 1KERA 1EKXA 2M1XA 1GGVA 1Q3HA 4Q9KA 5AJWA 4MB6A 2AMYA 1KDYA 2OYCA 2QGZA 3SGLA 5J3JA 2GJ8A 2XMDA 1DZIA 4QSMA 3ZWOA 3ZTWA 3JQ6A 3ZC3A 1Z22A 2VC2B 4S35A 3GX1A 2FGKA 1Y9EA 2X5OA 3IA2A 1I2DA 1W6RA 2QTLA 4WERA 1DFHA 4L8FA 3AF5A 5FF9A 1L5YA 1P7YA 5ERYA 1J9GA 1PEKE 5B1EA 2G1KA 2J09A 1XG5A 2CFCA 3C5VA 3AGPA 3T3HA 4EVIA 1GG5A 5KZMB 3MBOA 1OILA 4N3NA 1CPYA 2GWRA 4TKUB 4JR0A 3RRFA 3TZLA 3K6SB 4PCVA 4IVNA 3WGUA 1NYQA 4LJYA 3EGIA 2F7SA 3LD9A 3KZVA 4D1YA 3BHNA 4JQZA 2M32A 2BLNA 2OP1A 3WHPA 3EF3A 5F33A 3KXIA 4EW1A 3M4ZA 1QGUB 4WCFB 1YBVA 3QPAA 3ABRB 1HFEL 2ZBQA 3E9EA 1KBQA 6LDHA 1O97C 2G04A 1EAYA 4N6NA 3PDIB 4BKRA 4BYMA 2HDHA 2UUBB 2CVQA 4A16A 2RHGB 4BPRA 3VR5D 1FYXA 2WFMA 4MR8B 2OD2A 3O9ZA 3ETDA 1ZBDA 4OHKA 4BQIA 1UEXC 3R4CA 2NN3C 2P5SA 1OFUX 1OKKA 1Y7HA 1QG6A 3TSZA 4TV9F 1EUDA 2DLDA 2N47A 2W2KB 3W3AA 1B6SA 4RZUA 2JS7A 5CITA 1CQPA 1T4DA 4DSZA 1E0DA 5BR4A 3ENQA 1T9KA 2AD1A 4IDHA 2NTYC 3AR7A 2W6NA 1CY0A 3IR5A 1FVOA 1RWKA 1C9EA 2ZRGA 2QWXA 2WHYA 4I66A 2XT0A 3LT0A 5CLGA 4AF8A 4CQMB 4YV7A 3KSMA 2D00A 2E55A 1NVBA 3PFCA 1UWCA 3HWSA 1JQEA 4R1NA 1GZUA 1O1YA 2VTEA 2I76A 2PRZA 4FFOA 1KYIA 3N1UA 4P86A 5D86A 3WGGA 2G1JA 2O8DA 6PFKA 5H0IA 2WUEA 3LM8A 2RCYA 3BXGA 1HYBA 1NMSA 4GYKA 1ANKA 2B9EA 5CH3A 5AM4A 2ZSFA 4MV8A 5I9TA 4O02B 3G1WA 2C3PA 3KDAA 2XUAA 3GDGA 3C16C 2ATEA 4DRYA 1Z5VA 2OK7A 5C9ZA 3HZOA 2VS1A 3QVJA 1WQ3A 4FGKA 4KXWA 2C5AA 3GJ5A 1SU6A 4R31A 4U0KA 1ZMRA 3BB4A 1WV1A 1O94D 2O2ZA 3BCSA 3L6UA 3QG1A 2HO4A 3NEJA 1U3DA 2G09A 4RTSA 1G0OA 4WW0A 3DTTA 4HDKA 1CUWA 2A9KA 4EFMA 1E5VA 2IDZA 5E0OA 2H1LA 3KELA 3LF2A 1GG9A 2BTQB 2BFPA 4RPIA 2IXTA 1C9MA 1WDLA 1AT1A 2J8ZA 2WZDA 1CY8A 3LLSA 4HN2A 3OE7D 2WVHA 4QOFA 3CPSA 3PHGA 2XQVA 3KS9A 2W0SA 4FW8A 5JQWA 1UIRA 3FCCA 1Z39A 3MMXA 4XQGA 3NTOA 2HUPA 4TM7A 4DCMA 5DWDA 4ER3A 2IK8A 4BO9A 1H2XA 4DILA 3AEUB 3OF2A 2PMWB 3BG5A 4MW5A 3FSEA 2GZRA 1YQWA 1I4WA 3HKBB 3L9XA 3HK2A 4R54A 1Z4QA 4ZGWA 5AW7A 1M3SA 1TM2A 1ZIPA 3ZLVA 5JYBA 2HSDA 4MRMA 5DTJA 5ERGB 2V3CC 3LY5A 3UYKA 1DWOA 1Z6QA 1PR1A 1T1SA 2B3TA 3JWHA 3ME5A 1M2NA 1L4YA 2PUJA 4V03A 5JNVA 1V8DA 5D8DA 3VR4D 3DDNA 2XKBA 3Q7RA 3AT1A 1KMHA 1WLYA 3B52X 3HYTA 1TAUA 1VJ1A 2X9NA 2YQ5A 3D4NA 2QENA 3ZHCA 1TFUA 5FO1A 5AM2A 5AI5A 5F35A 1C3OA 1P2FA 2XB8A 1G8PA 1YS1X 4NYIQ 3WIDA 4FFDA 3BSFA 3SJUA 2CE2X 5K3DA 1CETA 1I0ZA 3SSOA 1CR6A 1MZVA 3VVCA 3JRWA 1MC8A 4PRLA 5EQJB 2OFXA 2OWEA 2Y93A 3B1KA 4GLBA 4LMAA 3TKAA 1KVRA 4ZZ1A 2FMTA 2BFDA 1A88A 1NV8A 2O2EA 4JIGA 3BYZA 3P9RA 2Q28A 4WD3A 3T7IA 5A5VA 4J0IA 4XCQA 3AVYA 1BMQA 1QCYA 2P2SA 4P35A 4DJFC 2H29A 2QG4A 2Z4TA 1G5QA 4IV5A 3VVLA 1UR5A 2FEAA 5EE5B 4JLDA 2GEDA 3CTMA 3GJTA 4YRCA 2YHSA 3W34A 2YJTD 1NNI1 2Z95A 4RLQA 5BSMA 3RF6A 3ZNNA 4LXGA 1TC2A 4PLTA 2WJZB 3IQFA 3MSXA 3G7NA 4EW2A 4M7OA 3UXEA 1OIXA 2QMUA 3PXXA 2R1UA 4H6VA 2EGUA 3A04A 2EFYA 4BAGA 3EFHA 5BNTA 1J1UA 2OGWA 3JQGA 4I5FA 1AURA 2IOYA 1JSCA 3S1LA 1ONNA 1RYYA 4MB0A 4Z0NA 1XRSB 2C78A 3GJSA 2WILA 3KLMX 2NZUG 2P41A 5TE9A 1BXGB 1EK6A 2NZXA 3C3PA 5DLDA 5JS2A 3B2NA 3MJSA 1TTTA 4D4MA 4TXNA 4FNOA 4WT7A 1GO2A 2C0CA 2Z5LA 5TDHA 2PD6A 4IOKA 2JGNA 4NFSA 5BN4A 1XQWA 3Q9NA 5GM1A 4BFXA 1FNNA 2FSSA 2QVYX 1MH1A 4IOJA 2FK7A 1N3LA 4FNMA 3O83A 4UFNA 5F5XA 4H7IA 2ZSBA 4TSRA 3TAUA 5T6MA 2A0KA 2QVCA 4F2DA 4Q47A 3DFUA 3LGAA 1R18A 3EFBA 4RA9B 4INZA 3FVTA 2P6RA 3REGA 3S2ZA 5KHLB 4KIFA 1S3SA 5AHXA 2ZE7A 4QG7A 2NW6A 3I0MA 2FPIB 3IHLA 2GSDA 3HJRA 2LR0A 5T57A 1Y3AA 3AHGA 4YLEA 2JI4A 2GN9A 3KIPA 1BSVA 1F0NA 2JATA 2E4ZA 2RHLA 3ABOB 3PS9A 5EWMB 3GRUA 1E9FA 4ZRMA 3SOZA 4BWYA 4DQXA 1SKAA 1E9AA 2G08A 4XLZA 1CXZA 1SIBE 1G3MA 2F62A 2PMBA 4L4UA 2D8AA 4BO4A 2M2IA 1HKHA 1W94A 1J7KA 1XZBA 2AK2A 2V6IA 4A15A 5DWQA 1H8EA 4KQIA 3ACDA 1HYEA 1KO7A 1USVA 4ZK2A 4RNCA 5EIAA 4BFUA 3PFHA 2GCOA 4E11A 1E92A 1NKSA 2Y99A 4JUFA 4NR0A 3TZ6A 1XHEA 3JVVA 1XCPA 2H4FA 4GI2A 1T8UA 2YWBA 4KSCA 2TYSB 2G5TA 3IV6A 4P3KA 4YT5A 2C2WA 3C1TA 3LQKA 3RPEA 5BR1A 1VZ3A 1A97A 1K92A 1N5LA 2FMIA 3FOCA 3V4LA 3W5IA 3WR5A 4XGIA 1MPTA 2RMKA 4GI7A 4TL8A 3L79A 3I2IA 4NDZA 1QIDA 1HI9A 3A2KA