3H5RA

Crystal structure of e. coli mccb + succinimide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
340
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 110
structure length 340
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5rA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5rA02
2DFDA 4FCCA 1H9BA 3M1LA 4FGSA 1KC1A 5A9SB 1VL0A 2A92A 3OBBA 3PP8A 4YCAA 4KWHA 2I65A 4PRLA 3VH2A 3ZW9A 5IG2A 1DXYA 3EY4A 3E6AA 3UCFA 1Q1NA 4JXKA 4RVUA 1HDZA 3FCOA 5CHEA 3UUWA 1R12A 1DLJA 1I10A 2IZ1A 3V1UA 5I8WA 1LRJA 2FSVA 4GBJA 4JBHA 5C3MA 1YJ8A 4LVUA 5CEEA 3O4RA 3LLVA 5FI3A 1SEPA 3CINA 1PZFA 4FBGA 3E8XA 3OA2A 3O9ZA 1QYVA 1X7GA 4JBIA 4DPLA 4J1QA 2BGKA 2BELA 2O23A 5GZ1A 3ANNA 3VZRA 3IUSA 2UDPA 3T4XA 4CQMB 3B1JA 3OECA 1E7SA 2O3JA 1T1RA 1UH5A 3BMCA 1N7GA 1DIRA 4J4TA 3T4EA 4BB6A 1C0IA 3V2GA 1CIVA 4AJIA 1CRWG 3MCVA 4BS9A 2ZB7A 1EFLA 1PL8A 1QV7A 5TS3A 3UF0A 1IB6A 3WNVA 2RH4A 4NBRA 2W2LA 3KEQA 4O63O 4YAKA 5EPOA 4YJFA 4UUOA 2EG9A 2NVUB 1XR3A 2X58A 2B5VA 2P5YA 4CM9D 4L4XA 3OEWA 5EQFA 3NAQA 1SC6A 3WJAA 1OAAA 4EDFA 4CMJA 1ONNA 1QYDA 4NJMA 3WWZA 4NPCA 2P68A 1BWSA 1ONPA 3HSKA 3SC6A 4D43A 1IZ9A 3LQFA 1B15A 4NJOA 4LN1A 4UEKA 2BD0A 1UXIA 4BIIA 4J16A 1IE3A 2C20A 1ML3A 1IY8A 3AY6A 5DOZA 1EEHA 1DSSG 1XKQA 4RVHA 4BO8A 1GYRA 2BI7A 4NNJA 5ILGA 1NFFA 1NHWA 4AJHA 3EHEA 1DAPA 4PG6A 1BMDA 1UXKA 4KWIA 5IZCC 3IQDB 3WGGA 4D0RA 1QYXA 4YAEA 4MVJP 4CM7A 2XF8A 1Q2XA 2X5OA 3I4CA 4U0JA 1C0KA 3DOOA 4Z0HO 1WLYA 3ON5A 3NJ4A 3DBLA 3GFBA 4R1UA 3RFVA 3QWHA 3B1KA 3W8EA 1RYDA 1VKOA 1ISMA 2DPGA 3GVHA 3NTQA 1GL3A 1YQGA 1WP4A 3WGZA 1IHYA 1VRWA 1AHIA 3JQ9C 1WZEA 4HADA 5HTOA 1HLDA 1V6AA 3KRTA 3HQ4O 5HRUA 1GPDG 2I99A 4CM4B 3JQFC 4XIYA 1ZBQA 5EESA 4BOYA 1ZW1A 3D7LA 4FOOA 4GL4A 1QRRA 4TQGA 2SCUA 3OJEA 2JD1A 2YY7A 1V3UA 5AXCA 1GUZA 3BMNB 2EV9A 3PWKA 1H94A 3INGA 4YJFB 3WIDA 1MX3A 4J1TA 4IJWA 4BNNA 1GU7A 3F4LA 3U4IA 4LRSB 3W6UA 4IPTA 3UGKA 1I32A 1B2LA 4MVJA 4UAGA 4YRDA 3ZHXA 2AQIA 3JQAA 1V3TA 4YT2A 4QT0A 1BXZA 3IAHA 3SXPA 5A9RA 1UDAA 3G1UA 4L4SA 1E1KA 4II2A 1DC4A 2PR2A 1ZSNA 1NHGA 1DPGA 1GR0A 1PR3A 4XYLA 3H9JA 2ZQZA 3L9WA 3SC4A 2RBEA 4YAIA 1N2SA 4FFOA 4FC6A 4CMEA 2Y0EA 4HV4A 2DTEA 1DEHA 4ZQFA 1HDCA 3QY9A 4MPDA 4CMEC 1XELA 1Q0HA 4NI5A 3ANMA 4BKQA 4IJUA 2CZCA 4MP6A 3CUKA 3FTNA 1GTMA 1YOVA 3CEAA 2IXBA 3A4VA 3NGXA 4BO7A 2QYTA 2P2SA 3Q11A 2QHXA 3GAZA 3PHJA 1LDEA 1CWUA 2D8AA 2GERA 1KVSA 4RQTA 1SOWA 3DAPA 3LVFO 3LC7O 4B7CA 4FB5A 2HAEA 1DRUA 1MA0A 4YWJA 4BKRA 1CERA 1E5QA 3W4KA 3WNQA 1BGVA 1LQTA 5DDIP 5G0TA 1AE1A 3I23A 4G81A 1H6AA 4EBFA 1GEEA 3AWDA 1UXJA 4XDZA 3FWNA 1MG5A 3JQ9A 3LK7A 1GY8A 2D1YA 2VYVA 3FBTA 3ZH2A 3V5NA 4CV0A 4L8VA 2WD7A 3JQ7A 5F21A 1Y1PA 5A9TA 1Q7GA 2RH8A 1DHTA 3CMMA 3HUDA 1YB5A 3BAZA 4IQ8A 2B4TO 2OMEA 4NH4A 2W4QA 5TJ9A 4U5QA 3VC7A 5JC8A 4D45A 2JD2A 1NQAO 3PXXA 3WGQA 1UR5A 3WIEA 1Z6ZA 1DJNA 1PQPA 3PQFA 1PU2A 1E3LA 5TRTA 3GN2A 1T4DA 1SCUA 4E5YA 4B7UA 4C7KA 4S1VA 1DIHA 5THQA 4Y8VA 1I2ZA 5GMOA 2OZPA 1L7DA 2JCXA 2VNAA 3ZHYA 4EI2A 2CNBA 4UUNA 1DC3A 4NFSA 1FDSA 3PHIA 1SEVA 1O0SA 2Y1CA 1NQTA 3V1YA 3Q2KA 2YV2A 3Q6IA 5KKAA 4FSHA 3WYBA 2UYYA 1VM6A 3HWRA 4OXKA 2EKLA 3BMQB 3G0OA 2OBYA 3FTPA 1E77A 2HUNA 4BNYA 3WSWA 1G0OA 1T1SA 1YL5A 4XA8A 2HJSA 3K31A 3MJ4A 1QLHA 3OJOA 2Y0DA 2ZJ0A 2A94A 1Z7EA 4NMHA 1PGJA 4DMMA 1DO8A 5GZ6A 4DPMA 4J9VA 3RC1A 4CLRA 3AI2A 1W8DA 3OEYA 3PLRA 1LXCA 4R68A 1X13A 2WD7B 2FMUA 3ENKA 3GT0A 3WDSA 3TF5A 4NBTA 3GUYA 3PQDA 5GZ3A 2J3KA 3VH3A 2NVUA 3GGPA 5JSFA 1UZLA 4BMSA 3R1IA 4CM6A 5B4TA 2EJWA 2NNLD 2FPIA 1T2DA 2C5AA 3R6DA 1A7KA 3VTZA 1YWGO 3HN2A 2WYWA 1U3VA 2Y0CA 4B4VA 1D3AA 1HYHA 1BRMA 1PTJA 4M89A 3ZNOA 4CM8A 4JIGA 2UV8A 4XGIA 2ZB4A 3O26A 3WFJA 4GAEA 1H6CA 2HMWA 5DT9A 4JJGA 4CMKA 4ESOA 4IBOA 3D5QA 3MEQA 4K6FA 4BV8A 1JA9A 3EDMA 1N92A 3EZLA 1CDOA 3JYQA 1PJTA 4OGWA 3QWIA 1HZJA 3D64A 4WE3A 5G0SA 4ND3A 2AG8A 4BNKA 1NX6A 4L75A 1DC6A 4AJEA 1PQWA 2Q2QA 2O3RA 3U0BA 1LJ8A 2NADA 4L4RA 2YZ7A 2J6IA 1GUYA 4GX2A 3DHNA 3D4OA 4HXYA 2JD0A 2VWQA 5KVQA 2RIRA 2NU6A 4CMCA 1ISHA 3H9EO 1BSVA 1KBZA 1QKIA 3OJFA 3N74A 4JGBA 3OQ6A 1IL0A 2PZKA 4FS3A 4CMBA 1NPYA 5CP8A 2EP7A 5TT1A 2NVWA 2WEKA 3RUFA 5H82A 4K26A 2C2YA 1PJ4A 1EQUA 3T7EA 4RF3A 4X54A 5DF1A 2Z5LA 3DB2A 3VHRA 1ZXBA 3JV7A 4ZQBA 4BNIA 1AN9A 4BO2A 4UVHA 3I5MA 3DL2A 3PVZA 3RVDA 1JTVA 1CEQA 1PJCA 1SZJG 3DQPA 3RASA 1PS0A 3SJUA 1T24A 5IXSA 4R69A 1Q7CA 2DUUA 5ITWA 1W6UA 3ONEA 2EP5A 5THKA 5KJ6A 5G4KB 1AXGA 1N7HA 3S2IA 4CLXA 3I9OA 3CXRA 1QLJA 3UH1A 1EVIA 4IZIA 5DZSA 3PWZA 5AXBA 3GNTA 5IXYA 3LYLA 5KWEA 1U3TA 1OC4A 2HMUA 2EKQA 1GD1O 2QX7A 4ZQGA 4FR5A 4TROA 3H3FA 3RSHA 3GHYA 3OP4A 3VDQA 1WNTA 1IPFA 1S6YA 5U1PA 4E21A 3O38A 2X5KO 3IKTA 1PJQA 4LW8A 1U4SA 3L4SO 1NNUA 2PWZA 1K2WA 2ZIZA 4INAA 4BL5A 4NHEA 4E30A 4IDEA 2GN8A 1P0FA 4FJ0A 1GUFA 2HK8A 2X1HA 3A1NA 4YTEA 4QUKA 3PRJA 1N8KA 2OHXA 1WWKA 2VCYA 5T64A 1ZSYA 4LVCA 4NIMA 4MVJH 3TL3A 1FDWA 4IUYA 3NT5A 4DYVA 1ZO8A 2GD1O 1YQDA 3NT4A 3PEFA 3G1TA 4H16A 4E0BA 1N1EA 3OICA 1T2FA 4J7UA 1S7CA 4KP7A 3AUTA 2DT5A 4Q3EA 6ADHA 2Y1GA 3WB9A 4BQRA 3GDOA 4IMRA 1J4AA 3U49A 3I6QA 4HFNA 5DNAA 3AI1A 4YJGA 4GQAA 5F1KA 4XRRA 4CM1A 4E5KA 1O6ZA 1QV6A 1PS9A 1PJ3A 4XWYA 4J1NA 3VTFA 3H2ZA 4LCJA 4TRRA 2HK7A 4J0FA 4RF2A 5L4LA 2VRCA 4YVFA 1NXQA 4B4UA 3NKLA 4U0KA 5G0WA 2VT3A 2P9CA 1HE3A 4NU5A 4NZ9A 4OL9A 5ENDA 1KS9A 4IJVA 4FDAA 5L51A 3ROKA 3TPCA 4I9NA 2VNSA 1O5IA 3ZNQA 1F8FA 3COSA 4B3JA 1U8FO 3PYMA 1ZK1A 1PS8A 3GZ4A 4ALKA 4DBVO 1CJCA 1ULUA 2V6BA 1JKFA 1OI7A 4I5GA 4BVAA 1U2DA 4TZTA 1SPXA 4J90A 1EVYA 2BFMA 2J5RA 4CR8A 2I3GA 1BG6A 1Y81A 3TL2A 3GF4A 1QMGA 2VTDA 1A27A 2X7HA 5CG1A 4DWVA 5JLAA 5JMWA 4UVDA 1ID1A 3ZWNA 4HKTA 3U62A 3IJPA 3UOGA 5DBIA 3BMNA 5L7WA 4K6CA 1Z75A 4PVDA 1Y9AA 4GKBA 5FWNA 3JQAB 3I3OA 4BMVA 1K6XA 3A28A 4PN3A 1LC3A 4Q3NA 5JPIA 2CMDA 5LDHA 4IGFA 4RVFA 3ITDA 2OORA 5CPBA 2ET6A 4OH1A 3K2BA 2Q50A 2QRJA 4WLUA 4Z9XA 3VVCA 4B8ZA 4JK3A 1JVSA 3OSUA 4RVGA 4XEHA 2VN8A 4ZA2A 4CM8B 5COBA 1O8CA 1SMKA 3JD4A 1AXEA 2R00C 4AJLA 1QYWA 5L40A 1YB4A 4BGIA 2FP4A 1H2BA 2GPTA 3MOGA 3WLFA 1EBUA 1GFSA 3ZCXA 4DC0A 4D79A 1K6JA 4BGUA 2FPPA 3TZCA 2ZTVA 1EMDA 3GLQA 5FYDA 2YYYA 1I2CA 4W7HA 4ILKA 5F1OA 2LDXA 3I9KA 3PDUA 1FJHA 1NPTO 2VZ0A 3ZHZA 1LSOA 1P0CA 2D59A 2NWQA 3CH6A 5IN4A 2VHZA 4D0SA 2HU2A 2BLLA 1B26A 5LC1A 1C0LA 2V65A 4ALJA 4IY1A 4HNHA 4MKRA 4AVYA 1O89A 2HKIA 2EHDA 3FR8A 4PGFA 2X4GA 5KVVA 1X1EA 2IZ0A 2EJVA 4Z3DA 5C5IA 3HB5X 5HWSA 4JP2A 1DFGA 1SB8A 3JQEA 2NTJA 3VPHA 2OP0A 1ULSA 4FJ1A 1E3SA 1H93A 4IXWA 4WCFB 1LU9A 4XB2A 3ZWCA 2HJRA 3TWOA 1C1XA 1V9LA 3TZHA 3GGOA 7ADHA 4QTZA 3GEDA 3PLNA 5LCXA 5A4DA 4TRMA 3SVTA 3QQPA 4XR9A 1KETA 3QWAA 1B3BA 1TVEA 1I36A 1VJ0A 1W73A 3VPGA 1Y8RB 1P31A 2Q4EA 4LISA 5KIAA 1OOEA 2HMTA 1P1RA 4YAGA 2OBNA 4W9NC 1IULA 5TIIA 3DBHB 1MLDA 4FD3A 4LMPA 4KUEA 2AA3A 4NQZA 4H7PA 1PZHA 3DDNA 1DHRA 4I9HA 1T4BA 3JQGB 4L76A 2G76A 4BO1A 2C59A 4W82A 3NEPX 2QQ5A 3R3JA 3O8QB 2VT2A 5JXWA 1NBOA 1HF3A 3F9IA 1WVGA 2J3HA 3E9MA 4OMUA 2XXJA 5JW6A 5C7LO 2JFFA 5F1PA 3JQ8A 1LC0A 1ISFA 3LT4A 4TMFA 5T57A 3DBRA 4HBGA 1GAEO 2TMDA 3O03A 2V6FA 4P8RA 4U6SA 4CLRB 4UUPA 5DCUA 5CEFA 4ZVVA 3PZBA 1HWYA 2V6MA 1I2BA 1OFGA 4CM3A 4ONEA 1ZMTA 1ZH8A 3GQVA 7MDHA 1MXHA 1R0KA 3ROPA 2TMGA 4I5FA 3WGOA 3WXBA 1HE5A 4YRBA 2EXXA 5DBFA 1YDWA 4DGSA 4CV1A 2Z95A 4DXHA 3KSZO 1U8XX 2W2KB 4BO4A 3SX2A 3DFZA 4WLOA 4WLFA 1XWFA 1V8BA 5AXDA 4YJGB 3DMYA 1R0LA 1JAYA 2VZ8A 4GVLA 5BNFA 4B79A 2OO5A 3UAGA 5IDYA 4ALNA 4ND1A 4AJJA 4TKMA 3DAFA 3R3SA 1MP0A 4R9SA 4WJZA 3ST7A 1P1FA 4PLPA 4CUKA 4CV3A 5L53A 1KERA 5L7YA 3S8MA 3P5SA 3GRPA 1A72A 2Q4BA 3WJ7A 3OHSX 1I01A 1YVEI 1ZXLA 3K6JA 2DAPA 4DREA 3W4IA 3G17A 3RBZA 4CODB 3MJEA 5EL0A 3QWBA 2WJPA 4BNVA 4CMAA 1V3VA 3ASVA 3JQ8B 5TC4A 2AE1A 3BZUA 5I7EA 5U9CA 3RC7A 3I9MA 4D7AA 3K2EA 4GMFA 1P33A 3AOEC 2DLDA 2R6JA 3JYLA 5JCXA 3AY3A 4BNFA 4AL4A 5K6AC 4E5MA 4ALLA 4K9DA 3GRKA 3CSDA 4PLYA 1NTOA 4AJNA 3H9GA 4LRTB 3LC1O 3AM3A 1QR6A 4JCOA 3E9QA 3KXDA 2O4CA 4L74A 1DRWA 1WW8A 5DBGA 1LSUA 3FNGA 2BF7A 4NJMB 3LSYA 4PZEA 5JCJD 3D5TA 1JLLA 1NQ5A 2AEJA 3GUCA 3HDHA 4XQEA 1J49A 2BGMA 4BO3A 1Q0QA 4BNZA 1T2CA 4NK4A 5ICMA 4U6QA 4E2WA 4XKJA 2BHLA 3I52A 4WK6A 3QRWA 5TJHA 1YXMA 5DULA 1R4NB 4MVJI 4OKNA 2EW2A 3TZQA 5C7OO 3WSVA 1DJQA 3GH3A 2X9GA 2B36A 1DIGA 3B20A 1VKNA 4C7JA 2DM6A 1EUDA 2VZ9A 4BNJA 4J1SA 4MJLA 3PJDA 2JHFA 2WYUA 3LC2O 1ZZEA 1GQYA 4J49A 4WOKA 3DBLB 3KOUA 1U3WA 5A3VA 2PFGA 3NDRA 2B83A 4ALIA 2B5WA 3I9NA 3A14A 2NVBA 3IC5A 4F46A 4NG5A 1YQXA 3TN7A 2IZZA 2CDAA 2OOSA 2ZCUA 4UUMA 1YONA 1P1KA 3AJRA 3M2PA 5I7FA 1LLDA 1N9GA 4YJHB 3GN1A 1U2GA 3NGLA 4BGEA 3BIOA 3RFXA 4NDNE 4J6FA 4ITUA 4OSOA 1LA2A 1LX6A 2J8ZA 3MWEB 5JMPA 1L1FA 4DQXA 2PKRA 3PGJA 3BMOA 3EC7A 1Z82A 3VZPA 5CDSA 4XIJA 3VZQA 1PWXA 3F46A 2V6GA 4WPGA 1WXDA 4EYEA 3EK2A 1P1IA 3LT1A 4G5HA 2Y68A 4J43A 3LF2A 4J0EA 2IYPA 4TVOA 3OJLA 4GSKA 1XCBA 1KEPA 3TDKA 1KIFA 1ZFNA 3D0OA 2JHGA 5JDCC 2X5JO 1D1TA 3IOYA 2B0JA 4CM9A 4IS2A 2XAAA 1RM0A 3L6DA 4E2ZA 4E31A 4IIVA 2CF6A 2WTBA 3VH4A 2GZ2A 5GY7A 4CLEA 2AQKA 3UFXA 2ILTA 3H3JA 4ZQEA 4BGVA 1XU7A 4Y6PA 1B14A 2O3UA 1T26A 3C1OA 5HS4A 3KZVA 3ANLA 1G1AA 1LQUA 3CIFA 2J3IA 5TLSA 1VL6A 3GG9A 4NBVA 3GA0A 3GVIA 5K0ZA 2IE0A 5ENVA 2QZZA 4PLTA 1Y8RA 3OMLA 1JWBB 4JJIA 2AG5A 2HRBA 3JYPA 4PIVA 2O3TA 2OXIA 3V8BA 1PJBA 2GN6A 3KVOA 4TKLA 5HA5A 3VDRA 2NU8A 5I8ZA 4CPDA 2Q1WA 5EINA 2EGGA 3RQSA 1T25A 3PTZA 3WMXA 1TT5A 1NVGA 4KQWA 1N9GB 2Y93A 4YJHA 4E2XA 3FN4A 3U09A 1MC5A 1XQ1A 3U4HA 5I9LA 3HN7A 3S2EA 4JJFA 3KYCB 1M6WA 4DQVA 4P22A 4A5OA 2PH5A 4WASA 3BYZA 4GX5A 2F1KA 4ALMA 3TQHA 3FNEA 2Q99A 4AJKA 1OZAA 5KTKA 4R5MA 4CR6A 3GFGA 5FF9A 3KB6A 1N1GA 2BI8A 3NRCA 2G0TA 5EMHA 3E03A 4R3NA 2FPGA 2FRDA 3A06A 4JX8A 3GG2A 1VPDA 3RI3A 3OA0A 5HBRA 3DMTA 4GLLA 4ZRNA 5FI5A 4MVJD 3WYEA 1P3DA 3QVOA 1JN0A 3QLJA 3NJ8A 1EVJA 2X6TA 4URFA 4CUJA 5JNLA 2GLXA 3HDYA 3ZI0A 3FF4A 4JROA 1ZUD1 1ENOA 1DBVO 3P2YA 1X7HA 2EF1A 4CJXA 5CDUA 2E6UX 3OH8A 3PJFA 2IDZA 2ZYGA 4RDHA 4Z0TA 2C7GA 2VHXA 5CDYA 1XLTA 3WTBA 4W6ZA 4TSKA 2ZTLA 3ZWPA 1UZMA 2IRWA 4RLHA 3IDSA 5KNLA 1G6KA 5AQ1A 1ZEJA 3WBFA 3TFQA 4IMPA 5FEUA 4RPKA 2UVDA 4D41A 3ETEA 3PYXA 3GVXA 4OQYA 4U8GA 2QRKA 2Y1OA 1BTOA 3WGHA 1UAYA 2C82A 4B3IA 4PLCA 4XRGA 4W99A 3GZNB 1P45A 2A9FA 3PYLA 4ND2A 3NTOA 2R00A 3BHIA 3ZHBA 4EITA 3RJ9A 3C7AA 1RM5A 2AE2A 2BFPA 3C8MA 3KYCA 1K3TA 1RM3A 3QVSA 3VPSA 4IDDA 3WYCA 5A3JA 2X8LA 4UVGA 4FJ2A 2RAFA 5F3RA 3WQSB 2CFCA 2D5CA 3ORFA 4JNKA 4MIOA 4O59O 5T5QA 4BO5A 5MGBA 1N5DA 1QP8A 2AEFA 4QFCA 4A27A 1E7WA 4FFPA 3AW9A 1CQJA 4QQRA 1D8AA 4AFNA 2P9GA 2J5KA 4R51A 5CDGA 2H6EA 2IODA 5KCZA 3STHA 3I6IA 5L3ZA 4B4OA 3W4JA 3HZZA 5H83A 4P4NA 5IFLA 1I3MA 2DTXA 3V2HA 3HDJA 4RF5A 1C1XB 1E92A 1Z73A 3DC2A 1UXHA 4E12A 4JQCA 1NM5A 4ZN6A 1UP6A 1XSEA 2PKQO 4J91A 3FR7A 2Q1UA 2GZ3A 1WPQA 1Y6JA 4N5MA 1IHXA 1JW9B 1HZZA 1MGOA 3JTMA 4L0QA 4OQZA 1C1DA 4R1TA 3ZNNA 3GDFA 2ZQYA 3JD1A 5A03A 1KEWA 3FPCA 4H3VA 2HRZA 3CMCO 4YA6A 1F0YA 3ZV6A 4DBZA 3BTSA 8LDHA 2HMSA 4BO0A 4PVCA 2NTVA 3GZNA 3JD3A 1X14A 4W7IA 4OXYA 2B37A 1NFQA 3JD0A 2FSSA 4WLVA 3H9QA 2Q45A 3LT0A 4XJTA 3RKRA 3ZV3A 1H5QA 3ZGYA 2NQ8A 3JQAD 2GCGA 4XDYA 2J5QA 3P7MA 3VPFA 5K9ZA 1VE9A 2POQX 1P77A 2O50A 3KYDA 3DBRB 4DLLA 3WQRA 1GYQA 2JFHA 3ADOA 3EMKA 5EN4A 4CL8A 2DVMA 3WR5A 3DMTC 3HG7A 2D3TA 2VYND 2ZB8A 3ITKA 3QIVA 1R4MB 1VC2A 2ZYDA 5JO0A 3LU1A 4J7CA 2PGDA 2PZMA 3DFUA 1WMBA 4D3DA 1Z7BA 5IZ4A 2YDXA 4YEDA 5I9MA 3ABIA 4MIYA 4Z6KA 3QVWA 2Y05A 2GR9A 4NBWA 1I3KA 4FIZA 4L73A 1JKIA 3JYNA 1NFRA 1Z74A 4IQ0A 4UVEA 3UW3A 5A05A 4CL3A 3UICA 5A06A 1LDNA 1E0DA 1V0JA 1YS4A 2EKPA 1D4FA 3W8DA 5KKCA 3M1AA 4J4BA 3JD2A 5JY1A 3QJ5A 4O0LA 4UVIA 5CAEA 1QSGA 3K96A 4YQZA 3ETGA 3KHUA 4HWKA 1LNQA 5JE8A 1U5CA 3H5AA 2Y1FA 3VZSA 3FNHA 3RU9A 2I5PO 2W2LD 1RJWA 2JCYA 4QXMA 1GV1A 5F5LA 3FI9A 3S1LA 2R2GA 5MDHA 4BNUA 2VYNA 3GMDA 2HLPA 3BHMA 2EERA 1GEGA 1GQQA 3FNFA 1P9LA 3ONDA 2I6TA 4FN4A 2LDBA 4RORA 4E2YA 4PG4A 2PH3A 3C3XA 2YDYA 1P1HA 4BNLA 4IDBA 1Y8QB 4R3WA 1TT7A 2I66A 5A1TA 5BSEA 2PD6A 5DP1A 2WWRA 2B4RO 3JQCA 4GGOA 3BTVA 3MJSA 3FPLA 3RUCA 1XA0A 4RZHA 1FDVA 2B4QA 1C14A 1Y9EA 2B35A 3L0DA 5ITVA 4XJSA 4IDFA 4YB8A 3T7CA 1HKUA 2DBRA 2AMFA 1K6IA 3ZWYA 1UAGA 5T8KA 2GUGA 3WBBA 1EQ2A 5I7VA 1MC4A 2WE7A 4W4TA 4QECA 3MOIA 1DFIA 1J5PA 2BH9A 2JKVA 1M75A 2VWHA 4FFRA 2Y1DA 3GPDG 4TWRA 3AUAA 2YFHA 4ZHSA 5ADHA 1MG0A 1C3VA 4QO8A 3INTA 3WX0A 1YB1A 3MJTA 5BSHA 2Y66A 4Q3BA 4I5EA 1TB4A 1FMCA 2YW9A 3I4FA 2AQ8A 4DLAA 3IMFA 3INRA 3QWFA 4LK3A 1J6UA 4RO0A 3AM4A 3PPIA 4YT8A 2BKAA 3ADPA 3FBGA 2VTEA 3EW7A 5JDIC 1GZ6A 3KLMX 4E32A 4Z3KA 4RL6A 3RJ5A 3PGXA 1PEDA 1GZ4A 3Q2IA 4WEQA 2JCVA 5DCYA 3GNQA 2XPCA 2NM0A 3VH1A 3MTGA 3TZ6A 2EIHA 4YXFA 4I8XA 1XDWA 4YT4A 1LDBA 2G1UA 2O3SA 2ZB3A 5EERA 4DIBA 5A04A 3LF1A 3U5TA 4DL9A 4ZGWA 2PV7A 3BMOB 2C5EA 4NFHA 4M49A 3H5NA 1U28A 4RVSA 3WS7A 4I5DA 3PWSA 3G3EA 4RDIA 4S3MA 4CMIB 1UUFA 2FZWA 4ZU3A 4WEOA 1YKFA 3VPXA 2H9IA 4A2CA 5HS6A 1ENYA 3RWBA 1GQ2A 3IUPA 4NK5A 4WCDA 3OIGA 4OAQA 2D2IA 3PDJA 1B8UA 3GHHA 4G2NA 3K30A 4PG7A 4EJMA 4YYZA 5JC1A 4P38A 4FC7A 1T2EA 1EUZA 2NU9A 4CR7A 1BHSA 4E5PA 5IAAA 3AUUA 5EIOA 4QEDA 1ADBA 4AJOA 1D1SA 2Q1TA 3C7DB 2CSUA 4UULA 3FWZA 3EZYA 1PL6A 3PIIA 3DZFA 1EDOA 4WLEA 2GO1A 1DDOA 4CQMD 1ADCA 3HNPA 4G65A 1A4IA 4XYMA 5JCJA 4R54A 5CPFA 4O5OA 4J7XA 1R37A 4DC1A 5B12A 5C7IO 4IDCA 4BO6A 2WYVA 3OFSA 4DUPA 4MP8A 2BFAA 3D3WB 2VOEA 5KJ1A 2GN9A 3TJRA 5CEJA 3PK0A 2OGUA 2BFOA 3L4BA 2F00A 3E1KA 3UVEA 1FF9A 1R6DA 1TT5B 1KYQA 4XGNA 4NBUA 3AUSA 4EUEA 2Q1SA 3K92A 2UUOA 5IF3A 2X0IA 4XYEA 2PZJA 3JQDA 2QYSA 4DVJA 4E13A 1L7EA 5BR7A 1GYPA 1OMOA 1HDGO 4XZ3A 1HSOA 4O1MA 2DUWA 3ZW8A 4E6PA 3WICA 2NTNA 1ADFA 4CMIA 4PLGA 1NAHA 1JQBA 3ZZNA 2E37A 1U7HA 4O6VA 4BKUA 4XYBA 1YH3A 4M86A 2PD4A 4BNTA 1Z45A 2FHSA 2H63A 4RZIA 4IIUA 4BNHA 2FR1A 4BQPA 2AW5A 2PGJA 3OETA 4R5HA 3HFGA 3DEYX 5I9NA 1K0UA 1LLCA 1M6HA 4FFLA 3K5PA 4F45A 4WCFA 3W1VA 4D42A 1YBVA 3BA1A 4WUVA 1PSDA 4MVJF 4XD2A 1VL8A 1F12A 3R0IA 4J9UE 3PJGA 3AI3A 1SOVA 3OIFA 3KEOA 1GPJA 3KBOA 3GK3A 5AOVA 5KJEA 1PR9A 4DYDA 4PG8A 2OUIA 2FZEA 3UXYA 1WZIA 3QE3A 4PLHA 3WWYA 1B8PA 1ZK3A 2NU7A 2O7SA 5IDQA 3CTMA 5JYDA 1E7RA 4K28A 5DN9A 1UDCA 3OF2A 2Q2VA 2PD3A 3ZWMA 2YQ5A 5A9SA 4OOFA 1EDZA 1NR1A 1PQUA 4KMSA 3UKOA 4B7XA 5B4VA 4NU6A 4U7WA 3RROA 4FOSA 3W8FA 3C1TA 4YPOA 3VVBA 5KVSA 2O48X 3PHLA 1E1LA 4P4LA 1X15A 2ZKLA 4OKIA 3DBVO 5IDWA 1J0XO 4JP3A 3ROMA 2PA3A 3S2GA 3NUGA 3EUWA 1R15A 4GKVA 1BVUA 3KYBA 4YDRA 1SNYA 2JFGA 1PZGA 1YJQA 1I8TA 1CETA 1PL7A 2EGHA 3MZ0A 4Q9NA 1ARZA 2HK9A 2P5UA 1LI4A 5A5EA 2JL1A 1I3LA 3EAGA 1KEUA 2FR8A 2OFPA 1KY4A 3BXXA 2RHRA 4TVBA 4MVJG 5A5FA 4IDAA 4D44A 3UN1A 2W2KA 5JFOA 4GGPA 3F3SA 1PGNA 3K8ZA 1E3WB 3SLKA 3RC9A 4GH5A 3NV9A 2FN7A 1XU9A 4CM5A 1LTHR 3L6EA 3ZV5A 3QA9A 4RPHA 1NASA 1KVQA 1SAYA 1E3JA 2X9NA 3LDHA 2C29D 3RUDA 1C1DB 4Y6SA 3DOCA 3ZU4A 4XQCA 3HE3A 1HE4A 4MDHA 1YRLA 3W6ZA 5JBIA 3OIDA 4OJNA 1ZJZA 3IJRA 1U4OA 1HLPA 1LLUA 1A5ZA 4CV2A 3DWFA 2NACA 3GEMA 1VI2A 3KUXA 4N5LA 1KOLA 3KSUA 4HP8A 5EJ2A 2HMVA 3RC2A 2PKQP 1SO8A 4ND4A 3H65A 2XOXA 3RFTA 5TQVA 1Y5RA 4MKZA 3F4BA 5B4UA 4IJKA 3OM9A 3RKUA 1KVUA 4CQLA 1P74A 3ZU5A 1KC3A 5KOIA 3MWDB 1F17A 1A9ZA 1B8VA 3RAJA 3VAZA 3ZWAA 2D5AA 2B69A 3U4CA 5JS6A 2DQ4A 3DZKA 4J3FA 1VLLA 4EUHA 1E3IA 2DBQA 1U7TA 2C7VA 2J3JA 2CVOA 4ROSA 3FD8A 1XHLA 4WGGA 5CDTA 2NSDA 1R0SA 3KO8A 4JBGA 3E82A 3WGYA 1R4MA 2BRUA 2O7QA 1YL7A 1EBFA 4A03A 3HDQA 2DKNA 2VRCD 1XGKA 2WM3A 4M55A 3S2FA 1ISIA 1IYZA 1GV0A 2C54A 4UEJA 3E5MA 1K89A 4MINA 4PLZA 1QG6A 2PTGA 4RCVA 5B37A 1HT0A 1ZKMA 3CPSA 4RJTA 2X0JA 5KVCA 4TRNA 4KDFA 1ZK0A 3Q0EA 1BW9A 3Q3CA 4FFMA 1YGYA 4M87A 4WOJA 1UJMA 1YBAA 4I08A 1LUAA 1KVRA 2P9EA 4ZRMA 3L07A 4NR0A 1NQOA 4J2OA 1R4NA 3ONFA 1NAIA 1ZJYA 2ZATA 3EVNA 3HFSA 4BNXA 5AXAA 2NQTA 5JY6A 1K5HA 1XEAA 2VUUA 4YACA 1PX0A 4QO7A 5LDGA 9LDTA 2CY0A 1LRKA 2I3AA 1OC2A 3SEFA 5ILOA 4B8WA 2AEMA 2W90A 1P1JA 1MXFA 1CF2O 4ZJUA 3ZU2A 1UZNA 1ONOA 2Z1MA 4BMNA 1HEUA 2GGSA 5AYVA 4F3YA 1EZ4A 3DZIA 1MFZA 2Y99A 2W98A 5J23A 4WNCA 1I30A 1DRVA 3H4VA 1IZ0A 1BXGA 3E9NA 1AUPA 4N5NA 1LDMA 1W0CA 2BGLA 5JAMA 3RUAA 1UXGA 2Z1NA 3RBXA 1ZCJA 3QV1A 5H81A 2CDBA 4OSPA 4WCFC 2D0IA 2WD8A 4UEOA 4CLHA 4ID9A 2PNFA 3GMSA 2X0RA 5T67A 4HY3A 4D3SA 2C2XA 3ZWBA 4IDGA 5JAIA 4N18A 4PG5A 5L4NA 3DZBA 1XQ6A 1KY5A 1ZVMA 3WQQA 2H5LA 2OP1A 3OJ0A 5L45A 4II3A 3DTYA 1KEVA 1TLTA 3Q9NA 3CZRA 4GX0A 1HTBA 4ZD6A 1DAOA 2ZCVA 4DQUA 3SBOA 3I9LA 4MP3A 3FSRA 2HDHA 4H15A 1UP7A 3D4PA 3IS3A 3UHAA 1UP4A 5G0UA 3IP1A 1DIBA 5DP2A 5L7TA 4N54A 3KLPX 4YRAA 2GDZA 4GLOA 3GR6A 1H0KA 3V1TC 1EFKA 1G0NA 3L4BC 2BMAA 3H6KA 2C0CA 4GWGA 5COAA 4RV9A 3PFWO 5L9AA 1E3EA 4B4WA 4E4YA 4M54A 1HYEA 4GI2A 2VOJA 3IKVA 4P4GA 3PHGA 2X9VA 4A10A 2VRBA 4AG3A 3JQBC 4YJDA 1FXSA 1T2AA 2WSBA 5JDIA 4R16A 3HJAA 3DHEA 5JAZA 4XX0A 1XIVA 3AK4A 1XG5A 1BXGB 4DLBA 1U3UA 4DA9A 3PQEA 2W8ZA 4EEXA 3JSAA 4I1IA 5U4QA 1JAXA 1NWCA 1EVZA 4IZHA 1YL6A 1YO6A 3BMQA 1GDHA 2FR0A 2RHCA 1JDJA 2G17A 1WDMA 2YHIB 1HDXA 1VJTA 4IGEA 4BHTA 4B3HA 3LLSA 2E48A 4FFNA 1DOHA 5G2OA 3L9XA 2DC1A 1DC5A 3E18A 3HADA 5T8KC 4WECA 1X7DA 1BDMA 1H6BA 2QIOA 3CE6A 1NYTA 1NVMB 1Y5MA 4MVJE 1O95A 4E3ZA 3F5SA 4WNIA 2HCTA 2QZ9A 3OQ1A 4IQGA 5K6AA 1D7OA 4BB5A 1B3RA 1DIAA 3QP9A 4YBZA 2DBZA 1SBYA 5TNXA 1PJLA 4OXNA 3TFOA 3PZRA 4XR4A 5ICSA 3GDGA 3B6ZA 1M66A 3SJ7A 4Q39A 4AJ1A 5CFZA 3U3XA 3E5RA 2EEZA 4GMGA 3F1LA 1Q7BA 4M1QA 1U5AA 4XQ9A 1EUCA 4AJPA 1CYDA 3NT2A 4BNMA 3GNSA 1YE3A 3MJVA 3GC6A 3CKYA 1X1TA 1E7YA 9LDBA 3RIHA 3DZHA 2QW8A 5TX7A 3PJEA 1ZK2A 3AU8A 2YV1A 5KJCA 2IEDA 2X0NA 1LDGA 1ZK4A 3QW2A 3FRJA 5BNTA 1IPEA 1HDYA 5COQA 3TZKA 3GPIA 3IP3A 3C7CB 4RF4A 2NUAA 2I9PA 1MB4A 3AFNA 3X2FA 2VHYA 3UCEA 4OM8A 2A4KA 2GASA 2YHIA 4A73A 4CUZA 4N7RA 2G82A 4A7PA 1BXKA 4LGVA 2CDCA 4AJ2A 3ROQA 2HO5A 2O2YA 1A9YA 1HXHA 3AU9A 4PZDA 2ZYAA 4MVJM 5F5NA 1QORA 2GNAA 3RD5A 4CQMA 1EE9A 4EJ0A 4TRJA 3K9QO 2Q46A 1ZNQO 2VWPA 4HFJA 1DLIA 1F8GA 2O4UX 4ZICA 3U4DA 3B70A 4R1NA 3RUHA 3MTJA 2X86A 4BKOA 1GCOA 3WGTA 1MUUA 3KSDO 3C85A 1Q0LA 3G49A 3RUIA 3N7UA 1PWZA 4F6LA 4HUJA 1BW9B 1RKXA 1U9JA 4FGWA 4I9UA 3WOHA 3ZDFA 5BSGA 4PRKA 2RCYA 1E1NA 5BQFA 3DO5A 2YFQA 4FPXA 2AQHA 2X22A 3ICCA 4HFRA 4Y98A 3WG9A 1MFPA 2ZJ1A 5DOVA 3BTOA 3DZJA 4W9NA 4EUFA 1FK8A 1I5RA 3EGOA 5G4KA 3Q1LA 2AXQA 3H5RA 4IS3A 2O3QA 3RUEA 8ADHA 3C1AA 3QSGA 3GGGA 2G5CA 4YT5A 3HHPA 3ICPA 1ENZA 2GRAA 3WMWA 1I0ZA 3BHJA 4UREA 4RVDA 4Z9YA 4DIOA 3L6OO 4OOEA 1TA4A 4R01A 4E33A 1LBEA 4MOWA 2DFVA 4RPJA 1A71A 2CUKA 2PZLA 3KYDB 3NDJA 1JVBA 2PGLA 2DU8A 4ND5A 1X0VA 3JCZA 2UAGA 3PFFA 1M76A 4EZBA 3M6IA 5ER9A 4KZPA 3NDIA 1LSSA 5BSFA 5L4SA 3L77A 4CM4A 3BTUA 3P2OA 3WTCA 4IXTA 3D1LA 1ZSVA 2GYYA 2XXBA 5BNIA 2IXAA 4RLSA 2NLOA 5JYEA 4GX1A 3GEGA 4KQXA 1XYGA 4CLOA 3JQFA 1E3WA 1LSJA 2PY6A 3LZ6A 4KTVE 4LMRA 3VKVA 4MIEA 3RCBA 2YJZA 5T6BA 4XQGA 5IDXA 2VQ3A 3H2SA 1PJSA 4GWKA 4Z9FA 5CG2A 2PK3A 3H7AA 5DCWA 2NV6A 1IOLA 1WAMA 3QVTA 3D3EA 4PLWA 1VSUA 1F14A 4QFDA 4IM7A 1PIWA 2C07A 2VWGA 2FY8A 3NX4A 4EW6A 3TSCA 5L95A 3GAFA 1JKJA 2EW8A 5IZCA 3KETA 3CZMA 5JO9A 1CQIA 2GN4A 2X23A 1B0AA 3X2EA 3D4NA 1DFHA 2DBVO 4CQLB 1O94A 1I33A 1X0XA 3HB4X 1DB3A 4Y67A 3RU7A 1JWAB 4L9RA 3DZGA 4EEZA 4HX5A 4MO2A 3MJCA 4HNGA 5ES3A 2E4AA 2DTDA 1Y8QA 1W4ZA 3GVCA 5A02A 1VJ1A 1EE2A 1ZIDA 4LCEA 3WFIA 5IJZA 4J2HA 4QX6A 4GPD1 1U1IA 1TXGA 2Q3EA 4K1LA 3NTRA 1PGOA 3PI7A 2D4AA 1ENPA 4CMGA 4OYRA 1H6DA 4FQ8A 2IEBA 4PLVA 4XB1A 3B1FA 1YBMA 3GOHA 5KJFA 4GVXA 2VUTA 4Y6RA 1E6WA 4XCVA 2JAPA 1F06A 4C4OA 3K73O 5EQDA 2P4HX 3ETDA 1ZEMA 4Q3CA 3F1KA 3DHYA 5TF4A 4XYGA 1ORRA 4BUCA 1ADGA 2VHVA 4EGFA 5BT9A 2H1SA 1RYEA 2CVQA 3WLEA 5IN5A 3ZWOA 4DRYA 1AGNA 1PJ2A 2Y67A 2OL4A 2HQ1A 4FW8A 3DTTA 3ZWXA 4D46A 4DIFA 4BNGA 2ZK7A 3GY0A 5JAQA 4RPGA 4LSMA 2JJYA 3OQBA 1QYCA 3H9UA 3QVXA 1E6UA 4PFJA 4TZKA 1LLQA 4DMLA 3WGIA 1TI7A 4RQUA 3VKUA 4KDEA 4CMHA 2Q49A 3DOJA 4KTTE 2I67A 3TOZA 1QXSA 4OHUA 2CVZA 1E6EA 4OO3A 2QRLA 1I3NA 2YHUA 3DR3A 3U9LA 2WE8A 3I83A 1NP3A 2GSDA 3A9WA 4WKGA 4R9RA 1HRDA 1NWHA 1M67A 5ER6A 2O2SA 4KUHA 4R4JA 4WLNA 4OIMA 1HDOA 4MKXA 2YQ4A 1HL3A 4A26A 2E49A 3DONA 1SB9A 3AOGA 4DTIA 4RPLA 2Y1EA 1VSVA 1HSZA 1O9BA 2I76A 3ASUA 1H2HA 1JU9A 3DAGA 3TNLA 5JDCA 4HFMA 3NYWA 2UUPA 4NFYA 1RPNA 2FWMX 4QSMA 4F6CA 1RWBA 3F47A 1Y7TA 4Q3AA 3VOSA 3F5QA 5HM8A 2PLAA 4DPKA 2AHRA 2HSDA 3EVTA 4LSWA 4PZCA 4YQYA 3SLGA 3ZWVA 4BNWA 3PIDA 2VHWA 2VYVD 2YUTA 2VUSA 2GF2A 1KVTA 3ZU3A 1PGPA 4BV9A 2EWMA 1E7QA 5TGDA 3AM5A 3IL2A 1V35A 4PLFA 4J4HA 1IUKA 2CD9A 2ZTUA 5G4LA 1E5LA 1B7GO 2QG4A 1MV8A 4Z0PA 3AFMA 1E7MA 1R16A 1M2WA 2JAHA 4Q3DA 1GCUA 2ZTMA 4BO9A 3ZV4A 1ISGA 1A4UA 3AY7A 3KV3O 2E82A 4D3FA 4E5NA 3D3WA 4YR9A 1YDEA 1TEHA 3JQ6A 3C24A 3S55A 3ZNPA 3UCXA 3JQBA 1FDUA 3KM0A 5TSDA 3M2TA 3EYWA 3KTDA 1RM4A 3DBHA 1I24A 3ZN2A 1HE2A 2A35A 4AICA 1EK6A 3FHLA 5G0VA 4JN6B 1YOVB 4A0SA 1EK5A 2P4QA 4KUGA 1WDKA 3TOXA 5I7SA 3JQGA 3P19A 2GZ1A 1R66A 2DPHA 1WDLA 3V2UA 4KOAA 1HDRA 1E1MA 3O8QA 3I1JA 3TRIA 1NPDA 3RBVA 2FOIA 2V7PA 4RGBA 3LT2A 4IINA 1PGQA 3G79A 3N58A 4R1SA 4Y9DA 2Q2WA 3Q9UA 1HETA 1A7AA 1OBFO 1FDTA 4YAJA 3PHHA 3BMCB 1WMAA 1C0PA 6LDHA 4EJ6A 1ISJA 1HYGA 1LEHA 3IIEA 5C37A 4R41A 5B1YA 1LDYA 1H9AA 4XGKA 1NVTA 3DXFA 1P44A 4JLWA 1B16A 4CLDA 1GADO 3I9JA 4GSLA 1GZ3A 3GVPA 3JQ7B 4M8SA 3F6YA 4BKPA 1BVRA 3ENNA 4CLOB 3JYOA 4ZQHA 1BDBA 2IYOA 3AOEA 5TT0A 5AVOA 1UDBA 1NR7A 3QHAA 1AHHA 3ZWWA 2YV3A 1ZMOA 2CF5A 2WDZA 2P91A 3E48A 1LRLA 3H8VA 3ULKA 4AJ4A 4PCVA 2WMDA 5FFFA 1PZEA
chains in the Genus database with same CATH superfamily
1G42A 3BIFA 3J80Z 3HKZN 2DFDA 2F5VA 3FTCA 2VYFA 5DHSA 4BB9A 2UU9B 3ASNH 1N0UA 1TJ4A 4ZKDA 2NUBA 3HACA 5A9SB 1K7SN 1BNCA 3D6AA 2XCRB 5H3CA 4KWHA 1FW6A 4M9SA 2KIQA 4DZJA 3K4BA 1NN1A 1MD0A 1RP1A 4OHYA 3RH0A 4R9UC 1O3QA 3ZCPA 4JBYA 5K3FA 1MJHA 1FVXA 2VJJA 1TFRA 4P82A 4F8JA 2YXNA 5DXFA 1HDZA 3FCOA 4CHUA 1XS9A 3I30X 1U3FA 3LO8A 2N1MA 1UXOA 4JL5A 1G8AA 1I10A 3UUWA 5I8WA 3AUKA 5F35A 5T7BA 1LRJA 4NLLA 1AK9A 3QU4A 4GBJA 1Y98A 3HXOA 5AONA 2QE7D 2FD5A 3K1NA 3O4RA 3LLVA 3OAAA 2IEZA 3B5JA 5B1EA 2C1ZA 3CINA 3D31A 3DBIA 2VLAA 4PDKA 1P7IA 1PNQA 2WT9A 3RYHA 3K6RA 2GN1A 4DZZA 1QYVA 5IEBA 5I3ZA 3I2IA 3DP7A 3F0CA 3V8KA 1QHSA 2CJYA 4H17A 5BUQA 2CL0X 2BGKA 2QK4A 2BHTA 4ZDJA 2OC6A 4XWGA 3GRCA 3S99A 2UDPA 3A3NA 3OECA 4HS9A 2O3JA 3C16C 5LUBA 4JI6B 3ASYA 2DX7A 3KKNA 4KXXA 2ZTSA 4TMTA 2GN0A 5ICEA 3GRFA 4X6UA 1DKMA 1Z2EA 3T4EA 1C0IA 5HKKD 4Y3OA 3MCVA 4AJIA 1IXRC 3E6CC 2QU8A 3S1NJ 2ZB7A 3IT3A 3JARB 4URWR 5EC8A 4DRZA 5JPCA 2FMLA 3ZQ6A 3QPDA 3R9XB 3D0KA 4OOIA 3U31A 1T43A 3WNVA 4B7ZA 2ZR7A 1XAHA 1VE7A 3P96A 4EVQA 2YIDA 3L0IB 2VQEB 5EP1A 1RC8A 4Y33A 2JVIA 4YAKA 1AURA 2ZPTX 4IG9A 1J97A 2R7VA 1KIMA 2NVUB 2EG9A 3PQ8A 3CRNA 2B5VA 1JEEA 4M0MA 4RAFA 4CM9D 4JX5A 5JWHA 3NAQA 3CCVI 2G4CA 3I01M 3EVFA 2SHKA 2MGQA 1JGSA 1E2EA 1RQNA 3FK7A 4TYPA 4CMJA 2OEPA 4NJMA 1T5TA 1IVNA 1P8JA 2GLOA 1GHCA 3ZEAA 1E9DA 1R5JA 3SC6A 5AVSA 5C34B 3LQFA 3GJ4A 3BRWA 2WYHA 3K9BA 4LN1A 4IYJA 3E58A 3AZPA 4RIHA 4UEKA 4YFVA 5DK4A 4BECA 5J4LA 5L51A 2QY9A 1ML3A 3QPAA 1N25A 1DSSG 1XKQA 2A14A 3TI9A 5EGOB 1CY0A 1DQYA 1JBQA 1J9GA 1GYRA 2B1JA 1QQIA 3WU1B 1VCOA 2C7BA 2JAQA 3FPGA 3GGSA 3K94A 1IC6A 4Z8YA 3ENVA 3SZUA 1PR6A 3T5DA 3W7VA 5HP4A 2AFIB 3D6MA 5KNDA 4PJMA 1G2HA 1LWOA 1NW5A 4KWIA 3WGGA 3PR2B 4QDUA 1C29B 1G66A 1BBYA 3OIQA 1GUDA 2D2VA 4MVJP 2ECCA 1UAAA 1DQSA 3I4CA 3BJEA 3I2FA 1XD8A 1ZINA 1QA6A 4MWSA 3UNXA 4PGMA 2CJJA 1SKAA 4OA8A 2RBGA 3BERA 1XT6A 4M8KA 1E8NA 2P4UA 4R1UA 2Q7XA 4YCLA 1C8KA 4IWXA 4LOHA 1RYDA 1J5EB 2E85A 3M9WA 3IEVA 3CKKA 2AV6A 4OINF 2PT6A 3GVHA 1QHHB 1YI8A 2FHPA 2VC0A 2XNDA 3HH8A 2WP0A 4IL6C 1UJ4A 4MCJA 1VRWA 1CQTA 2R8BA 3E3LA 4WK8F 4IV5A 4RENA 1JQ5A 3FMQA 4G8CA 5EIBD 5HTOA 3ND8A 1GPDG 1O58A 4XIIA 2XF6A 4ZQCB 2QKYA 2B1IA 2R7NA 1ORVA 4AS2A 3HL0A 3OE5A 1A2QA 2IBMA 5EOVA 2SCUA 1TWCJ 3ZJYA 4G94A 2VTBA 4RNCA 1SD5A 1OASA 4FZ5A 4KI7A 5AK5A 4Y7NJ 1NNEA 3MXTA 3ZMDA 5FQOA 5KNDH 1CIPA 1KAQA 3PWKA 3BEDA 1IG0A 2HBRA 3EOZA 4BNNA 3F4LA 5A4JA 1R10A 2UVPB 1FX0B 3FDZA 3TL6A 3PC4A 4MQFB 1NF3A 4MVJA 2NSYA 3OSZA 2B7BA 3JQAA 3NBQA 3ZHXA 5FPYA 2QTBA 3HOUJ 4FEAA 4TTQA 1M8FA 1FYVA 3SXPA 1EX1A 5ELMA 2CKMA 1C0WA 2YMPA 1L3CA 2QA5A 3OOEA 5FFNA 5KHAA 3GEZA 2NZUG 1E1KA 2IV7A 3WNCA 2GOXB 4DLKA 5BW5A 5C18A 1N33B 1NHGA 1DPGA 1GR0A 3HO6A 2IFTA 3H9JA 3L9WA 3NWPA 2ZSBA 1GUBA 2FMTA 3P94A 4YAIA 3GLVA 4IZZA 2HDDA 1J8FA 3I39X 1WRJA 4FC6A 5J63A 2PNJA 3T1TA 1B00A 4JYCA 2IZ5A 3LJKA 5HOQA 2O8EA 3RSGA 3ACDA 2DTEA 1CQIB 1I4EB 1BJKA 1HDCA 2JT1A 1PKXA 2LMDA 2PMCA 1FXWF 2RGYA 1ZS9A 3D3NA 3QY9A 4M9RA 3WB1A 2J3LA 4CI9A 4B3GA 5FB2A 3C5WP 1DQPA 4P93A 4EB3A 2ZMEC 2RGNC 4AROA 1U80A 3O1HB 1UPAA 4BKQA 1XDZA 4OLJA 1K1EA 2CEAA 3S2WA 3GBSA 3MM4A 1QF7A 4MV4A 3X2SA 1KJ8A 1U0GA 1GTMA 1M1YE 3GEBA 4P7GA 1YOVA 3T5GA 3PEEA 2VP0A 3CEAA 2IXBA 3QKRB 5EKSA 2Y2ZA 2P0AA 2X1VA 4AMZA 3MB8A 4RTQA 1UODA 3A02A 2QHXA 1RMYA 1VIVA 1EWQA 1LDEA 3W9UA 2GERA 1GQRA 3PUYA 4C3JJ 4MB0A 4TWBA 1LJUA 2P7IA 3R7NA 4RK0A 1PV4A 2KLOA 5HIIA 3K4MA 2H54A 1T1IA 5GAEJ 2RGWA 1WCXA 3DV9A 5HODA 2PYDA 3E5HA 4QATA 4DZTA 4LB5A 2WAMA 4YS6A 3KFVA 3WNQA 2OZEA 1BGVA 1W0TA 3EC2A 1HFEL 2LVBA 3H3XA 2BYVE 3QYFA 3MD2A 1JFSA 4QGAA 1IC8A 4EBFA 4F56A 1GEEA 3EQ8A 1X92A 4J1TC 1QPZA 4YCNA 2QTHA 1DWUA 3AF4A 3FWNA 1GHTA 3DD5A 3JQ9A 1B6AA 2D1YA 3I8XA 3LK7A 1U99A 5ALFA 1JMKC 5KREA 1KO4A 1JSRA 1JLMA 1PWEA 1IOZA 2ICAA 2WD7A 1O7JA 3CBGA 3G5TA 4GI1A 2DLNA 1KFJB 2RH8A 1DHTA 2CXTA 1YB5A 3BAZA 4IQ8A 2CW0F 2AXLA 2B4TO 4U2BA 5TJ9A 3PE3A 4U5QA 1BH6A 2HFKA 2JRLA 1X4PA 5CB4F 2ZXWH 3PXXA 1UR5A 3TIXB 3WGQA 3WIEA 4BPRA 5CCXA 1Z6ZA 5HPYB 2VQHA 1L7MA 2BJVA 4P7KA 2G3YA 3I05A 4B7AA 1S2NA 4BMXA 3I4PA 1E3LA 1Z3CA 4PZYA 1T4DA 2B82A 5M3MJ 1XPRA 1G38A 1CB0A 4B7UA 4LPSA 3EA0A 5B58C 4ENTA 1UINA 2I8DA 3IUNA 3GBVA 3MS7A 4F12A 2O8CB 1E6MA 2VDVE 3H2IA 3IQFA 1NJSA 5BOSA 2SICE 1ECCA 4DLRA 1DIHA 3BR3A 1KXJA 1XD7A 2VC1A 5CRIA 2EW1A 1ZGCA 4Y8VA 1YI1A 3PFYA 5THQA 1XXHB 1K8XB 3MFQA 4KQMA 4LOCA 2EG5A 3MGCA 2W83A 3ZXYA 2W82A 3IVXA 3R5SA 5I7WA 1WFXA 4DIQA 3HP4A 3PC8A 4TKUA 1ID8A 2CNBA 1S8OA 1TQ6A 3E3AA 2QD1A 3FUXA 3NIFB 4NFSA 4BHCA 3MMXA 4FHFA 1J9ZA 1XCJA 1NQTA 2DDBA 1ADJA 1XAIA 2GZSA 3Q2KA 2YV2A 3HB9A 5ALYA 3KQSA 2QJTA 4UM5A 5DNVA 3FCSB 5KKAA 3C3WA 3WYBA 2BI4A 2UYYA 3MD9A 3JATA 2J32A 3N59A 4OXKA 2G72A 5CCBA 3GF2A 3BMQB 4N47A 1VGQA 4UAVA 5F4ZA 1T36B 3A6FA 3J81Z 4DV7B 4OG2A 4BNYA 1NI3A 4AMUA 4AZTA 3W6NA 1FQWA 1CJUC 1G2PA 2LCFA 2XQVA 5LQNA 1DKUA 1T1SA 1R0WA 5CQEA 4FEYA 2QM0A 5ECYA 2C00A 2JIZA 1SU4A 5BRNA 1PNRA 2PLFA 2ZJ0A 3LTEA 2VE9A 4NMHA 3W2VA 3HDDA 1HKHA 3CNHA 1ZTRA 4YDSA 5DMXA 4J9VA 5GZ6A 4CCWA 1OI2A 4DPMA 4F4FA 1H4SA 3F9CA 3JWGA 1Z28A 1S96A 1JV2B 3ZE8A 1JQ3A 1RWNA 1MTOA 2VXBA 1ECBA 3G8BA 4R8VA 3LSTA 3G8CA 2TECE 3LWDA 1ON2A 1LXCA 3UW1A 3WZMA 5AW0A 4LHVA 2W4IA 3KDAA 2WD7B 5EIBC 2KT0A 1QRDA 1TO1E 2XD9A 5HHTA 4HX2A 1L5QA 4EBBA 2WLSA 3M6XA 1DAEA 3P1JA 1UZLA 4WRRA 3ER6A 4CM6A 3IRVA 3E05A 3PQ5A 4BLSA 1T2DA 3HJCA 3FYSA 1RZRD 4FFSA 2JGRA 4OFBA 5DHFA 5AKYA 4OIRF 4NEHB 3ZLBA 1NK2P 5DUIA 1QC5B 2O2IA 3QU9A 3D8UA 2ZFUA 4JJEA 2HU8A 5BOSB 4B4VA 1FVOA 2D74A 5E20A 3EGEA 3QENA 3V7FA 2E2HJ 2HIGA 4I01A 1OROA 3RVSA 4U7TB 4JB2A 2GUWA 2OAP1 1GP2A 5FOVA 3UV6A 6Q21A 4WDQA 4XGIA 2W8BB 3WFJA 1H6CA 2B2CA 4G0MA 4C0SA 2F5FA 1KQ3A 4C29A 1X8XA 1FYEA 1NJ5A 4IFTA 4MV3A 5ECDA 2HCFA 1YX5A 1G8GA 1SIUA 1FC3A 2OCAA 2B3DA 1XRJA 1QDLB 3EZLA 5FOSA 5T4FA 2EYQA 2GM5A 3QWIA 1RWMA 2FK7A 2M98A 5E4FA 4CV0A 5IASA 1JEDA 4G4SP 4E1AA 5IKMA 5AQEA 1USVA 4MRMA 5I9TA 1XC5A 2AG8A 2KLHA 1Y1SA 3HHEA 4UBNA 2F1IA 3QQAA 2WUEA 4NCBA 1XP8A 2Q2QA 2XRNA 4IHJB 3E7LA 5H59A 4NSNA 1PW5A 2YZ7A 4EKGA 5F3WB 1W93A 1YVUA 3J80A 1VKHA 3DUFB 2J3DA 2NV0A 3QTLA 5ALTA 9ANTA 1GPBA 4GZ3A 2C61A 2I4LA 4HXYA 2GYUA 4DXAA 4WNYA 1OVGA 2RIRA 2HWXA 4XVQA 5IP6A 2YFYA 2GVDC 1XSDA 4ZTFA 1QKIA 1WVMA 4TTVA 4KR7A 4L28A 4OY3A 3OJFA 4N8EA 2J9YB 3OQ6A 1YYVA 4X41A 4ZOAA 4FS3A 2AL7A 5JLJA 1FW8A 4CIXA 5F64A 3ZQFA 4CMBA 1E0SA 3LA8A 2WEKA 1OCRH 1MX5A 4G5FA 5EIEA 1YAJA 1ZH5A 5GVSA 1TA0A 1EQUA 4M76B 3T7EA 1L7BA 4XOTA 3JR9A 2Y0SA 2Z5LA 2OWEA 4K05A 3SE0A 3QXGA 3JV7A 2ZI9A 4ZEMA 1G3MA 2AS0A 3TO7A 1ZHHA 4UVHA 5KSPA 1NKVA 1USUA 2G7ZA 4G0QA 1JTVA 1DWQA 3DQPA 1KTVA 2ISSD 2I1QA 4X93A 4W5OA 4ZALA 1UPCA 1Y34E 3P0RA 5ITWA 3FVTA 4PYNA 3WWEA 1V8ZA 2OVBA 3L7KA 3RS9A 3ADDA 5G4KB 1N7HA 4FGKA 4PSXA 2PWYA 1G7RA 1BDIA 3QPHA 1TZKA 3E70C 3I9OA 1QLJA 2W8BA 1FYDA 5F1RA 3O2JA 1EVIA 4KVGA 3NRJA 3OWOA 3JXEA 4H1WA 4X90A 4PAQA 2H7YA 4CKYA 5DTJA 4Q4ZF 3NJRA 4KGXA 5IXYA 1Z1DA 3R5XA 3CUUA 3N2EA 1C1HA 1WS6A 4EA7A 4CL0A 2GKOA 2ZBQA 1DUXC 3MELA 3BGSA 4W8GA 2HMUA 4LI0A 5K0EA 1ONVA 1Q91A 2HB6A 1XEXA 3NVDA 4R7TA 2DTRA 1GD1O 3H35A 1K4KA 2HRQA 2QX7A 4FR5A 5GONF 4BYGA 5JV5A 1WUJS 4PM4A 1E79D 2XUHA 3O47A 2BC9A 2QL6A 2XLCA 2Z4SA 1S6YA 2O8XA 2EBFX 5U1PA 3VPAA 2FWNA 3UWOA 3IKTA 5KWSA 3ZQLA 2DA2A 2VZEA 3ZQ7A 1BN7A 1ULBA 1YDFA 1NNUA 2ECOA 4Y13A 1UWVA 2BW3B 3U21A 2BFCA 2PWZA 2BFFB 4JFRA 4NHEA 1D7AA 2C4KA 1NLUA 5B7GA 3PD1A 5BSVA 5BWLA 2KP6A 3OT1B 4FJ0A 2OFFA 4AN4A 1XPUA 1PZXA 3VR5H 3A1NA 2DPXA 3CX3A 4QUKA 5K7ZA 3PRJA 4HQOA 1G21E 3LMKA 4N0EA 4I09A 1K5GA 2BSXA 2CLKB 3A1SA 4GOOD 4JA0A 2DPUA 1WWKA 2VCYA 2PUAA 1H9GA 4DMHA 2Z43A 1RZ4A 4MVJH 1FFHA 3TL3A 1FDWA 1B59A 3KZZA 2F9LA 2ZIXB 3WMRA 3WLKX 1UKZA 1MEEA 1H8ED 1YQDA 1ZO8A 2E9SA 2OBXA 5KCMA 3G1TA 1KEEB 3KKOA 3PEFA 4G8JA 3OICA 1ODSA 4HVTA 4MMYB 1T2FA 4BX2A 4J7UA 4IHJF 1CQWA 3N87A 3TQQA 4DR6B 5IMSA 3JWPA 5KSWB 3LFUA 2DQSA 1W7PB 1F9AA 4RAYA 3JR7A 4NYMR 4MW7A 3KBBA 5F1KA 4ZZLA 4CM1A 2XKJE 4HSTA 3RPUA 3CLSC 1PS9A 1PJ3A 1U5BA 3DCJA 5K3CA 3TRFA 4BAGA 5CVDA 1AN0A 2YZKA 2O8DA 5LHIA 1OHHA 4LVOA 1U2PA 5L4LA 1SVLA 4QDZA 1M0EA 4YVFA 4NB5A 4FCWA 4C0BA 3F9RA 1IM8A 2VT3A 3ZZUA 4BDSA 2P9CA 2WTXA 5TVKA 1KS9A 1I9GA 1KA9H 4FDAA 2FGKA 4I9NA 2VNSA 5EMMA 3VYWA 2Y1WA 3JASB 3ZNQA 5IAJA 3E6DA 4IEJA 2JJQA 3FKJA 1IHUA 1PVDA 3GZTB 1ZK1A 1PS8A 2WD9A 3R20A 1SHUX 2P78A 5FTMA 1CJCA 3WNBA 4ALKA 5T6MA 3T1BA 5DHRA 1JKFA 3KPWA 5ALZA 2C9ZA 4WXDA 3R8CA 1PEAA 4E70A 3JRXA 3T7AA 2EQRA 1OIWA 4N03A 4I9FA 3ZGZA 1SPXA 1V55H 1OAOA 2DDAA 3PRKE 1EVYA 1UPFA 2BFMA 2J5RA 3DE1X 1QNFA 3BR2A 2I3GA 3M5DA 4HGQA 4JJ8A 3VTAA 5CA0F 1SQ0A 2E4XA 2VTDA 2X7HA 1RZVA 3OPXA 4LBZA 5E6SB 5CG1A 1Z8DA 4DWVA 2V7WA 5E3IA 4EJSB 4PQYA 5JLAA 2IHJA 1U0JA 4UVDA 1IN8A 4QJ4A 5L3DA 4YQEA 1U7WA 3U62A 3IJPA 4DYQA 2WSYB 2BM9A 2QX9A 5JMOA 3ZMUA 5L7WA 1C9KA 2ZSKA 2YY5A 4TT3D 3ER9A 2JPCA 1EDDA 4K6CA 4UE6A 1Y9AA 3UC5A 1V6SA 4NV1A 1L5HA 4GKBA 2JRCA 1COZA 3OE4A 4C9BA 1F6BA 5CFRA 1Y1LA 1CEXA 2HFJA 1TZLA 2HEIA 3N8GA 1N8TA 1K6XA 1ZPDA 3A28A 3UANA 5ARBA 4QAJA 4PN3A 1XTRA 5A6VA 2XE4A 5DXJA 4LJZF 3IBCA 5CPBA 3ITDA 4EI8A 1N8SA 1ZJ6A 3FVVA 2X8BA 1DXQA 5FP0A 3HFJA 4TKVA 1MBHA 1OLXA 5EE1A 5LLDA 5EJCA 1O94C 3MT9A 4Z9XA 3CLUD 5A6SB 1J5YA 2HW8A 4B6SA 2CW7A 1FSGA 1JVSA 1UZUA 1RKVA 1FLVA 2MSKA 3MINB 3P9RA 1BX1A 5DNUA 1FCJA 3EIUA 3KT8A 2Q4RA 4XEHA 1K7XB 2F4IA 3PF8A 5JVDF 3LOPA 4A2PA 5FIUA 3JD4A 3T3MB 4IPAA 1AXEA 4V02A 4H4KC 4CM8B 4RE6A 4U9UA 1ZC3A 4PCLA 2HR3A 2VASA 1CG6A 1SD1A 3OC6A 4HB2A 4M9CA 4R1QA 3IOEA 3UOAB 4XPIA 4EM1A 1I7SB 3JAMA 1H2BA 2MJLA 3WLFA 2R5ZA 5JQGF 2HJWA 4RHUA 2AX3A 2X0FA 4BGUA 4KO1S 4O2AF 4WIAA 4F3RA 1GXPA 1I2CA 2PX9A 4XVUA 4RSHA 1GA4A 2GK7A 2MG4A 2PYZA 3A70A 3CB4A 2QD4A 5F78A 4GR4A 1NLYA 1BOBA 3IRUA 4GCVA 1FJHA 4NJEA 4ZDWA 2IBSA 3ZBPA 2XCUA 1PLKA 1NPTO 1NXPA 4NYIQ 3G5MA 1LSOA 3D3JA 4YCDA 3DLIA 5F27A 1U7XA 2P35A 3Q10A 5DIFA 4EJSA 1H1DA 5IXJA 2NVQJ 1KJYA 2BFNA 2G9UA 3DMDA 2NWQA 3CH6A 3HYCA 3HRIA 1ZJ5A 4OHOA 4YCBA 2OILA 3WV5A 4E1VA 1A1SA 1KJJA 3LBYA 5A0FA 2BLLA 4ALJA 4I55B 2JW5A 1TYBE 4HNHA 1IG7A 1OBVA 1PNTA 2QSFX 3ELYA 3P0EA 4AVYA 4C89A 2E4VA 2RK4A 3F9KA 2CXXA 1WJEA 4QHSA 4KISA 5P8WA 2QRNA 4NDLA 4R2KA 5IVPA 4Y6QA 2P90A 3EARA 1H69A 1V5IA 4Z86A 1ETHA 2C5GA 4MJ7A 3EPRA 2BTEA 1QGED 4U0YA 2ZIUB 5BUCA 2OP0A 2IGKA 4FJ1A 4F9TA 3TZLA 1H93A 1Q21A 4UAUA 3R61A 1G64A 1Z4KA 3OQHA 2RH9B 4PS1A 1YKGA 4WCFB 4IL5A 4YGXB 2H3EA 1LU9A 1N78A 4XFJA 1I6MA 3A4MA 1GXQA 2K9QA 1H2WA 1V9LA 2W4MA 5ILVA 3PQ2A 4FXPA 4UNQA 3KZMA 4EARA 3KVVA 5E7JA 1NBMA 2HADA 1G19A 2HF9A 3R0JA 1XVUA 2AJBA 2OGTA 5K5EA 1E2GA 2HHLA 1NQXA 2Q6OA 1FY2A 5JFTA 4RKWA 1DP4A 2GCIA 4XR9A 3V4SA 1AKVA 2Z16A 2Q5FA 3NXSA 3VJMA 3L7CA 4XXHA 2B7LA 3FHCB 1TTHA 1VHTA 4ZK2A 4PGHA 2E87A 5AIPA 1R0BA 3DFMA 4MWOA 4EG0A 2MSCB 4HUTA 1WD5A 1IULA 2NU7B 2QTMA 4A3MJ 2N8GA 4HN2A 3DBHB 1KKMA 5JARA 4Z4IA 3ZVNA 4DB2A 1W6RA 1QGDA 5EXSA 2G28A 5ALGA 1WI9A 5AW3A 1W5AA 2DUJA 5FBKA 4KXVA 4DSNA 4YAWA 1WJDA 3FDFA 1V5FA 5E4YA 1II8B 1W48A 2G76A 2CXSA 3B9QA 4EI9A 1E2IA 4CKBA 4RV5A 4W82A 2AG1A 3NEPX 2X0EA 5CNMA 4DDMA 4NJEB 4U2EA 1OXTA 2Z8YA 1MB9A 2H2FA 4KDPA 1VHLA 2FPWA 1HBXG 3F9IA 3BC1A 3HABA 1F4PA 1WVGA 2J3HA 2VYQA 3E9MA 3K20A 3EIFA 5GOTA 2XXJA 2JFXA 3BF8A 4GQBA 1KHHA 5AICA 5LD2B 5EZYF 3ZDYB 4WZ6A 3HY6A 3U9LA 3LA7A 2IYFA 1ISFA 3O2QB 3QKIA 3FX3A 2XUJA 3MTQA 3KZYA 4O5VA 1T0UA 1J59A 4P8RA 1XMXA 2JJ2D 4RGVA 5E9AA 4CLRB 4NXMB 1Q22A 2OFWA 4DT1A 5BMOA 2DOEA 3KFWX 2G04A 5SZJA 3WA6A 4BLUA 5DNDA 4JV5B 2VL7A 2JJ1A 3ESAA 4ACAA 1H22A 1OFGA 2PZ8A 1A4XA 1IJKA 1BE6A 4I8IA 2AQEA 1HA3A 3OZFA 4NC7A 1NJGA 3PDIA 1D6NA 3Q87B 4GSYA 2CYYA 1NVKA 7MDHA 2FLWA 3F0TA 3SDSA 4I5FA 2G9WA 3PRYA 4WXYB 1HE5A 1ZIOA 2FPIB 1P73A 3IAS1 3KQLA 1E4OA 1F6DA 5DBFA 4HUQA 4KR2A 1A35A 2JA1A 5EKUA 3P4YA 4ZDPA 4B4DA 3WGKA 4CV1A 1SUPA 2XCQA 3EUAA 3MLBA 3RC3A 2H06A 3EAQA 3SX2A 3R3HA 4FE4A 1TW2A 2IEIA 3B2NA 3Q12A 4WH0A 4FYHA 2P5LC 3LFHA 3UT5A 5LDDC 3QIAA 1XWFA 3ONNA 3SZLA 4ZOQI 1F6WA 1C80A 2ZUUA 1FUYB 3DMYA 3GLFB 1B76A 1EHIA 2FA9A 4B79A 1N9ZA 1B42A 1XN4A 4L9WA 4CGZA 2Y69H 3FIJA 3G2HA 4ZCQA 4ND1A 4PGAA 2EWVA 1BVYF 1G7CA 1TZJA 2R1TB 4TKMA 3WYDA 1YIOA 1DTWA 1YULA 4WJZA 1MEOA 3CJRB 1E64A 1YZHA 3ST7A 1PBNA 5L53A 3ZE2B 4RHXA 1P60A 4C2BA 3F8SA 4E22A 3P5SA 1O94D 2Q4BA 2W6OA 5FWXA 3QELA 2JN6A 1S01A 2AC7A 1PRYA 3PQ7A 2FDXA 4F1WA 4CKBB 3L8EA 5K09A 5JJLA 2YVAA 3TLMA 4B6OA 4O08A 3R5TA 4NWIA 3RBZA 3MBOA 3ABLH 2ZWIA 3R2JA 4BNVA 1EFHA 1H89C 1F2DA 2P6SA 4L18B 2MLKA 2ZG6A 3Q9VA 4M6VA 1IDOA 3W2AA 1Q83A 2H65A 1UC8A 3QF4B 1Z15A 2AE1A 4UB8C 2ORYA 4RY2A 2LR8A 4D8UA 5U9CA 3TBKA 3U4GA 4F4JA 2YX4A 3H4IA 1QQ6A 3A1VA 3KTAB 4DEVA 2GXUA 3NHJA 4Y9RA 2GYVA 5JCXA 1R6AA 2QQBA 2PZAA 3RPUD 1IAVA 2ARKA 3CB2A 1DMSA 3R3VA 3V8RA 1EXMA 4UY8I 2XB5A 3ABMH 1EHYA 3VO1A 4BVFA 4ALLA 3ISJA 3Q3IA 1LF5A 2ZB2A 4N40A 4D0PA 3PDIB 3P9YA 1XROA 2ZDHA 4AJNA 4IRUB 2A07F 2NPIA 1AMUA 3AM3A 3N2GA 4JCOA 3TLEA 3ANTA 3NFRA 4D3XA 2HSJA 3PEWA 3GW2A 5J1YA 1GG9A 1LSUA 4B84A 3CPEA 2O57A 3C6BA 4UE2A 3WSTA 4DKJA 3D5TA 5I9IA 3FNBA 1NQ5A 4ZKEA 4N7MA 3IQGX 1ZICA 3OCWA 1H66A 2BGMA 4OIPF 4EPYA 5L3QA 4NK4A 4UDNA 2Y4NA 4E7PA 3OSFA 1G8HA 2FI1A 3NWBA 5DWDA 1PFGA 4XKJA 2OM2A 4A5SA 5FLVA 5DTRA 5CW1A 1R1VA 3I1YA 3QRWA 5HDKA 1YXMA 1ZH4A 3JWIA 2AFIE 3LUDA 4OXQA 4HT3B 2AB0A 4HDMB 3G1MA 2R1TA 3O8RA 2GIVA 1IUYA 2EW2A 1ZYRF 1UZAA 4BLRA 3GH3A 3H2JA 3O9VA 2UYCA 2HOAA 1DIGA 3B20A 1VKNA 3DULA 2DM6A 3ZHQA 1K79A 2FF5A 4GOND 1SBIA 3PJDA 4MJLA 5EUBA 4QHYA 2JHFA 2C58A 2WYUA 1ZZEA 3LC2O 4JL8A 1GQYA 2YN4A 3DBLB 1KO1A 1U3WA 2G71A 2WAXA 2I1VB 1XB4A 3VYVA 1L8QA 3VR5D 2PO7A 1Y48E 3MRTA 3SXUA 3ZWYA 1R1DA 5JD3A 2B83A 4NZZA 3K7EA 1V26A 4OIQF 1GPYA 2RHLA 4CW7A 4ESEA 2OU2A 2NVBA 2IHZA 3IC5A 2ZI5A 3KPVA 3A25A 4OHKA 2BV3A 5F2OA 3TN7A 5BR4A 3RSZA 3NASA 5I7FA 2KYRA 2QLMA 5CLGA 1G8MA 2C2WA 1J24A 3TPFA 4GOKA 1U3GA 3GN1A 1U2GA 4RY9A 2E4YA 3IT0A 1XP5A 1FSEA 1LA2A 1LX6A 2ZXEA 3MWEB 1UJNA 5ERXA 5JMPA 3TLAA 1CUDA 3B12A 3BMOA 3DM5A 3VZPA 1ISRA 2HIAA 3AH8A 1BZYA 1NF8A 2NZXA 3OFJA 3KQQA 2OZ6A 4XMYA 5ICFA 4H4CA 2BM1A 4ZP1A 4B35A 2I34A 2QTWB 3WLRA 1E0AA 3EK2A 1P1IA 2VK4A 1BC8C 2KLBA 3LV8A 3N2GB 4PU0A 5CYFA 1BOAA 1ZN7A 1F0PA 2WYOA 1XWIA 2WYIA 2E4ZA 2WB1A 2QBYA 1VI6A 3DLCA 1XCBA 2B8JA 3TDKA 1L4YA 4CKEA 2BL4A 4I7HA 2ZRQA 5JDCC 3TW8A 4F5ZA 4CM9A 4C7OA 2JZNA 4ASUA 1OFVA 2XAAA 1ORTA 3AETA 3PC6A 4E2ZA 2XUQA 4RTMA 2GD2A 2CF6A 1KTIA 4F2PA 3AKZA 1TO6A 2J0EA 4BFWA 1NIPA 2XIGA 5LYJA 2QB5A 2XGXA 4ZQEA 3JAMK 1PP7U 2YU9J 3WL8A 4M71A 1B14A 2O3UA 1NDHA 1XVTA 3C1OA 4EKEA 5JSZB 4G1BA 1QKKA 1OFIA 2R7XA 3HM2A 1Z0SA 4HDMA 1H9CA 1HRKA 1LQUA 2DHRA 3DMPA 4LMYA 4FU0A 4JLAA 3BD6A 4MAAA 4NBVA 3ZCVA 4US0R 5TLSA 3HJTA 5K0ZA 4G4GA 2XZDA 1YW9A 1CS0A 1SQ5A 3OMLA 3KJXA 1Q0UA 2WABA 3OFKA 4MW1A 3ZWDA 1O03A 3LGSA 2ZNZA 2AG5A 4IH1A 1L5GB 4GM1A 1MJ5A 4XKCA 5E3MA 1CUSA 3JYPA 4UBIA 2OXIA 4UZFA 3F72A 1ZYUA 3EGDB 3H5WA 4S12A 1M2EA 3LY8A 2NN3C 3OS0A 1GPMA 3KVOA 4X71A 5HA5A 1OXKB 4N3AA 3H75A 1WJAA 2RHGB 3CT6A 2PXAA 4PICA 5TGZA 2Q1WA 2G88A 3IAAA 2EGGA 5EINA 3KUCA 2ZRLA 2IYTA 4H3SA 1H3EA 2P9BA 3PGLA 4DN6A 3WGVA 1T25A 3ZK8A 2ZJRF 2HVQA 5CTAA 1YDMA 3RYFA 3WMXA 4E2XA 1M3SA 1BS2A 2OBBA 1RLMA 1FRNA 1XQ1A 3M6WA 3HN7A 1T3HA 3VC2A 2XEDA 3S2EA 2CUJA 1A7JA 3BJAA 3KYCB 1J23A 4DQVA 5FKNA 4LNUA 1YZKA 4P84A 4F2HA 4IZOA 1RESA 2WDPA 3C3YA 3T3EA 3K9NA 4R5MA 1HNXB 5LN1A 4LAFA 4MI6A 3GRRA 4GP9A 3CH4B 3D6TB 4XASA 4IHSA 1W5EA 3BCUA 5FF9A 2EIMH 1SCNE 2BI8A 3NRCA 4XLFA 1W47A 4B82A 2QBYB 4JGIA 2J09A 2RK6A 3AR3A 4JX8A 1PQ4A 3E4DA 3JAKA 1P4RA 4ZZ2A 4GPTA 2JC3A 3QVVA 1XLVA 2Q6KA 4M1ZA 2HRRA 3MKWB 3DMTA 2AN9A 5FI5A 4MVJD 1JS1X 3QVOA 5JADA 1BDHA 1Q7TA 1UMBB 3BQZA 1OWMA 3QLJA 3ABUA 2ZJ2A 5TARA 1OFHA 3G2LA 4TV8B 4CUJA 5GIOE 4RETA 4ZVTA 4JROA 5HSGA 4HXFB 2JWTA 4M38A 3SJAA 4E46A 4QGSA 3P2YA 4G0VA 4ZO6A 5A3SA 2EWWA 4LOKA 3H17A 1CZLA 5JD6A 3RRNA 3B2QA 5JROA 5KSYA 5FPHA 2OM6A 4B5KA 4RDHA 1VTKA 2P3SA 2VNHA 2K5CA 2C7GA 3HJFA 3KTOA 2ZIEA 5CFMA 2VHXA 5M2QA 5CDYA 1SFXA 1XLTA 4MUYA 5CUQA 2NOAA 1LGYA 4EABA 3WIVA 3FMVA 3WGJA 4PGGA 2A9KA 1EBBA 1UZMA 2HYJA 3PGVA 1BQ3A 4B5LA 1E1QD 4RLHA 5KNLA 2GTPA 3FVWA 1ZEJA 2HV8A 3WBFA 2JHCA 2BAGA 1P19A 3EQ9A 2UVDA 4KRXA 3QPUA 4LIPD 4HQ0A 4PAOA 5D8DA 8ATCA 5HBGA 2Y1OA 5E6RB 1KY2A 3RBAA 3BL5A 1UAYA 4YT8A 3HMQA 1LFDB 3NKVA 2AMVA 1A8HA 1ONSA 3I34X 5FORA 4D0GA 3HRMA 1MBFA 3PYLA 4WERA 3FKQA 5EHIA 1K8QA 2R00A 5H02A 4MMZB 4MS3A 3O74A 3ZHBA 2HPZA 4GR5A 4GMKA 1RC0A 4X0GA 2PBFA 4RGYA 5EXPA 1MN6A 5I7OA 3UKJA 5G40A 5CD1A 1I5ZA 2Q21A 2GAFA 1JJIA 3KYCA 4H7EA 1SXQA 3QVSA 1R9JA 3OIYA 1TF2A 4OBBA 3V8PA 4KCGA 4OP3A 3EODA 3AEUB 3WYCA 2AFHE 3DF9A 3CVWA 4YGYA 5FKMA 4UVGA 2RAFA 3D02A 1HR0B 1W0KD 3DVRX 5JRJA 1JBEA 4MI1A 3T94A 3DPUA 2CFCA 3UMJA 3NEAA 3ORFA 4G5RA 1EJ0A 3QUBA 2XT0A 3D8BA 3ABTA 5K3AA 1PDWA 2RREA 5FTKA 2VJDA 2OB2A 5DHQA 2A1UB 4QQRA 3UNGC 1PEKE 4CCSA 4R51A 1L7QA 4HWGA 5A4KA 3AEQA 2IODA 3UBMA 3WKEA 5JVTA 2PZFA 1LBTA 3I6IA 4P35A 5BN4A 3W4JA 1LVGA 3TIVA 4P4NA 1I3MA 3C3CA 4DYRA 3OYDA 1KIAA 1GKYA 2QTLA 1A77A 1E0JA 1UKCA 3C48A 4MKFA 4MLDA 1Z73A 3PDHA 4WA7A 2UYQA 4G07A 3OWHA 2BEOA 5K1YA 1A8QA 4E4RA 4HNRA 4CZ2A 1WQ1R 4E12A 4RA2A 3VYTB 3M7GA 1NM5A 4QBKA 3DOUA 2JFZA 1NVWQ 2WTAA 1MX9A 1HKSA 1Y6JA 4QPZA 2CZGA 1TVKB 5M3BA 4IHAA 1JW9B 4DCCA 3RT9A 4AIKA 4HPQA 2B9EA 5LHHA 1R9TJ 4QYSA 4AIIA 3K70B 1CY1A 3RI4A 1IN4A 3DJYA 3HHHA 1J5XA 5I4IA 1FL9A 2W70A 2FNAA 3DGFC 2FWBA 3V8JA 1TUEA 3CMCO 4KV9A 5CA0B 3MBIA 3AR7A 1DINA 4XJXA 4LLLA 2ID6A 4LXTA 2AOUB 1EUDB 2HMSA 4NULA 3B9PA 3CUEF 4TSFA 4AMVA 4PVCA 4BAYA 3THYA 2QR3A 3PFCA 1OH6A 1P7WA 1X14A 2FK8A 1X74A 2NSLA 1X1DA 2ZKIA 1QHYA 2FSSA 2HSWA 4V24A 1CRLA 3MWMA 3L02A 1XCVA 1DKOA 3PSIA 3LT0A 2WA2A 4MS3B 4TL7A 4WOPA 3TR5A 4ECAA 4EZEA 4UBMA 2IHNA 4DCJA 4BQQA 4QXPA 3OYCA 2ELJA 3HM5A 1RHUA 3P7MA 4I6GA 4TV9F 3R44A 1VE9A 2FQXA 3UWDA 3EMVA 4IGIA 3FAZA 3SS7X 4DLLA 5I5EA 3WQRA 2NNWB 3JWJA 2JFHA 2X0KA 3ADOA 4RXUA 3QLUC 4FDVA 1NT4A 1K6YA 2QD3A 1ZLKA 2OV8A 2VF8A 2VJQA 3L0BA 1STZA 4WN9A 2AFHA 5D86A 3W5HA 1XX5A 5DV9A 4AO6A 1Z8NA 2DQYA 4EO7A 3QIVA 5AW1A 3N6XA 1CGPA 2PHZA 1HK7A 1KZ4A 3BEOA 4J7CA 2IC5A 2PGDA 4J0HA 3U39A 2PS9A 1YZTA 4D9FA 4C0LA 3P9CA 2A59A 4EYKA 4NYJR 1HYBA 4WJKB 4F60A 3EA4A 5BN4B 4AY5A 4OHMA 5BT8A 5IZ4A 2YDXA 4NOKA 3K69A 3NBAA 4LYDA 2CXRA 3O0TA 2DGDA 4UBOA 4Z6KA 2LCIA 5BUSA 4ARCA 2Y05A 1N34B 2VDUE 1E18A 3A37A 4PZAA 4B48A 4I81A 3RHTA 3BK1A 3LKVA 1DAMA 2BPOA 3V9AA 4QVIA 3D5RC 1NFRA 1ZR4A 1BQEA 1Z74A 2ZJAA 4KQ6A 3KK0A 1Z21A 1T3LA 4HB3A 2ZUSA 1M8PA 1WXWA 1SN7A 2OK7A 2R6FA 4CL3A 1CRQA 4AKSA 4PHHA 2QJOA 1YS4A 4UXHA 2L7KA 3BWDD 5HYVA 1D4FA 3WO1A 5KKCA 5KWVA 3M1AA 10MHA 1NVBA 5JY1A 2QUFA 4O0LA 4UVIA 5ALUA 4EMTA 3HK2A 5E3JA 3ETGA 1FRZA 3HY4A 4EHHA 1Y8AA 4LIVA 1C81A 5ILSA 4GOLD 2VH2A 1YF3A 5KBYA 1EESA 1RBZA 1D2AA 1C7RA 2JDID 2MMGA 3RU9A 1DJOA 1D1BA 1YA4A 4QXMA 1GQFA 1J2EA 4RY8A 1FRFS 5LKRA 1GV1A 4HNUA 5F5LA 2JRTA 1DAIA 3TD9A 2C4UA 2R2GA 2RGXA 3FISA 5E7QA 5C2JB 2D1QA 1OAKA 3BHMA 4W8OA 3VX3A 4JMLA 2PN6A 1N2CB 3ONDA 4Q00A 1JHHA 2L4AA 4FN4A 5TEWA 4QBHA 3NAGA 5D3KA 3RIYA 3L1JA 3HN6A 1UJBA 4JCCA 1P1HA 1Q1BA 3SQXA 4BNLA 3W6OA 5K0GA 3SYNA 5B64A 5J58A 2I66A 4C88A 5A1TA 3EG5A 4GUDA 1LVKA 2QG6A 1SFEA 4KMFA 3RZDJ 1PK9A 4KXUA 1QJ4A 4EYQA 2A5WA 1EFDN 2AMLA 5HCUA 4F6RA 3GT7A 4GGOA 4U02A 4FZRA 1A9TA 2RKWA 3MJSA 3T3GA 3WADA 1GKUB 2ZS7A 3ZV7A 4FILA 2BDEA 1C14A 5DWQA 3W5JA 3GTPJ 5IP7J 3WNDA 4BNTA 4IDFA 1Y6FA 4DEXA 3OX1A 4OA5A 2RN7A