3HPQA

Crystal structure of wild-type adenylate kinase from e. coli, in complex with ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Rational modulation of conformational fluctuations in adenylate kinase reveals a local unfolding mechanism for allostery and functional adaptation in proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hpqA00
4PPNA 2XTZA 4BASA 3PUXA 1UJ2A 1T6NA 3EX7C 2BV3A 1Y63A 4HLUA 1Z0KA 2ZRFA 5CM8B 3AV0B 3IO5A 4OQXA 4GOXA 3BJIC 1XD2A 3ZS8A 2PCLA 3CF0A 1PUIA 1X1RA 5E7IA 4ARZB 3I61A 2QORA 2CHGA 3MJHA 1TTTA 2DY1A 1B0UA 3FVQA 4PTLA 4RD6A 4TL7A 3M0EA 2J0QA 2QY9A 3HYRA 3BH6A 4WA7A 5G53C 2QMHA 4Q7JB 1XPUA 3RRYA 4OQLA 1TAGA 2IS1A 2FFBA 4I99A 5EJEA 3IILA 2E9SA 4GZMA 1JECA 4JBXA 3AM1A 3NVAA 3CWZA 1NIPA 2OILA 4U7DA 1Z6YA 1ZYUA 5FI0B 1TQ6A 1LV7A 4M9XA 3ICEA 3CNLA 2FF7A 4F92B 2D3WA 1GL9B 2H92A 4Q7LA 3U7EB 4Y0VA 4RKEA 1OH7A 1UFQA 4GOKA 2OCPA 3W34A 4MITA 4XD7A 3P26A 4IDPA 4UJ3A 2NZJA 2IWRA 1TEVA 4XWAA 2FGKA 4FINA 2Q0HA 3ADKA 2WWIA 2XZPA 4Q47A 1P9RA 4ASUA 3IO3A 3OAAD 4JVMA 4K81B 5DNYB 5FBLB 3LVQE 1E79A 1XTKA 3QE0A 1OSNA 4B3XA 5DYGA 2QQEA 4IVRA 4R2IA 2QROA 1G8PA 1U94A 4M21A 3FB4A 3EG5A 3K0FA 3IEUA 1Z63A 3A4MA 1ZNWA 2IYYA 3I3SR 1EWQA 2JLRA 1G3RA 3ZZ0A 1QHIA 1ZBDA 3FDIA 4TSFD 4BLPA 1PLLA 1F6BA 2WWFA 4Z8XA 4RFSA 4Q9LA 4O2LA 4O25A 1E4VA 1R8QA 2BJVA 2ERYA 4URYR 5JCZA 1KSHA 2FGJA 1NLFA 1T9HA 3N2IA 3TJZA 2GK6A 4M1YA 1ZM4A 2ZETA 2C9YA 5BXQC 1UF9A 3TAHA 5FTKA 1AN0A 2QI9C 2ZRDA 4TYYA 2DB3A 3TVTA 3T5DA 4MDEA 3D8BA 1DEKA 1E4YA 4YONB 1VG8A 4YMVA 4BECA 4JYCA 4EPXA 1NI3A 1Z6GA 3QF4A 3R8CA 4DWJA 4YQFA 1G8YA 2QP3A 4LX0A 5P21A 3U6BA 2GAAA 2QE7A 5K8UA 4M1OA 3PJRA 1BMFA 2QAGA 2P6NA 2WAXA 4ABYA 2WWYA 4AURA 3VR2A 4I1UA 1HA3A 4AYXA 2NOAA 1ZM2A 1E2JA 5DN6D 1A5TA 2OBMA 3K9HA 1CJKC 3WMGA 4JKYA 4DIDA 2AK3A 1WP9A 4QBHA 2V55B 5F9HA 1KI2A 2EWWA 1PVOA 4P4SA 2ANCA 4TLBA 3GMTA 4UNSA 4IVPA 5FL3A 3V00A 5SZHB 4GNKA 3RYTC 4C30A 3GEEA 3PUVA 1Z5ZA 3JVVA 4OJQA 1P2SA 2Q21A 4RY2A 3VX3A 4O2RA 1CEEA 3QG1A 2IS2A 1KNQA 3DO6A 5JWOA 1G7TA 4CEHB 1T3LA 4HB2A 3DEFA 2O5VA 1E2PA 2CLCX 1FUKA 2EWVA 5BYJA 4MRVA 1M34E 3E2IA 4ZDJA 4GZLA 2Z0MA 4IDNA 4D0NA 4HAXA 4RFVA 1YZQA 2ZYVX 4G5SA 1VHTA 3I8SA 3W6PA 4A0GA 2FNAA 4LV6A 1OXSC 3CZPA 2W58A 4C4PA 1T8UA 3CRRA 1PZNA 5JWRA 1U90A 1MT0A 3LLUA 1Q57A 1G6HA 2O8CA 2XSZD 3PVSA 2QBYB 1XEXA 4LJ6A 4S2EA 5BW8A 5BQ5A 4P4UA 4X8LA 3NBFA 1K5DA 2D7DA 3AGPA 2VH5R 2I4IA 1ZMXA 4JT4A 1A2BA 1TF7A 2XTMA 1E2EA 4LC1A 3REFA 4C7OA 4R71A 2NZ8A 3HWSA 2OHFA 4PSAA 5G40A 3NC1C 3SBEA 2NTYC 5HR5A 4B34A 3VQTA 2P65A 5FPTA 3CRMA 1QRAA 2GVZC 2ONKA 4BWYA 4CEHA 3EIHA 3DOEA 1GL7A 1W46A 3CX7A 2BM0A 1GILA 4EPYA 1F60A 2AKYA 1KGDA 1KK3A 1ONBA 4EPWA 5KSZA 3QKRB 5TB5A 1NN0A 1TX4B 2D7CA 2ZS9A 2IUTA 4MQBA 4FMDF 2V7QD 1VIYA 3DKPA 3X1XA 4DT1B 4CVNA 4LV5B 5FOXA 2W2TA 2O8CB 1MRSA 4HI0E 2WAYA 1KI6B 1G4AE 3CRQA 2Q3FA 5H8WA 2J7PA 2FH5B 2JJ1D 2ZI7A 3U4QB 2KJQA 4OQNA 3FHTA 3AEZA 3KQLA 1E96A 1E9AA 2YC2C 1U9IC 3SE0A 1EXMA 1U8AA 4CGZA 4HAWA 4PC6A 5FL7D 3TAUA 3K9GA 1II9A 3SNHA 1E2FA 2D2FA 1IM2A 4B3FX 4X8HA 4MKIA 5EZ6B 1NRJB 2NIPA 4RZUA 2O8FA 1G5TA 1T5IA 4D0LB 1BO6A 1COWA 2AX4A 3C41J 4YMSA 1SULA 1G7SA 1AJEA 3T61A 4BQSA 4M9ZA 5FUVA 4TYNA 3IEVA 4Q9JA 4TWZA 2JIZA 2BOVA 1J70A 3VU9B 1Z0IA 4ACAA 4AIIA 1W36B 1VG0B 1WXQA 3LH5A 2C2HA 5FTNA 1XZPA 2A2ZA 4URWR 3AP2A 3CR7A 1PJRA 1KO7A 1RJ9B 1W36D 4CIDA 2YC4C 3CX6A 3DL0A 4OI2A 4IXNA 1LY1A 2JCSA 2ATXA 2ZRLA 1MABA 4OKSA 3AF2A 5UKDA 1Q3HA 2JATA 2ECKA 2WBLC 5DO9A 1W0KA 2RGNA 4XD7D 1J2JA 3CO5A 1GRQA 4ESVA 1FNMA 4F4CA 2GXAA 2PX0A 2AD5A 2PJRA 5EXTA 3ZH9B 1XBTA 1DG1G 1VHLA 2FZ4A 2PMKA 4DLXA 5FPSA 3UG7A 4IEIA 4MRSA 3K0EA 3CB4A 5JLJA 3K09C 3GJ3A 3L8ZA 3HR7A 2DWOA 3GLIB 2GBLA 5CYOA 4OL0A 2GZHA 2IYLD 2OZEA 4DLVA 1VDZA 2J7PD 1NSTA 3U2QA 2Q9BA 2J59A 1P9WA 2ZAOA 1ZD8A 2IA5A 2BBWA 2BEKA 3SEAA 2QBYA 2WV9A 5B58C 3TSWA 1P7CA 1VIAA 4W9MC 3PUZA 4KAXA 1M7GA 2C95A 4JLJA 1XP8A 2XGJA 4MA4A 3UMFA 1UKEA 2J1LA 3V9PA 2JJ8A 4B73A 1N5JA 5J4HA 4HAYA 1IJFA 3TRFA 2QU8A 1Q0UA 3CH5A 4KSBA 1KMQA 4PO9A 2PZFA 5KDOA 5A5GA 2C04A 4LJYA 3SDZA 2H18A 4RZXA 5HPYB 4F38A 2ZRHA 4ARZA 1MO4A 4HLQB 3W8RA 2O52A 4ACBA 1HQYE 1UBFA 2SHKA 2ZSFA 4U00A 4WVFA 2B21A 4Q4AB 3VR6A 2ZIAA 1AIPA 5FOSA 1M74A 1W4CA 3AF1A 4GP7A 1XD9A 4TL9A 3WNBA 2FWRA 2QGZA 5FBRB 4CRWB 3AVVA 5KTYA 1AQUA 3HYTA 3QEJA 5FPHA 4CEIA 3OIUA 1G5RA 2J9RA 4FW9A 2FFQA 4FXPA 4C0AC 5L8VA 621PA 4DHEA 2PEYA 2ZITA 1A7JA 3O8BA 3HDTA 1N6NA 1F5NA 3ASYA 4LYHA 2I1QA 2A9KA 4YLGA 1ZD1A 1G291 2B92A 4HUTA 1LFDB 5KDLA 4PPFA 2ZS8A 3EAQA 8OHMA 5KO2A 2OFXA 2R44A 3MWYW 4OK5A 3QF4B 1HY3A 2VQSA 5HZKA 2F3RA 5JEEA 2F43B 5KNDA 3QOFA 2CLSA 4PC2A 3SYLA 2ZRAA 4TN1A 1I4LD 4V02A 4EFLA 1OV4A 3LQRA 3F0TA 4PZLA 4GPTA 5B57C 5IK2D 4D4JA 2OXCA 4BFYA 1NF3A 1KDRA 4NYMQ 1XTRA 1Z0JA 5AJVB 3KJGA 4QKQA 3MSXA 2JJ2A 4PC7A 3QENA 2G6BA 4MYCA 1F2TB 1FFHA 2P5SA 3MRSA 1KO8A 1LF0A 1J99A 4BLTA 4DZZA 2G3YA 3BAFA 3ZQJA 5JRJA 5E7MA 1OXXK 3DZDA 3OEEA 2J0VA 1OIVA 1OFTA 1NBMA 3HU1A 1BS1A 2FA9A 3PFIA 4FD2A 5C4GB 3V4RA 2DFKB 2IYQA 3RANA 1Z0AA 5BWMA 1HQCA 4DUGD 2C99A 3F8TA 3BOSA 4KLNA 4S35A 3K70C 5AUNB 1XU4A 1YQTA 1DAIA 1E9DA 1AZTA 4NTZA 5J4YA 1G1MA 3PEYA 1UBGA 2WWWA 3LNCA 2X2EA 2QQ0A 1X3SA 1T3SA 2Z43A 2WMOB 5IK2A 2IT1A 5JHHB 1G7RA 1OT3A 1R0YA 3TK1A 4TQUS 1GTVA 1NP6A 3VKWA 1D9XA 2DFNA 1YU9A 1YZKA 3OHMA 1H8HD 4ZCIA 3G0HA 2YZ2A 1OFUX 3OESA 3U44B 1XMSA 1KY2A 1W2HA 2WKRA 1ESMA 1N6OA 3GJ8A 2HV8A 2JAQA 3UIEA 1LW7A 1SXJD 3IGFA 1XD2B 1JPJA 4IDOA 4DCUA 1FTNA 1UEJA 1AM4D 2IHYA 4V03A 4AG5A 4A15A 2O8EB 4JIMA 2PH1A 4HYYA 4W5JA 2ZRGA 4LPKA 2WSSA 1H8EA 4WAUA 2NO7A 2CCGA 1S3SA 1KO5A 2WHXA 3VX4A 4UNRA 4N1AA 2RGGA 3T34A 2AXNA 3K70B 1JJVA 2R6DA 1NMXA 2AFHE 3D3QA 4US1R 3TNFA 3THXA 4B2LA 3NDBB 1TUIA 2JJ2D 2BMDA 2ZYUX 4OK6A 5KHOC 2QRNA 4CEJA 1E0JA 1Z29A 2OBLA 2X1VA 3N70A 1KTVA 1T0HB 2A5DA 4B3CA 2XZOA 4BFXA 2V6IA 2QG6A 1E2MA 3P27A 4QRHA 3TIFA 3HR8A 2IXEA 4N0DA 4RZ2A 5SZKB 1XPOA 5C1BA 5GVSA 4F7WA 2X19A 3HP1A 2AWOA 1GAJA 2JEOA 2OCYC 3SS8A 4DUGA 2FZLA 3U3OA 2ZM5A 1U81A 3TW8B 3KXKA 1Z83A 2AN9A 3QQ5A 2FU5C 4LYFA 1Z6TA 1RFLA 5CM9C 1E79D 4QBIA 5K8LA 3RWOA 1KO4A 2WPDA 2DPXA 3P4XA 3SJAA 1XCMA 1S2MA 2YVUA 4NYIQ 1Z2AA 4EIWA 3LBIA 1E1RD 3UPUA 2JLYA 2Q9CA 1D8TA 4M1WA 4M22A 1EFRA 1SVOA 5FOWA 5AWFC 2RHMA 2ZJ8A 4DCNA 1ZU4A 2O0JA 5J47A 2A78A 3RS5A 4MKGA 4O3MA 2ZRIA 3WMFA 1NVXQ 1CU1A 3CPJB 4LYAA 1NSFA 4ZI2A 5TY0A 1PV4A 1EFUA 3B5JA 2IC5A 2VPPA 2ZRMA 1S3GA 5EQTA 3BIFA 4RD3A 3Q8XB 3QEOA 1G41A 1S96A 4QGAA 2IK8A 2FJUA 4EFNA 4PO1A 4M4SA 1Z0DA 2F9LA 2A3RA 1UBEA 2FEMA 2BBSA 3OFNA 4IFEA 3U3MA 1OIWA 1NG9A 1W49A 1SKQA 3B1VA 5JMTA 1G17A 4I4LA 1OIXA 4KCGA 1DTSA 2NO6A 2ZVQX 3QBTA 3TUIC 4DJTA 3GFTA 4FI3C 3GLFB 2IF2A 2W00A 1BMFD 4P33A 1NVVR 1GKYA 2FPMA 2VBCA 3R20A 4PQYA 4RVCA 4DXAA 1DAHA 2BIFA 1FOEB 3L2OB 2LKCA 1JR3A 5FTLA 2WJYA 2ANBA 1RRGA 3SJZA 2Z4SA 4LJ4A 3W5IA 4PFSA 4AYTA 2IWHA 3T5GA 3HU3A 3B1XA 3NDPA 1Z8FA 1E99A 1PLJA 1S8FA 5JCPA 1W0JD 4HUQB 4LGMA 3X1DA 4L8GA 3BB4A 4IJMA 4RD4A 5GADl 4HB3A 4Q9HA 3SFVA 1A1VA 1P62B 1SHKA 2FOLA 4UXJA 4R7ZA 2Y8EA 3KJEA 1P73A 4Q00A 4TSFA 5J40A 3KQKA 2GF9A 1P9NA 1L7VC 1TU3A 2FSGA 4ESHA 3LRPA 2WIAA 4AKGA 4KFUA 1II8B 1HTWA 3P1JA 2VSFA 3GEHA 4FCVA 1HE1C 4Q9IA 1WDTA 3EWSA 4DCTA 4CEJB 4TLAA 2J46A 4KV9A 1ZCBA 4TMTA 4BFSA 4LY6A 1ZU5A 4XVRA 3NC0C 4AC9A 4X8MA 3FGNA 2QPAA 1IBRA 1YJ5A 1DAKA 4NDZA 1OXUA 5GJBA 2G9NA 2ZRJA 1RIFA 3B13B 3ND9A 3R9IA 4CEIB 5LD2C 2CHQA 2OUKA 4QJ4A 3IIJA 3U3RA 2H17A 1H8HA 3FFBA 5JRZA 1JR6A 1D2MA 2XAUA 3D7MA 1N6KA 4KFSA 3K09A 2IHBA 4JVLA 2GCOB 2GILA 3A1UA 3U3KA 1KZ7B 2YINC 3VKGA 1ELOA 1DO2A 1KNXA 2W6ID 3B1WA 3ETLA 2H7VA 1DAMA 1P3JA 4TMXA 5AJWA 5DI3A 1NN5A 4DDTA 2YYZA 2OV2A 1KAOA 1OE0A 2IEZA 2IYRA 2ZJ2A 1RYFA 4UXIA 5J5CA 3RS0A 4D2IA 5C4MA 3A4LA 1ZM3A 5CB6A 1JAHA 2YNMA 3O8CA 1S9DA 2FPKA 1SXJB 5E4FA 4JLDA 1KJYA 3ICQB 1EFTA 2NO9A 3DHWC 1ZNZA 4W5WA 5DE3A 2OSBA 4KFTA 1U8YA 2EFEB 4AWXA 3UWOA 3KX2A 1H65A 4A2WA 2W2VA 3TBKA 4W5HA 3QI2A 3QPUA 5JHGB 1NKTA 1T0JB 3TVDA 3UATA 4DB2A 1E94E 1ZNYA 2ODNA 1E0KA 5K8IA 1XMJA 4Q5IA 1LF5A 3F5FA 4V0OA 1JXMA 4I1OA 1YVDA 4ZV4A 3SHFA 1COWD 1I2MA 3K1JA 2ZSEA 4EKDA 1OLOA 1N6RA 1XFAA 1TUEA 3FFAA 2IUSA 4DB4A 5EUMA 3DM9B 2YHSA 2QN6A 4JJZA 3SU8A 3GJ4A 3THYB 2QRZA 2ZUBA 2ZJBA 5LPNA 4V0ME 1VECA 4GMXA 4FCTA 1P4SA 2Z5FA 5L3VA 3PITA 4A36A 2QPOA 2ORVA 4PHTA 2REOA 2J3EA 2F1JA 3EASA 2WOOA 4FMCB 3SC3A 1W4RA 2DFLA 4GOJA 2EFCB 2G88A 3BBPA 5TDHA 1SVIA 1XMVA 4IHQA 3TQFA 3LAWA 4C0KA 2RCNA 3WYGA 3BXZA 1IN6A 2D74A 3U61B 4Q1BA 4WXRA 2QP4A 1NY6A 3M4YA 1N3BA 1VCIA 3A37A 3C5CA 5ELXA 1N5IA 3GLFE 1DPFA 4UNQA 1E9RA 4BFZA 2QTHA 3QKSB 4TTQA 3RHFA 2QEQA 1ZIPA 4HDCA 5JI3E 4OI4A 2JASA 2XTNA 4LHZA 1TQ2A 1BYUA 2QM7A 2EU8A 2BC9A 2AKAB 4Q03A 1M2OB 3MD0A 1XDBA 4JL5A 1GITA 2GRJA 1XEWX 3RC8A 4YDSA 1DAGA 5JI2E 3WHKA 1AA9A 2NO1A 1D2EA 4EUNA 4TLEA 5FBWB 5LB2A 3O47A 2ZE7A 2ZRNA 5TXGA 3LY5A 4BLQA 2JLUA 3BK7A 3PV0A 3DMNA 3K0SA 4D25A 3VR3A 3AH8A 3SQWA 3KB1A 2ZANA 2JLWA 3CPHA 4QOSA 1P5ZB 4U02A 1VPLA 5DI3B 5LDDC 2A5JA 5CJPA 3H86A 4V0NA 1OKKD 4HAZA 4QC2A 1AK2A 1I4TD 2HF9A 2GK7A 5KSYA 2EFDB 1RW4A 2JA1A 1T4GA 2J0SA 2CCKA 3N2EA 4Q4AA 1OXVA 4QNMA 5JJIA 4B75A 4ITRC 4A82A 1Y3AA 5H1YA 1KI8A 3FHCB 1U0HC 1LTQA 2IYVA 3PIRA 1LS6A 3AQ4A 1FX0B 2CL7X 3I4LA 4M53A 4BFVA 1FPMA 1YZUA 1NKSA 3GFOA 4JLBA 2CL0X 3WYFA 3VU9A 5JZVA 2VP5A 3HPRA 5HZHA 1OB2A 4G0NA 4C7OB 4LZZA 1WA5A 4HAUA 3BS4A 2ZJYA 1ODFA 1X8KA 2BCJQ 3AUXA 4TZ0A 1RZ3A 2ZE6A 2W83A 5FH9A 1KIMA 4K8OA 3B8HA 5FUXA 1E1QA 1NLZA 4HLDA 1IN7A 4B76A 2E1RA 4Z1MA 1G7CA 4Q4LA 2PT5A 2JIZD 1U98A 2QE7D 2VHQA 2Z4RA 3I92A 2ERXA 3TLXA 2EQBA 1KDTA 3RS2A 2WZQA 4HEJA 2CMKA 2HJVA 2CK3D 2AXPA 3H4MA 1W4AA 1UKZA 3CIOA 1RRPA 2V9PA 5CK4A 2R6GA 4J0QA 3WY9A 1F48A 1O3YA 2HCJB 4HLUC 1OFHA 4HLCA 3MWJA 3TSZA 1KKMA 1ZVQA 2JLVA 2GCNA 2WWHA 3BFKA 1JEEA 4GL2A 2YV5A 4TYWA 3BE4A 1OYWA 1P60A 4HZUB 2WOJA 5E95A 1TEXA 2DCUA 1HT1E 2CXXA 3LD9A 4AI6A 3LXXA 4JVSB 1M7BA 1IXZA 4BRUA 3K53A 1GL6A 3ZVNA 4MYTA 2BKEA 2YWEA 3KKOA 2YOGA 2NQ2C 2QNRA 4GFDA 4Q48A 4Z51A 2WTUA 3LXRA 2VHJA 2ZI5A 2V54A 2VHUA 1XEWY 3ZQ6A 2ZEJA 4IOJA 4RKFA 3BWDD 4LJAA 2IS6A 2ZJ5A 4OK3A 3VR4A 3W6OA 5A0FA 1VYVA 1ZUHA 2IF0A 3MWKA 3E5HA 1YZNA 3VFDA 4RZ3A 4OHXA 3U5ZB 2PMDA 4RCYA 4PHFA 5DLQC 3CR8A 4LJ8A 1KZGB 2BVNA 2HYDA 2CNWD 4HSEA 2AWNA 3NBYC 1HURA 3AVOA 3EZ2A 3FKSA 5FUWA 3TE6A 1CBUA 4G3XA 4FMDB 4P31A 3JVUA 2RGNC 2UZIR 4URZR 2XNDD 3RSOA 3AP1A 2IYWA 2REBA 2ZUCA 4QHYA 4AKEA 5EE3A 2VRWA 1OHHD 2YWGA 4D0GA 4CF7A 3CONA 3KKQA 4BUJA 2VLIA 2XOKA 1E9EA 1P72A 5GJWC 1Q1QA 1RRFA 2R9VA 4A2QA 4EPVA 1E32A 2ZRPA 1B23P 2PLFA 3W9YA 1L2TA 4NZYA 3QBVA 4PZZA 2OBNA 3OAAA 4PC1A 1YZTA 3AVPA 3R9XA 2GCOA 2GVDC 2CHVA 4QBFA 1X8LA 1N6IA 2P6UA 3ZS9A 4IDHA 5KUTA 2RMKA 5AR1A 3QSYA 2WKPA 3AKYA 4JS0A 3MGCA 4LJ5A 4DDWA 4QGHA 1QVAA 2ZUDA 3NH9A 2FN4A 3SBDA 4EJSB 3ZDQA 1OJLA 4QNRA 1RC8A 1AKEA 3NTUA 3NXSA 3FTQA 3IIMA 1W5TA 2B6HA 2Q6TA 3MWLA 4BLSA 2BJWA 2N46A 4LPSA 4I1SA 5C46F 4DEYA 3FKSD 4C9BA 2W0SA 5EE9A 1DE0A 2GDJA 1R5NA 2ZE8A 2WJJA 4US0R 4IVQA 4LBZA 5DSZA 4M1SA 3NEYA 4RD0A 3PUWA 4B2IA 4WOPA 4OYHA 3CUEF 2MMGA 5CLQA 4AG6A 5IDVA 3W6NA 4Y0AA 2CJWA 4JT2A 4Z1MD 3KQNA 2EW1A 1BKDR 5CK5A 2HCBA 2IW3A 3KTAB 1CJVC 3WBJA 2B7CA 1NVUQ 4KHZA 5JBQA 4K46A 2ZU0C 4TQAA 2D06A 2V7QA 3KKPA 3SR0A 2ORIA 3TW4A 3DPUA 1P75A 4LHWA 2HXSA 2Q3HA 5IF9A 3HPQA 5IT5A 4WBSA 2GZAA 1E9SA 4LHXA 5K8TA 3C16C 1U99A 2WICA 5C18A 1KSFX 2OT3B 3PXGA 5EP3A 4KITB 5A4JA 3O8RA 1AGRA 4Q4HB 1U0LA 2D62A 4ZCLA 3R7WB 3K8YA 3MCAA 5FOVA 4YMUA 1U2RA 4E22A 1KY3A 1Q1ZA 1KOFA 4PPQA 1UPTA 1G8GA 5KPJA 1W0KD 2QSYA 3PEVA 3ZGXA 2O8DA 4UQOA 2ATVA 1NMYA 3C15C 2MMCA 4ILEA 3FMOB 4TYPA 4C0BA 1AKYA 3PQCA 2OLKA 4I81A 3WRYC 4KODA 2OESA 1S1CA 1XMIA 3KFXA 1L4UA 4RSGA 4DCVA 1JAIA 1R5OA 3SQXA 2PCJA 2WJHA 3ZVMA 4DLUA 3K0CC 1NN1A 1MO5A 2OFOA 5DYIA 2ZU6A 3SN6A 3VR1A 4A92A 4B32A 3VAAA 4Q1FA 4URXR 4JLKA 3SI7A 2R65A 1P2VA 2Z6VA 3IUYA 3AB3A 3WP1B 1K5GA 2YWFA 4XVQA 1HYQA 3SFZA 4DLWA 2V1UA 1R10A 1UAAA 3KUCA 1RYHA 1FZQA 4TQ9A 1JQJC 1KKLA 1PLKA 3KL4A 1WCV1 2YWHA 4D26A 4IFBA 2OE2A 1LNZA 3EZ7A 1GUAA 4Q4HA 1AS0A 1E2DA 2ZVPX 3L43A 3NBZC 4IW3B 2QMUA 4XIGS 1QZXA 3GD7A 5H70A 4HZIA 4UNNA 4GI7A 1NVWQ 1JB1A 3EZ6A 1N25A 2BWJA 4QGFA 2XB4A 2Z83A 3EC1A 3SZRA 2GEDA 1N0UA 3DOFA 2ZTSA 3NHBA 1Z2CA 1QHSA 2IL1A 3GLFA 1VMAA 1F2UB 1CIPA 1E1QD 3OZXA 4WIAA 1P2TA 2VA8A 3IHWA 3VNVA 1DBSA 4NCNA 1TMKA 2RGCA 3PCRB 4A0FA 5FPKA 5JSZA 3MG9A 2H1LA 1VG9B 3I5XA 2X2FA 1G8HA 3H84A 4DDVA 4NKRA 1ZW6A 3OIWA 4XTCS 1XNJA 3CBQA 5DHFA 4MRRA 2ZPTX 4EJSC 3L0IB 1EFHA 4DVGA 5C2JB 1CF4A 3GQBA 1KK2A 4HB4A 4L16A 1HH4A 4BEBA 1T8TA 2QZ4A 3T35A 1VYUA 4NPHA 4UNPA 1UKVY 1OYYA 3ZD6A 2O8EA 3FWYA 2ASEA 2GXSA 3RC3A 1G3QA 1FX0A 1CJUC 2VP4A 3R7WA 4NYJR 5EXPA 1VCMA 4ERNA 1NJFA 3WRXC 4E5UA 1AZSC 3Q85A 1KI3A 1XRJA 4RJLA 4H9GA 4KSCA 2NPFA 3Q3JB 5EE1A 4F93B 4HATA 1IHUA 2CK3A 3BH0A 3QNUA 1XJQA 3K0AB 4WXPA 3EA0A 4IRUB 3SHWA 4NYJQ 2HF8A 3CH4B 3RABA 4EPRA 1CKEA 2PX3A 2PJZA 2C96A 1QHXA 2EYQA 1DS6A 4JKIA 4C3ZA 3A1VA 1G20E 1SXJA 5GVRA 3LBHA 1QHGA 5TARA 1P6XA 4JYBA 4D4MA 4N3NA 1ZIOA 4B3DA 1KDOA 1Q22A 1X1SA 4CZ2A 5IRCD 4D80A 2QP9X 1WF3A 2OCBA 3QXHA 6Q21A 1CR4A 5CIWA 4JZKA 5CYPA 4EDHA 1E2GA 1OH5A 2XNDA 5J4LA 3HU2A 3AVQA 3PUYA 1M1YE 2JLQA 1FP6A 2FFHA 4V0MA 2H5EA 2L0XA 2ZI9A 3UXMA 1TADA 3Q7PA 1KO1A 1G21E 1MV5A 1SKYB 3X1WA 4DCSA 1HUQA 4DLTA 4D81A 4CYMA 4DSNA 3GLHE 3RS4A 4BFWA 3AVWA 1N6HA 1N2CE 3LX5A 1R4AA 1QHHA 2WPDD 5AJXA 3WHLA 3BD9A 1XEFA 2RKOA 1FMJA 3T1OA 4A2PA 3THWB 1GG2A 2J87A 3FMIA 3QY0A 4M9QA 2PZEA 4OBEA 4D4LA 1XXHA 1VKJA 2MSDB 4DKXA 1DAEA 1W36C 5D3MA 4PANA 4DBLC 2A5FA 4II7A 4PC3A 3H0KA 4TL8A 5AK0A 3I73A 3THXB 3GLHA 2ZR9A 2GETA 4BZQA 4R98A 5ANRB 4WZ6A 3A1WA 3L0OA 4M1TA 4OQMA 1ZUIA 1YRBA 2C77A 4Q1AA 1I4DD 3IKJA 4IDQA 3KDSE 3ECCA 1XB2A 4FCWA 4ZDWA 1Q1BA 1XXHE 1E0SA 1ZM7A 5EE0A 1KI7A 1KYIA 1CR0A 3GCGA 2JDID 1KJZA 5HE9A 4FMBB 1UBCA 3NG1A 5FPYA 4B74A 2O8BB 1K6MA 1VTKA 2G0TA 2LKDA 2ZSAA 3RRNA 2GESA 4RD2A 1V43A 1DADA 1IN8A 2FE4A 3CRVA 2C98A 3X1YA 1J90A 3B9QA 3Q9LA 5EP2A 4BFTA 4AY2A 1NMZA 4I1VA 4OI0A 2QM8A 4FWIB 3B60A 1KI4A 5JJKA 1E2LA 1SKYE 3U7FB 1QG2A 5EZ5A 3QJYA 2XJ9A 4QL3A 2PLRA 2XB2A 4XWKA 2AR7A 1SVSA 5D3MB 4Z54A 1RJ9A 2PT7A 3T12A 2ZJZA 1I2DA 1E2QA 2BMEA 4LV8B 3GLGE 1CRQA 4BFUA 4TT3D 2OEPA 2NG1A 4Q18A 5B64A 2EYUA 2VL7A 2A5YB 4C0HA 4A0HA 3DM5A 2JDIA 3LW7A 3NKVA 3Q7QA 1MO6A 3BH7A 3NH6A 4GMDA 4NCJA 4PHGA 3C8UA 4OQFA 2A30A 3KKNA 2ODEA 5JJLA 4Q21A 3FPAA 2HDNB 2VSXA 3BORA 1G19A 2IS4A 3U6KA 1EFRD 4LWZA 1XXHB 3DKVA 1CRPA 3UANA 2GXQA 1YR9A 3GLIA 4ZI3A 5G3ZA 1JR3E 3C14C 4F4IA 3GLGB 1T3HA 2OLJA 1QHHB 1U0JA 4HDQB 5HCIA 5LD2B 2NGRA 1D6JA 3D31A 1MR3F 3EZ9A 4AYWA 1FMLA 2C5LA 2QL6A 3ONWA 4B47A 5CDFA 3TSOA 2ORWA 1NBMD 2P3SA 3O8DA 1WQ1R 1KSGA 5DN6A 5FUYA 3CRW1 1W47A 3IDQA 3LX8A 2CJWB 2UVQA 2IXFA 1QHYA 2VF8A 3GLIE 1WMSA 5L3RA 4NH0A 4PPGA 4BZXA 3P4YA 1IXSB 4IOMA 421PA 4B44A 3Q72A 4ZCMA 2XOKD 3LLMA 5HE8A 5EUQB 4A8JC 1RE0A 1E69A 3AKCA 4NCKA 4OJKA 2UKDA 2JLZA 3BFVA 4TYQA 1KK1A 4NMMA 4HUQA 2R6CA 3ZJYA 2VHCA 2QMEA 1RPZA 1CXZA 1D9ZA 3BB3A 2TMKA 3D6TB 1J8MF 1E9BA 2KWIA 3QKSA 4M0LA 3VMFA 1KMHB 3OEHA 4C0QC 2VEDA 1VCOA 2FPLA 1SHZA 2HLDD 2J0UA 1X86B 3SYNA 5CIQA 3OE7D 3N5CA 1VCNA 4G5RA 1W7AA 5AUQA 4L9WA 3WP0A 4MKFA 4B3BA 2IYSA 3I32A 3WMEA 1AS3A 2ZJAA 2ZRBA 2O8BA 4QXAA 3CWQA 3KB2A 4PQFA 4PAMA 2XSZA 3EXAA 1WE2A 3S1AB 1IY2A 4AKHA 3FMFA 2R6AA 1IJEA 1W4BA 4OI1A 1G9XA 4QM6A 1XJCA 2VP6A 2GEUA 2QTVB 1GNRA 5L3SB 2ZS7A 3U4QA 4D82A 4G01B 2AHOA 5E3HA 2EVWX 2GKSA 4H1UA 4KYIB 4EFMA 4MRNA 4MUBA 1ZINA 2IYTA 2HJGA 4JLOA 1E3MA 2QT1A 1NVVQ 1Q20A 4QG7A 3MLEA 2REXB 1DVRA 4GP6A 4US2R 2D2EA 3RS7A 4OHZA 4IEEA 3AF4A 1TF5A 1XX6A 1M6NA 2FSHA 4Q1CA 4TMVA 4A0RA 5CB8A 2D4HA 3FMPB 2X8AA 1Z0FA 3NEJA 4JLNA 3W8NA 4YXWA 2J0UB 5JFGA 2ZROA 2R62A 3U7HB 5IHPA 2OXRA 3NIBA 3IHLA 3Q5DA 3U7GA 1IXRC 4C0LA 1FTSA 2WJVA 3A4NA 3F3YA 3VR5A 5J4KA 3K9LA 1FQKA 4JSTA 5FTJA 1GRNA 4YMTA 4B3GA 4HAVA 2ZXUA 2QTFA 3P20A 2CDNA 1YZGA 1UDWA 1E2IA 2RHDA 3CM0A 3KZ1E 1ZM9A 3EPJA 3LFUA 1E9FA 1AQYA 2VF7A 5FI1B 1U8ZA 4M1MA 1WB9A 4DC9A 5HTKA 1NL3A 4KO8A 2JLXA 1ZCAA 4OHWA 4LRWA 3EA5A 1S9HA 4KVGA 4NYIR 4PQRA 2B8WA 2F1HA 1X8JA 4A9AA 1TPZA 4TMKA 1HV8A 4Q7MB 3BGWA 3KXLA 4DLRA 4QFMA 4KJZA 1U9IA 4IKEA 3AVXA 2ZRCA 1W1WA 2CLDX 1IY1A 1AS2A 1SQ5A 3THOA 4ZDIA 3ADCA 2JJ1A 2W6JD 4EPTA 2C03A 4XH9B 4URVR 2I1VB 1EFCA 2IX3A 2DWQA 2XZLA 4NP6A 1V5WA 2JLSA 4NCIA 5AJYA 3C5HA 1FNNA 1T5LA 2ZI6A 5F9FA 2F7SA 1GZSA 5FBQB 1GOTA 1JNYA 3LDAA 1N6LA 1MABB 1R7RA 4E03A 2DYKA 3UKDA 1EX7A 3W90A 3QKUA 4KLZA 3T06B 4LHVA 2BKUA 4XWOA 1DAFA 1Z07A 1YR6A 2CE2X 4ZKDA 2CEAA 1ZUNB 3CZQA 721PA 3T1TA 1QF9A 2I3BA 2ZQ5A 2WJGA 5B2ZA 5FBVB 1CR1A 1GDDA 3QXCA 2ZR0A 4FIDA 3RNLA 3RS3A 4HDOB 4B48A 1CP2A 1W0JA 1A4RA 4NE2A 3SOPA 4D6PA 1TF2A 2FEOA 2J7KA 1CJMA 1Q1EA 1ZP6A 1IAQA 1AGPA 1UM8A 1QVRA 2UZ3A 4GT1A 4N0EA 5GJCA 2QAJA 1FW6A 3B1YA 4C2TA 4AKIA 4M2LA 1KI9A 3I72A 2GJ9A 1DG3A 4Q19A 2KB0A 3I62A 2ONJA 2V8OA 2FG5A 4EJSA 2F1IA 4TTRA 4Q9KA 3WNDA 4L4UA 2VSOA 2QT0A 3ADDA 1Q21A 1XTJA 3OEED 5DISB 3VHLB 2YOFA 4JLPA 3QKTA 2QAGC 3QXSA 2YKGA 1YR8A 4P4TA 4NYMR 1SGWA 2JGNA 1Q3TA 4JLVA 2C9CA 2WWGA 2GJAA 2GNOA 1SZPA 4JLMA 3UK6A 1HEIA 2HXYA 3K0AA 1OH8A 3RAPR 4LK2A 4DDUA 2C8VA 3PEUA 1E98A 3MMPA 2KBEA 3GEIA 4MGKR 4NCHA 2P2LA 3QUSA 4LC0A 3R8FA 3AUYA 3THWA 1TU4A 3EPHA 2VYFA 4QM7A 5SZIA 3UG6A 2XJ4A 3NHAA 5FR1A 221PA 3ZIAD 2VIIA 3QKRA 4DSTA 2XXAB 5BN5A 1VYTA 3I1FA 1JI0A 2OFWA 2W2XA 2KI5A 2QMOA 4MGZR 4PSKA 3ZZUA 1W2GA 2P5TB 2RGEA 5GJVC 5BN4A 2W0MA 3VKHA 4L15A 1GFIA 1R0WA 4A6XA 4LJ7A 1D2NA 3SYKA 3ZVLA 1P61B 3FOZA 1XD8A 3IBYA 3B82A 1W48A 2P6RA 3QXJA 3GJ0A 4WW0A 2QPTA 1QHNA 4TLCA 1XCPA 3EWAA 2VP9A 3OFND 1GP2A 1R0ZA 4G5GA 4LUCA 3Q5EA 5HKKD 1II0A 2G0NA 3W3AA 1C9KA 3I5YA 3AVTA 4D4KA 4F91B 2F1RA 1GKUB 3ASZA 3BB1A 2GJ8A 3LVRE 4LSGA 3B85A 4HZUA 1Q12A 4NONA 2FSFA 4TMZA 5BN3A 3IQWA 2HT1A 2V4ZA 2QSZA 5JEDA 1MH1A 3KJIA 1OB5A 5F98A 3ND8A 3ZZTA 5FR2A 4B2PA 2C78A 2WMNB 4M9SA 4Q01A 5EP4A 1MKYA 4E09A 2XXAA 1IONA 5M04A 4YDHB 1F2TA 3VTKA 1S1MA 4KYUA 3JZAA 1S0UA 4QJ3A 1QG4A 4B6FA 2BCGY 4W7SA 5EP1A 1JBKA 1Z3IX 3KFVA 2RGAA 3PR1A 4JLAA 3I8XA 1X6VA 3H2YA 1E9CA 1Z6XA 1J8YF 1NN3A 2YJTD 3H1TA 2G83A 4JJKA 5LB4A 4B33A 3CX8A 1G3IA 3AKEA 3QG5A 1N5KA 2F9MA 4JL8A 5JS8A 1IN5A 2BMJA 4A4DA 2OCAA 1Z6AA 4EQ6A 1BIFA 2BM1A 2VTKA 2K5UA 4TL6A 1GRRA 3B6EA 4PSVA 1W44A 4R2HA 2LWIA 2CCJA 1DOAA 3A36A 3IIKA 2X77A 2QAGB 5TVKA 1D5CA 3DDCA 4KBFA 1JALA 3JZMA 2BEJA 5AJZA 5JECA 3CNNA 1YZLA 2CBZA 1BYIA 3ZYCA 1G8FA 1BOFA 5JS7A 2NPIA 2MSCB 1NIJA 2VP2A 4GBMA 4Q66C 1XTQA 2ODBA 2VP0A 2CE7A 3TGPA 2PZGA 5CJ2A 3M6AA 3RWMB 2MSEB 3LW8A 2XNSA 2GCPA 2ZJOA 4BPBA 2PBRA 2ZRKA 4FN5A 2WVJA 2B7BA 4FWTA 1L8QA 1CLUA 3WNCA 4O0MA 5E7JA 1C4OA 3L82B 1JEDA 4MRPA 4LHYA 4A1FA 3GP8A 2BDTA 2BMFA 2HUPA 3NWJA 2FDCA 4BLRA 4Q1EA 2ODWA 4YXWD 5F3WB 3T1QA 2N1BA 2IEYA 1IQPA 3MAAC 3IQXA 1G18A 4JBYA 2ZE5A 4WZBE 3L8YA 4H1VA 3X1ZA 3K70D 1VG1A 4NHOA 3K0FB 4MH0R 1K8RA 1OPXA 3ADBA 5FOUA 5L3QA 4WZAE 3OEHD 2V3CC 2ZAMA 1R2QA 2ZR7A 1Z28A 2ZI3A 2NO0A 2QA5A 3AF0A 3THYA 2OAQ1 3NBXX 3K9NA 1Z47A 2V1XA 4Q7KA 1US8A 4DSOA 1G64A 2XITA 1YRAA 4MYHA 3W3ZB 2CVFA 2EFGA 1HE8B 4B6EA 1XF9A 4IXMA 4G5QA 5EXSA 3GPLA 3QVVA 1O87A 3G82C 4POAA 4LCBA 4V0LA 3REGA 1GNPA 1SXJC 2GA8A 3SJBA 4LBVA 5KU1A 2GJSA 4LOAA 1CJTC 1XTIA 1NBME 4M8NE 1CTQA 2WJIA 2HYIC 2ZYTX 4M1KA 4PO8A 4HB0A 5DHAA 5TMPA 4Z8YA 3EC2A 2R6FA 3RSLA 3OIYA 2LCFA 3W5JA 3CKLA 1LB1B 1ZD9A 1LS1A 4LJ9A 5DI9A 4ZDKA 4BGDA 1SVMA 3OE7A 1PUJA 1TNDA 2XEXA 2Q3MA 1QDEA 3KTAA 3PG5A 1GIAA 1F2UA 5L3QB 2F43A 1ZC4A 2G77B 1CR2A 1GSIA 3BC1A 4ZKEA 3X2SA 5KSOA 5KYKA 1YHNA 3A1SA 4V0KA 5G41A 2FV8A 1JXOA 3ZVRA 4KVAA 1KHTA 1XEXB 4BEJA 2RAPA 3TMKA 1DELA 5G3YA 3CNOA 3CLVA 3TUZC 1OF1A 1R6BX 2ZYWX 2F6RA 1H8ED 3RRMA 3A1TA 3B2EA 3J81k 1E0AA 3EW9A 4CDGA 4UXHA 3EARA 1EX6A 3BRWD 3A6PC 4QGGA 1GWNA 5DH9A 2V6JA 4P0TA 2O8FB 1G5PA 3KUDA 3MUFA 4KU4A 3QPVA 3C4JA 1NJGA 3UWKA 2RB4A 2F3TA 1G3MA 3TR5A 4NBSA 4C0JA 1Z08A 1TQ4A 1UEIA 1UADA 3B78A 1Z06A 3CW2A 4XSGA 5AUOB 1GM5A 4LBYA 1QBKC 2HLDA 2VO1A 5KDDA 1OH6A 1NG1A 3L0SA 1XCGB 3DZ8A 3AKDA 121PA 3SJCA 3ZIAA 2O0KA 4U5XA 3QXXA 4BE7B 4XVUA 2DR3A 3ZD7A 3HJNA 2KBFA 3QVUA 3EIEA 4XTRA 2CNWA 4RFSB 3KXIA 1C1YA 1FQJA 4DLZA 3GJ5A 3R9WA 1NLYA 2ZSDA 4YC7A 3U3JA 1KAGA 2GF0A 1E2KA 1ZC3A 1W5SA 1N0VC 3ZLJA 1TQDA 4AK9A 2QGNA 1Z22A 4FMCF 2IUUA 3VHXA 1XTSA 2E87A 1F3OA 3EZFA 3OF5A 1ETUA 4DEXA 1KMHA 5DGXA 4QBGB 3E70C 2HT6A 5FTMA 4CT5A 2WKQA 4RCZA 1DARA 1E2NA 4KI0A 1SVLA 1KSJA 2GXUA 3UMRA 2G1KA 4GDFA 2GEVA 3VNUA 2DHRA 2FFAA 1EESA 1OFIA 4B35A 3GLGA 1YE8A 4TZ6A 3C7KA 2W6IA 1TL7C 4E07A 1XJ0A 3QIAA 2H8KA 4KFRA 4TTPA 5HCNA 2A5GA 1G4UR 3RRZA 3EIQA 1ESNA 3E1SA 1E6CA 4NL4H 4TMWA 4UJ5A 3LO5A 5L3SA 1OXTA 4JSYA 4CT4B 2WIBA 1EWRA 5D3QA 3WXMA 5BYKA 1CS4C 2R8RA 3P32A 1WRBA 2GJKA 2HEIA 3TUJC 4AD8A 4LI0A 2P0EA 1ANKA 1HT2E 4P32A 3RDPA 3S1AA 3AVUA 2P67A 4MDFA 4A8JB 1N0WA 4GSYA 4ZO4A 1UDXA 4Q1DA 2WSSD 2A7QA 2IXGA 2WSMA 1IN4A 3WBKA 1JJ7A 2XX3A 2IBMA 2IYZA 4JL6A 5DIFA 3V4FA 1OW3B 4OHYA 5J4VA 3AF3A 3QF7A 3M1IA 2VHTA 3MFYA 3EPLA 4PAQA 5CDFE 4ASUD 2IYUA 4PXAA 1G6OA 2FSIA 2RGXA 4TLDA 3WYAA 4Q02A 3KQUA 4G5OA 2N42A 5EE5B 2Q9AA 3T15A 3CF6R 1YKSA 2GZDA 2IYXA 3B9PA 2B8TA 3EPKA 3IPYA 3LA6A 1EGAA 1SVWA 3RLFA 4B43A 4DIEA 3CF2A 5KNBA 3B7GA 2AFIE 2DWPA 5H68A 4C2UA 5SZJA 4ZPXA 3AGQA 2EFHB 1FL9A 4XJXA 5TV2A 2OAP1 4MUAA 2YOHA 1IY0A 2GTPA 1MOZA 3PENA 2G1JA 3KJHA 4LYJA 1KI1A 1II8A 4PX9A 3A58B 3GFPA 4QHTA 1R0XA 4DLYA 3UMSA 4ZIRB 2KSQA 5CLLA 5CITA 2ZREA 2PEZA 4C0SA 2WWXA 1LVGA 1XWIA 4IOKA 4RD1A 4EQ6B 1UKYA 4ON9A 2O0HA 4LBWA 3MJRA 2ZI4A 1EK0A 1JQLB 3LQQA 2AD1A 2ZSBA 3B1ZA 3FHOA 1EG7A 4DLSA 821PA 2F55A 3TH5A 1P2UA 3KQHA 3IBGA 1Q44A 3GJXC 5B30A 1KDPA 4X8OA 1BH2A 3QPWA 2GHIA 4MKHA 1WBDA 3A8TA 2OM2A 1MO3A 1ZJ6A 1SXJE 4DT1A 3BERA 2AL7A 2W6JA 2FX3A 2QENA 5FFMA 2CL6X 1ZAKA 1NY5A 1ZRHA 4JBWA 4LDJA 3AVYA 2GBLC 2WM9B 3TR0A 4PHHA 4Q4JA 4PR0A 3GLHB 5LBIA 3PEWA 4L5BA 3DVLA 1RVDA 1E2HA 3FYHA 1XZQA 3AP3A 4A8JA 5KNCA 3L0PA 3TQCA 4R9UC 5FL7A 2GAOA 1M7HA 2J45A 4JMPA 2R2AA 2NMVA 4KXFB 4YMWA 5HKKA 521PA 4NU0A 1G3UA 5EXXA 4JVNA 2H57A 1E1RA 2DFTA 1RKBA 4IOLA 4F4JA 3LWNA 1DO0A 2RGBA 1IOZA 1FP7A 1OKKA 1R8SA 2O8DB 2OG2A 5JSZB 3LBNA 1N5LA 1JPNA 4GRAA 2BBTA 4XOIA 4BLOA 2CVHA 1YR7A 3OIVA 3GJ7A 1R5BA 1RRCA 1US8B 4QHSA 1CULC 1XPRA 2RGDA 4MGIR 4CW7A 3CPEA 4A6PA 1OHHA 3LV8A 4XSHA 1KI6A 2BBOA 5F2EA 5FOTA 3FKQA 1J7KA 1L4YA 1T91A 4QJ5A 3RVBA 3U44A 1S4QA 4Q4JB 4PZYA 3TKLA 4DRZA 1MRNA 4G1UC 3DMDA 1N6PA 5JWHA 2GWHA 4EAQA 4P3YA 4TT3A 4MGYR 1JR3D 4BRWA 1SVKA 1GVNB 4L9SA 1GKIA 1GNQA 1FUUA 4MYUA 1A2KC 1M8PA 4BZPA 4B71A 1A82A 2J41A 2RH5A 3T1VA 2AK2A 2OO7A 1KJWA 5KSPA 2PL3A 4UKDA 5KOYA 1KK0A 4DSUA 2DBYA 3K0CA 3U60B 1G16A 2BHRA 4KBGA 4ZIRA 1NNEA 3KKMA 2FMXA 3G5UA 4OHVA 4PAOA 1ZNXA 2QUZA 4P4SB 3FE2A 3GJ6A 1WBBA 3IPXA 2KE5A 5AUPB 5KPDA 2J5XA 2H16A 3BFXA 2C9OA 4URUR
chains in the Genus database with same CATH superfamily
1GKLA 4PPNA 5HOQA 3I5MA 1YXMA 1FXUA 1QXSA 2BV3A 1KS9A 1Y63A 5EIBC 1Z0KA 1Z13A 2P5UA 1Y80A 1T2NA 4OQXA 4INAA 1K89A 3FYCA 2SECE 3KOZA 1E6UA 3ZS8A 3CF0A 4LX8A 2CXRA 1PUIA 2GM3A 4UFNA 4XUCA 5E7IA 4ARZB 4YCNA 3I61A 2QORA 5CTJA 5IKOA 3KVYA 3UQYS 4F4UA 1AKUA 1B0UA 4A82A 3OE5A 4YJFA 1IM8A 2CGEA 1TJYA 1VMIA 3GHYA 1LC0A 3OZTA 2FLWA 1B43A 5I7AA 2R1VB 5CT8A 1U3VA 2PGDA 1Q0ZA 1T5DX 4YY3B 3PD1A 3HYRA 2YH2A 4WA7A 1W1UA 3F5DA 4GWLA 1HRKA 4J0CA 3K4PA 3RRYA 4DV7B 4EMTA 3STVA 5I48A 5BUCA 2O2JA 2ATIA 4MA5A 5DLDA 3OU7A 2IS1A 1P8JA 2FFRA 4Y6RA 5JCJD 2OQRA 2W2NA 1QVVA 4DG9A 1E1DA 1JECA 4GZMA 4JBXA 1A5AB 3GI1A 3NVAA 1RHMA 4ZI7B 1NNSA 4H4DA 1HM5A 5KVCA 1B6SA 2I7XA 1PE0A 5C35A 3MA0A 4KQ6A 1OTXA 4ZI5A 4HDRB 4ZD6A 1W5EA 5FI0B 1TQ6A 4DLNA 1N4DA 2MDTA 2RJNA 3D8HA 2ZK7A 4PSDA 4ZVMA 4F92B 1DHTA 2ILTA 3DB1A 1GL9B 3MT0A 2H92A 2PIAA 1FSFA 2ZIEA 2ZTMA 4H3KB 1C50A 2P2CA 3GRYA 2XOXA 1AXEA 1V5GA 3OM1A 3ZLUA 4MITA 4XD7A 3P26A 3AQIA 4PLZA 4KX5A 2IWRA 5U9CA 3WLIA 2BGNA 1TC2A 3O95A 2HA7A 1WP4A 3BMNA 3ZCQA 4P80A 4R01A 2EZ9A 4B84A 3P2JA 1O9HA 1YQGA 3OAAD 5HBGA 3PNSA 5KNBH 1Y5IA 4LNUA 1E79A 3IIIA 4G41A 1O5IA 1OSNA 1SG0A 1Z5VA 3P96A 5HW0A 1EJ0A 5DYGA 3SLGA 2AG8A 3RS8A 1JDNA 2QROA 2QN9A 3COZA 1GUDA 3E15A 4LSZA 1VGQA 3PDIA 3VOAA 3VR2D 3FB4A 5JTTA 3SC2A 3IEUA 1V8PA 1YCDA 2IH5A 4E5YA 2JLRA 2Y68A 3OLYA 1GCAA 1QHIA 1YJQA 1ZBDA 3KV1A 4JR2A 1RZVA 4TSFD 5BV0A 1DXYA 4Z86A 4IYRA 3E7DA 1ULTA 3E84A 1K5PA 2FSVA 2B35A 3LG2A 4TMYA 5DGHA 3KWFA 4RFSA 3GLSA 3QYAA 3HM9A 2FEWB 1W9HA 1KSHA 1OGYA 3NANA 3UFXA 1SPBS 5FB3A 1DEHA 3N2IA 4EKNB 2GK6A 2BGJA 3N59A 1SU6A 5A04A 4QFDA 2WZCA 3QKWA 2LPMA 3M3DA 3TAHA 2YZGA 5FTKA 2QI9C 2OZLB 2PWZA 3R4VA 3RVRA 3T5DA 2YHUA 3HLYA 3TVTA 4ZV4A 5IJWA 3D8BA 3AFMA 1AHHA 1B8VA 2NSDA 1NVBA 2ZFUA 2XQKA 3BCUA 4UQPA 2PJDA 5AI6A 4ZJUA 1ODLA 1TW2A 1X7ZB 2FPUA 5ECWA 3GBSA 4JYCA 4ED9A 3QJGA 3E7XA 4LX0A 2BW0A 3OOSA 1ZITA 2VRNA 2WQZA 3LDFA 4CLXA 3DSRA 5A02A 1RFGE 3WKEA 1BMFA 3A3NA 2QAGA 4EKEA 3KT6A 2WWYA 1CDDA 1PWZA 3SQLA 1ZL2A 3AERB 4FDAA 3TOVA 3OMXA 2O5RA 2VYVD 5LDGA 4AYXA 4FZ5A 3VKUA 2R751 1M1XB 5BNTA 1BA2A 3HKBB 3O7MA 4IIUA 3FNQA 2YBEA 4JKYA 2XLBA 3GGDA 3UFBA 2RHWA 4DIDA 4DM3A 5IZCC 2GHQA 1B1AA 1KI2A 1JG1A 3OTGA 3U4MA 5FPQA 4GKJB 4BP3A 1PVOA 1XRRA 1NVFA 4TLBA 5JC1A 5IFKA 1U31A 3L7MA 1MG5A 4IVPA 4U6NA 2H2WA 3CF4G 5SZHB 1KEZA 3RYTC 1PUXA 3GEEA 1W2WB 3CKYA 3JVVA 1DFIA 1X19A 2Q21A 4OJQA 1Z0ZA 2IGBA 2JNWA 4O2RA 3VX3A 3U9SA 4YUYA 1N2HA 5BT9A 2IS2A 3IC5A 1Z74A 1ZXBA 1G7TA 5JWOA 3ZU6A 4MR8A 4WOBA 4LRTB 1LSUA 3DEFA 4HDKB 2A4KA 5I9BA 3V9AA 2ZYHA 3DTVA 2CLCX 4KO1S 4BMSA 1ZN9A 4R9VA 1R0CA 4IXTA 3NTVA 1KDYA 1B0ZA 1M34E 1X7DA 1TMGE 4IDNA 2Z9CA 1T3ZA 5FD8A 4HAXA 4PN3A 3PNBA 1QG0A 3JR3A 1QO7A 2P6MA 2V0CA 2FNAA 2YYSA 4LV6A 4MLPA 2BEWB 4W82A 4CG3A 5C3MA 1MZPA 1T8UA 1PZNA 3R7LA 4B4UA 5JWRA 3K2BA 1KAEA 2AIRA 3AY7A 1U90A 4BLWA 3ZIDA 4E4TA 2J5KA 1OMOA 1Q57A 2JK1A 4AS2A 2QTMA 3H5AA 2XSZD 4CT0A 1UPCA 1AO0A 2O2HA 1IB6A 4D6YA 4LJ6A 3GDOA 4WNCA 5JXWA 3A1NA 3EF0A 4WVLA 5C7IO 4P4UA 2AOTA 4X8LA 5DBEX 2Y2VA 3EIWA 3T5MA 1K5DA 4MR7B 3ZNNA 3IKTA 2AQIA 2D7DA 2D00A 2QMYA 4JT4A 1QK4A 1RQRA 3EYAA 3IAHA 3QYFA 1DLJA 2NZ8A 1G5IA 4LDRA 1TZCA 1JHVA 1ADJA 1BTOA 4NBKA 4IMPA 5ESDA 5CFNA 5DT9A 2ONKA 1RI2A 5BOSB 3K2IA 4PXSA 5EVJA 4MI1A 4A23A 1NA5A 4CEHA 1CY0A 1GL7A 2Y92A 1C7IA 4DR1B 2X0JA 3M49A 5TQ0B 5IKXA 1U2QA 3GO4A 2AKYA 2J4FA 3HUFA 2YQZA 1KK3A 1ONBA 3IA7A 3MWGA 4QLAA 3QKRB 4UVGA 5TB5A 3RTGA 3SICE 4L0CA 2IIPA 2LIPA 3AJ8A 3M5CA 4MEBA 4C20A 1TX4B 5JNRA 3GH3A 1JDBB 2P68A 1RAAA 3GCDA 4FMDF 5HCUA 5KBYA 1BD3A 4H59A 3P9QA 3IXQA 2FJPA 1SCIA 1QYXA 4MMYB 1J8VA 3EDCA 4LV5B 4B45A 2PHZA 3X1KA 2UUOA 3INRA 3QFFA 2Z04A 1JFVA 2Z3VA 2O8CB 2ACEA 3A9TA 4MI6A 4I4CA 5ALDA 2RG1A 1BX3A 3CRQA 4I08A 2Q3FA 4M46A 4HNGA 3E9YA 5B4TA 2FH5B 2VJKA 4TUYA 2R66A 1NMQA 2ECPA 3ZGLA 4I4TA 3BIXA 2PKWA 4FI3F 1WKBA 1ULSA 2WSLA 1E96A 1QO9A 2PAFA 3ZI0A 3ZQ4A 2YC2C 1U9IC 1K6IA 1NKVA 2CEKA 1JBQA 2JJMA 3F8SA 4PC6A 4BO2A 1EFLA 2VDJA 3C5EA 4FHCA 4UBJA 4O6VA 1LA2A 1L8XA 2ZBRA 1II9A 3AEUB 3NTXA 1RKUA 3I28A 1IM2A 4OIFA 4CCAA 4B3FX 2C7RA 4R0NA 2W2OA 5EZ6B 7MHTA 4AY6A 2NIPA 3WWYA 4RZUA 4RLSA 3O2JA 3L1IA 4GYJA 5KYTA 3QNWA 2Z98A 1C3OA 2Q0QA 2DH6A 1AB5A 5I4BA 4DR7B 1G7SA 2C2ZA 1V3VA 4KR9A 1AJEA 4MLDA 1U9JA 3QGMA 1UT8A 1ML3A 2FHSA 3IEVA 4Q9JA 1XJWA 4TWZA 3UAVA 3F47A 1PR2A 4LJRA 4NAVA 4L9AA 2P9QA 1J70A 1ZGGA 3GV0A 3IXLA 5E2IA 3VU9B 3NVMB 3GAFA 3GRZA 4PRZA 4HQOA 5E4TA 1TO6A 4AIIA 1GQYA 5FTNA 1LPSA 3Q9UA 1MIHA 3S44A 3AP2A 2G07A 3CR7A 2PD6A 2WDZA 3M5PA 4C07A 1QX4A 5IJ9A 4LN1A 4RELA 1U4NA 2YC4C 1GZUA 1SCQA 3SSAA 2R7MA 5T8KA 2ODPA 2FDRA 2QRQA 5EWJB 4WPGA 1W0KA 1PWEA 2NYVA 4FEGA 1I3KA 1X92A 3DZFA 4RXMA 4ESVA 2R97A 3DLPX 3HVKA 1FFWA 2PJRA 4MB2A 2CLHB 4QJIA 1A0OA 3SC4A 1IPEA 4B4DA 1XCOA 1YZHA 2MYTA 3CB2A 3ZH9B 3I1JA 3FCAA 1VHLA 4UTVA 2AJDA 2E3JA 3ZTTA 4DLXA 3OKFA 1TCVA 5CT5A 3K9FC 3WGIA 2CDRA 3CB4A 5JLJA 3K09C 4Z9BA 3GJ3A 2RARA 5HP4A 2JB9A 4JENA 2DWOA 3RYCB 3GLIB 1U63A 5CYOA 4OL0A 3G23A 3IA2A 4DMMA 2GZHA 4W6QA 5KCMA 2IYLD 2OZEA 3NPAA 5IW8A 1VDZA 4ITVA 3SP1A 4MUXA 3U2QA 2W6ZA 2Q9BA 2J59A 1AKVA 1YB4A 3KSMA 5KI6A 3L7IA 5AI0A 2RI6A 2HRBA 3SEAA 5JBIA 3PXEA 5HRAA 1P7CA 2IHJA 5DULA 1M7GA 1QR2A 3O93A 1VLVA 1WBJB 3H2ZA 3HCCA 4HN2A 4PSCA 1Y1LA 4G1MB 1N77A 5FFNA 4RY9A 2JJ8A 4U6SA 4EB0A 3PHIA 4P38A 1IJFA 2QU8A 4PBRA 4YWJA 4BB6A 5JZBA 3CH5A 3T9BA 4DS3A 1KMQA 4PO9A 2Q1UA 3ZKWA 2XKKA 4QOEA 3V46A 3EY9A 3G5TA 4J4HA 2JBAA 5U1PA 4BKMA 3I4FA 5HPYB 1W1IA 1YB6A 4HLQB 3UWPA 5HJEA 4Q4DA 4HSGA 5HXAA 4WVFA 1NNLA 3CY6A 1R0KA 3C6QA 3DOCA 1WXDA 2B21A 3GYGA 1OX6A 4BNXA 5FOSA 4E51A 1YFLA 1XZ8A 1QLHA 4ISCA 1W4CA 3PDIB 4TL9A 1JWLA 4EG0A 3AVVA 1D2RA 4GX5A 4C89A 2PY6A 5HK9A 5GZ6A 4FPXA 4CEIA 1QOPB 4G0PA 3AM5A 4Q3CA 1OROA 2IVFA 2GKOA 2QVCA 3KALA 1ZI6A 4G4SO 3KSAC 4FW9A 3IEPA 1GNSA 2FFQA 4O02B 4C0AC 1EGHA 5L8VA 3FOZA 1A2QA 4GXTA 4DHEA 3TW6A 1UWCA 2IRWA 1A7JA 3IURA 1QTIA 2J9FA 2FZGA 4U9IS 1JE1A 3HDTA 3RI3A 5BMOA 3ASYA 4YLGA 1XVIA 3BWXA 4DCOA 3OCWA 1S8NA 5CPFA 1N0HA 2HJSA 3U1TA 2JFBA 1IH8A 3HWWA 5AFSA 3ASUA 8OHMA 2OFXA 5KO2A 1M0EA 4LZLA 4ZJYA 1Y42X 3MWEA 4HGQA 3HJHA 1GZ5A 2AJ8A 4XFKA 1HY3A 4NJEB 1SUFA 3RYHA 3O4GA 1K8ZB 2VPQA 4LOJA 1S02A 4LYDA 4QPCA 4UUOA 2F43B 2D5AA 3QOFA 2CLSA 4PC2A 2YMPA 1P7WA 1UBJS 1Y33E 1XLVA 5BSMA 2C3UA 1EMDA 3ZTYA 1SUEA 2RJ3A 4BNHA 3MQFA 3UOWA 1P1FA 3GNSA 4YAIA 4ZYWA 2A9VA 1NF3A 4NYMQ 4EYSA 4S1OA 1PWHA 5AJVB 4J1NA 2X14A 2WU8A 2X1LA 2JJ2A 3TZQA 3G0OA 5DWVA 2G76A 3T7IA 4S24A 3Q2OA 1V11B 3Q6NA 4MYCA 3WWOA 4A5OA 5LYJB 2P5SA 4V0SA 4F2DA 2EF0A 4IKOA 3ANMA 4BLTA 4DZZA 1GGJA 4Z99A 4HGNA 4I9FA 1WV1A 5TR9A 1Z7EA 2QY6A 1W9MA 5JRJA 4ZZIA 3FCCA 1B2RA 1OFTA 1BWRA 1NBMA 4ZMRA 5I01A 1BS1A 2B2CA 4DOMA 1JS1X 5C4GB 4JQSA 3LQ1A 2HK9A 3PJGA 4J7AA 5D00A 5T6MA 1DQZA 2WYWA 4JH0A 3F8TA 3ROXA 2IUYA 3VH4A 1T6BY 4WFKA 4HEQA 5JNWA 3SFTA 1BDMA 2SCUB 1IBCA 2I66A 3ABOB 1E9DA 3JAKB 1AZTA 2HY7A 5JJ5A 3PEYA 2JI8A 2WWWA 5GONA 4NU8X 2X2EA 4E21A 5ERYA 4MARA 1KJNA 1EHYA 3JWGA 4AN1A 3AR8A 4PW0A 4ZOLB 3USZA 1J5XA 5IVKA 3K2QA 1JTEA 4RQBA 4E94A 1A72A 1GTVA 2QX8A 3A6KA 3GJSA 3IAFA 4LE0A 1YZKA 3OHMA 3QU2A 2D1SA 3CUWA 3U44B 1DQRA 4LDZA 1UBTS 3RFUA 2Q9UA 2V7UA 2VLBA 4ZQHA 5B3KA 3JAWA 1EFPA 2BE9A 2HBQA 5IDXA 1UAGA 2EJCA 1M76A 1VL2A 2I71A 3B1FA 3A9SA 5K03A 4B79A 4FFLA 1H1DA 1G8MA 1MAHA 1RYYA 2HV8A 3UIEA 3CE9A 1SXJD 5AVYA 2MYPA 2WIKA 5ABPA 1X70A 3IGFA 1XD2B 1W75A 3N76A 2IBSA 2IHYA 4V03A 2V5AA 4B4OA 2XCIA 1J33A 4D0RA 4A15A 2BELA 2PH1A 4HYYA 4BE9A 4LF4B 3PFCA 2AZXA 2XMSA 2ZRGA 4LPKA 2R8PA 1DI0A 1I5EA 1H8EA 4WAUA 2NO7A 4Y1RB 2CCGA 4IWXA 3WBFA 4MV7A 3MWFA 1UP6A 3RF6A 1YJBA 3JW8A 4N1AA 3JSXA 4H7DA 4CLOB 5KHLB 4JLUA 4W5OA 4YJKA 3HMQA 5HBRA 3THXA 1FSZA 2IXBA 1KBQA 2JJ2D 5A5VA 2BMDA 1Q0RA 3D4BA 2AVDA 3KWLA 1O97C 1X39A 3DWFA 2BR3A 2QX6A 1E0JA 2CMGA 1AC5A 1Y8RA 2X1VA 3EVNA 1LRKA 1QRSA 4TKVB 4B3CA 1E60A 3KYCA 1LBTA 2G25A 2AN3A 4R1UA 1RM3A 2QG6A 3SJ7A 4QRHA 3HR8A 1GUFA 2AJLI 2ENWA 4N0DA 4WZBB 2SBTA 5SZKB 1PS8A 2YZMA 3HDYA 4WEQA 4IWYA 5C1BA 4B3IA 2HSEA 1GFSA 4H7HA 4BRSA 3SS8A 1NJ2A 5IASA 4HGOA 2FZLA 4M38A 2ZM5A 2ZSHA 4NK5A 1ULHA 4R6XA 2K87A 1Z6TA 2Q2NA 5K99A 4PSUA 4LAFA 2AG1A 1XMPA 4AJ9A 4W5RA 1EFVB 3BSWA 1I1NA 3UFXB 3UTDA 2PUDA 1NBEA 1JYEA 1S2MA 1X7YB 4B9AA 1Z2AA 4WK4B 2WIGA 2X8WA 2M32A 3VZQA 2DVMA 2M9MA 1C0EA 4JDUA 3UPUA 1WMDA 2Q9CA 1D8TA 2K2QB 4M22A 1I9CA 1SVOA 3KQMA 5AWFC 1HNZB 3ORFA 2HREA 2O0JA 1Z45A 3NNNA 4FOOA 3PXCX 4R7GA 4BB9A 3H7IA 2QVLA 2A0KA 4EYEA 1VHDA 1DQNA 4KZKA 5ALFA 6ADHA 3TZBA 3DE1X 3NORA 3NHZA 1S3GA 4OL9A 1PTJC 3CCFA 4EUHA 4I6EA 5HQ3B 2I62A 2AQ8A 4RD3A 4K26A 1S96A 1GVHA 1KEKA 1CY4A 4QGAA 4DR2B 4KVFA 1G5QA 1XI2A 4EGQA 4Y2TA 4A5SA 4H3VA 3STTA 3HG7A 1TCCA 5ALIA 4EFNA 4M4SA 1Z0DA 1MTZA 3GJQA 2A3RA 3ZY3A 1L0BA 1UBEA 2FEMA 1TI7A 5MGNA 2CUKA 4B2YA 2WC1A 5LJIA 1NF8A 2DCMA 2W6CX 2F17A 1OIWA 2FW8A 3CNEA 5TC4A 3ROMA 3A70A 4EY6A 1DTSA 4WK0B 3FW1A 2ZAYA 5FUQA 1FP2A 4FI3C 4F1JA 3GLFB 2W00A 4JP8A 1NU8A 3L6RA 1NVVR 4P33A 1UXHA 2ZVJA 5NLLA 3QU5A 1G2QA 1GKYA 1R6XA 1GXSB 1NWCA 3G0GA 3CVVA 1LWNA 3YASA 3VTFA 2Z4TA 3HLKA 3N6RA 5MDHA 5JZOA 3QM1A 4CCYB 3OCJA 4G37A 2B4KA 2OHXA 3CT4A 1QP8A 5DNAA 3W1VA 1C30A 3H05A 1GCGA 3EB9A 4MINA 2IWHA 5LYJF 3BMOB 4Y2GA 1GPDG 2ZCVA 4P35A 1FMTA 2JFHA 4D8YA 1BZYA 5DF1A 3PL1A 5TSDA 4YIKA 3BB4A 3QEBZ 4N0PA 4FOTA 1QK5A 4MVXA 4HB3A 3JZDA 1FQOA 3DXFA 3TLJA 4TV9F 5FO0A 1A1VA 1BDHA 3UT0A 2IHVA 1T8SA 3DDOA 3MBIA 1DC5A 4X3PA 5J40A 2BFPA 3G2LA 1TU3A 2HMTA 4EW1A 1FFXB 3UO8B 4MUJA 1P4HA 2PYDA 4AKGA 3DZIA 3FFTA 3KUKA 3MUOA 3GLQA 1BQ4A 4KG7A 4RTOA 2BE7A 1PN3A 4CQNA 1P2FA 1ZCBA 2FZVA 4HMQA 4LY6A 4DBZA 3UW3A 3QLVC 4XVRA 1BGXT 1IRIA 4AC9A 2IEAA 2I91A 8ABPA 1NASA 1Q95A 2GAIA 1IBRA 3DFKA 4HYQA 4GNRA 4X63A 4HWSA 4DIKA 2BN4A 4Y9SA 4NDZA 3D0OA 3N8GA 3SWWA 3LQYA 3VV2A 3ONFA 1SY7A 2VYNA 2HQBA 5I9IA 4F8EA 1UCFA 3F9RA 3CVJA 3VVCA 2L17A 5KTSA 4QJ4A 5DTRA 2KYRA 3GR6A 3ZDDA 3AFIA 2WUFA 3AM3A 4RVSA 5C52B 1M2WA 3L1HA 4FFBA 2XYPA 1VYHA 2QTVA 2QD1A 4XDGA 5LOVF 2BRUA 2FPSA 3F2VA 4KXXA 2VTBB 3UMYA 4N0MA 3ETDA 5I51A 4FZVA 1E7WA 1RYEA 7YASA 1N2XA 2W6ID 5AJWA 4L78A 5DI3A 3EOZA 1DAMA 4HBZA 4O4IF 5K6AA 3O8NA 1F0YA 1VJGA 4M7PA 1S2IA 4WASA 2OV2A 3JQ7A 1OE0A 3RSZA 5AM2A 2IYRA 2AZMA 1IHXA 2FFJA 4IIVA 1IATA 1Z34A 2PG3A 1QRDA 2XBUA 3L7KA 2EBUA 4YAOA 5CH3A 2OYCA 5CB6A 1WD7A 3I6QA 2XCRB 4NCAA 1FTWA 4BMVA 1FUIA 5A0VA 2CFTA 1Q7TA 2FW7A 4U63A 2ZUWA 1EFTA 1ZNZA 1HZJA 2C0CA 4GI2A 2WLTA 4INOA 2H7XA 4KFTA 1U8YA 1CY8A 1WZUA 4AWXA 3LSTA 3UWOA 1CZNA 3WIOA 4TZKA 3KX2A 4Z4CA 4E08A 4P5DA 4TRMA 4YX9A 2QS9A 4OU4A 1PHRA 4UAUA 2R47A 4AF8A 3IEKA 1Z39A 2A1UB 5K6TA 4R4JA 1Y6RA 2CWDA 2XODA 3O1JC 1GPJA 4Q4CA 3PGA1 3CUTA 3QMPA 1LF5A 2FSUA 2YS6A 3ESAA 4QUIA 1JXMA 3HGMA 3KR0A 4V0OA 5F7JA 2C7VA 1ZJYA 2AR9A 3M8KA 1ZS9A 1IEWA 3R3UA 2QLTA 1YNOA 4U7WA 2ZSEA 2AS0A 1DWQA 3ROGA 4HQ6A 1DP4A 1C8VB 4WCDA 2Z56A 2GTIA 4MRMA 5EUMA 3TLGB 1QLWA 1MJHA 1ZKDA 2B1JA 1Y4DE 3DM9B 3DPSA 5EY5B 2QUKA 4IQ8A 1P7ZA 3THYB 5JNUA 3FG9A 3R40A 4RCVA 5DHRA 3RSCA 5LPNA 1YJCA 3OPXA 3VDNB 4CG1A 3JS5A 3NNSA 3HXMA 1QE0A 1VIVA 2EKDA 2HMWA 1BVHA 1XVAA 1S7GA 3N2GA 3QHPA 1M34A 4YQYA 3RVJA 1FVHA 1P4AA 5HJ5A 2ORVA 2HA3A 1NNUA 2C3MA 3F97A 4H7PA 2FEKA 4J0IA 4ZARA 5L40A 3DHVA 5FJIA 1JR2A 4GVPA 3ZDCA 3SQOA 2IZZA 2QRHA 4OA5A 5IAKA 1XQ6A 2FQXA 3HNRA 4IHAA 3IVRA 3KVRA 5HF9A 1ZJZA 3ETJA 5TDHA 3U7RA 3TQFA 3LAWA 4XYBA 4DJFC 2C4NA 2ZWAA 3AFGA 1ISSA 2DETA 2BTEA 3U61B 3N2KB 3DLHA 5FJJA 3E22A 3CZCA 4YJ2A 3LC1O 2BSQA 1H6AA 1YI1A 1MX5A 1VCIA 5TS3A 3TIIA 4GX1A 5ELXA 4CI9A 1NPTO 4D92A 4G4GA 1IAVA 1M75A 1PFYA 3OX2A 1COZA 1DPFA 2QTHA 1PZFA 4XR9A 1VA4A 4U39A 3RHFA 1KRWA 3A6HA 2QUAA 3ABIA 4QUBA 2XTNA 3CG4A 4OQZA 1PGPA 4M55A 1QWSA 4UW9A 3MD0A 2XE6A 1ZJWA 4GP9A 6NULA 2BMAA 2BFNA 3L93A 4G26A 4AECA 1YQUA 1U5BB 3KYJB 4GPEA 2JC3A 4J1QA 1TT7A 3IERA 1P4JA 2L42A 2G04A 4FTWA 4JOQA 1IMOA 5FBWB 1MC5A 3SVZA 1Q92A 1QGUB 3VVLA 5HKKA 2CXPA 4LZJA 4BDSA 3MOGA 2XD4A 4ZU1X 2F3PA 2VJYA 4A91A 3K0SA 2FW6A 4NV3A 2DC1A 3A0UA 4ND7A 3AH8A 4FKMA 5ALJA 5DMHA 4EENA 3QVTA 4YALA 5BSFA 1F9AA 1EA7A 2O0MA 4GVXA 4MIKA 3UY4A 3VPAA 1DHRA 3F6RA 4IJQA 5DI3B 4ML3A 3EZNA 2CT8A 2A5JA 3AV3A 1OKKD 3LTEA 1VSUA 4JGIA 5FF9A 4HAZA 2O1SA 1AK2A 4D9BA 5KSYA 3JD3A 2G7MC 3FYUB 3LBAA 5DZSA 2Q50A 3PQ7A 1PYDA 2P2YA 3KWMA 4MSUA 4A1OA 3EEBA 3N2EA 2J0SA 1BGVA 2ABWA 3JWJA 3GDHA 3DUFA 3ZWOA 2ZT8A 1Y89A 4JI2B 3AK4A 2QSJA 1Y3AA 4GQBA 4L02A 1KI8A 1OI7A 2FPGA 1KJ9A 3FHCB 3QSGA 4IXDA 4N5NA 3ROPA 3FPGA 1LTQA 3PIRA 3ZCPA 5JS1A 4QFBA 4M53A 1U9YA 3SMVA 2WF6A 3OBIA 5J9FA 2VDRB 4DLLA 5JZVA 3DF9A 4XQCA 1NUPA 2VP5A 3OPQA 3ELUA 3HPRA 3SSNA 3NRCA 3P2IA 4EF6A 1OB2A 4PZPA 4G0NA 5LUBA 4LZZA 4HAUA 3HXOA 2FUG6 3BS4A 5LZ2A 4Z9YA 4EHHA 1J23A 2ZJYA 1RM0A 1Q7EA 3K8QA 1ACJA 4ITUA 3CISA 3WOVA 4LK3A 2UXCB 3P9PA 4BWVA 1AQLA 4LNHA 1KVUA 1NQWA 4KUGA 4CLEA 4K8OA 3B8HA 1NW5A 1WQ3A 2W6QA 3Q4GA 5LC1A 4B81A 2IBTA 3OM9A 3WZMA 2E5LB 4Z1MA 2O2SA 1G7CA 4ZAZA 3RS9A 2PT5A 3FI9A 3RQSA 2OMKA 2BISA 1C30B 1J09A 1U98A 3I92A 4WXHA 1HYEA 4HX2A 4XDHA 3ENVA 5JVDB 4UXIA 2F1OA 3TLEA 2IPOA 5BSVA 2HJVA 1NVEA 2BM8A 2J30A 2NYAA 3NTLA 3M6VA 1RRPA 2CDBA 3KYBA 3FWKA 4R81A 5AVUA 1U3FA 3OTIA 1KYTA 2FPGB 3C98A 1N0IA 2DFPA 4F3CA 1RQ2A 1C9NA 2J4CA 3HBLA 1Z75A 3Q87B 3ZWNA 3GN1A 4OY3A 3EVZA 1EUDB 2R6R1 3BE4A 4X3OA 1P60A 4TYWA 5E95A 2DCUA 4CR7A 1ZI9A 1GN9A 2B9VA 1RI5A 2RGWA 3NYRA 4YAUA 3A1DA 1GPWB 2H0QA 3DGFC 1Y7PA 4UU7A 3AL0C 3KKOA 1J0DA 1XCLA 4TYMA 2NQ2C 2QNRA 3CLRC 3U1VA 4CM9A 4F1WA 5TIIA 3W5HA 2ZI5A 2WTUA 3SVLA 4CTJA 1TCAA 3LO8A 3VU3A 4MB6A 2B83A 4G5XA 1P6UA 1GCOA 2ZEJA 1G1AA 3B51X 3BWDD 1N7JA 2IS6A 3H2HA 3IPCA 2ZJ5A 4QU5A 1H3NA 4IRXA 4OK3A 2GBFA 3VR4A 2PTHA 3AONB 5A3RA 1MW8X 2RHJA 2YHAA 3E0XA 4KLAA 1MH9A 3UNXA 3I37X 3W5VA 3MWKA 1YZNA 4JUFA 4X60A 4RVNA 4GLLA 3HCPA 2HSWA 3VFDA 3U7QB 1V6CA 1N2JA 1MEJA 3P4UA 4DQVA 2WABA 1OD6A 4L28A 3SGLA 2JGFA 5MFZA 3CINA 2P2GA 3O26A 1SNYA 3COYA 5K3CA 1KDVA 2BF4A 3AF5A 1S5PA 4UUQA 1A9TA 2XE8A 5DM2A 3TE6A 1JG3A 1HURA 4FYPA 4L08A 4RK6A 1CBUA 4G0ZA 2QYHA 1QH8B 1BS9A 4MR9B 1P0IA 1KZ1A 4TRJA 4C14A 2GA9A 3JVUA 1ONNA 3AJDA 2Q3JA 1U0SY 2CHEA 4HPXB 4TWAA 2REBA 4URZR 1JW9B 1W7AA 4L7QA 1QRUA 1WR8A 1K68A 1ZK3A 4F2WA 2QZSA 3B1JA 1H85A 2YWGA 3QI7A 4N7BA 3RUPA 4D0GA 6REQA 3U31A 5B7GA 5AKGA 2VYND 3I76A 1L1EA 1PZXA 2VLIA 3T38A 1PJBA 4DA7A 5DCWA 3KSZO 4KTTE 4A2QA 1YVRA 5AHWA 2GNAA 1H2BA 4OLJA 4UE2A 2QV7A 2TECE 1B23P 3OG9A 1NOKA 4KI7A 3QBVA 1QO0A 2I87A 2YMLA 2COUA 4KXVA 3VSCA 1JE0A 2GPWA 1YZTA 1YUMA 4NZPA 4KQXA 2P6UA 4RSMA 1NRWA 1YUBA 3ZS9A 1G38A 1ICIA 2RMKA 1MT3A 2QV0A 3AKYA 4LJ5A 4YRSA 3MGCA 2BGWA 1Z73A 2FN4A 3TOZA 3HZOA 4UFPA 1OJLA 1WHSB 2H2GA 2WAMA 3BMNB 4B8ZA 4QAJA 4Z3OA 1FW8A 3NXSA 2ZOSA 5F5LA 4YCSA 4W9NA 4L73A 4KQGA 4OATA 1C0KA 1OI4A 4KQEA 1DQSA 5D3KA 4ZAFA 2C3YA 4ZHQB 1RRKA 1K4KA 3NTQA 1USUA 3VYSB 3RADC 4PG7A 4EEKA 1VFNA 5C46F 2XHZA 1JFFB 2WIFA 3PDWA 2W0SA 1AA6A 1PR5A 5EE9A 3KQVA 1DE0A 3WLEA 4GXQA 4ID3A 3ST7A 4F5WA 4NESA 5AD1A 721PA 4ZRDA 2DPGA 1TYCA 5EXEA 3N6VA 3PHGA 5HF5A 3NEYA 5LUAA 4RD0A 2B98A 4B2IA 4YRZA 4Y6QA 2C4MA 5DV9A 5IX8A 3VC1A 5KYXA 5CLQA 4DJDC 2CJWA 1XRPA 4CMBA 1AHNA 4IIJA 4RHCA 2RH9B 1CP3A 4IZHA 3G13A 2EW1A 4PLYA 3AI2A 4P34A 2OXTA 3S8MA 8ADHA 2NSYA 2QR5A 2HRZA 2IW3A 2V0NA 3JQDA 3F71A 3KTAB 1CJVC 4MTLA 3B6MA 1IBKB 1YOBA 3MPUA 2EZTA 4MKXA 2CYBA 3MB5A 3GRPA 4KHZA 1GPKA 2ZU0C 1PZEA 3HR4A 1YRLA 3NHRA 3QZUA 2HL6A 4JOCA 3L6DA 4RMNA 2EV9A 3DPUA 2FW1A 3TW4A 3O7WA 4LHWA 3OKAA 1RJEA 5IT5A 4WBSA 1FP1D 2GZAA 4LHXA 3O8QB 1HXHA 2IDMA 3UF0A 2OZKA 2PWBA 5IM5A 3PXGA 3LZDA 3IRVA 3A1FA 4WXEA 2F9FA 1GV1A 1YE3A 1S89A 3H42B 4JLWA 3K8YA 4I4TF 5FOVA 5JISA 3VYWA 4CM5A 3S3TA 4X6LA 1U2RA 2IHZA 1KY3A 1Q1ZA 4MYSA 4PPQA 1J39A 5KPJA 1V1JA 3MMSA 2WY2D 4C1BA 4C0XA 1RHUA 1MZVA 1A4UA 1ZJJA 3GPDG 2QB5A 1YR2A 4E1AA 4G85A 4UOEA 4BQOA 4C0BA 1QIMA 3ORHA 1EYZA 5E4JA 5HA5A 5JNTA 5LQMA 4TV8F 4AIRA 2YRXA 3OWOA 1X7HA 3OEYA 1G20B 3KFXA 1J0EA 1JAIA 4L5AA 2NV0A 3DOJA 1PGJA 1ODTC 4QIHA 2WJHA 2XKJE 3DZBA 2XNKA 3FI0A 3MHPA 4GI3A 2FRDC 2PUGA 1XDSA 2AHRA 3MRXA 3FSRA 3H17A 3VAAA 4FFVA 3FVTA 2HI0A 3W5DA 4FGZA 2VSNA 3TPCA 2VFAA 3DOIA 3SI7A 2WTBA 2R65A 2O06A 1YTLA 3E9QA 1R0LA 1FLDA 3IUYA 5I47A 1Q2XA 3D5TA 4HDMB 4L6IA 3AB3A 3VU8A 3GQBB 4K9PA 3QFCA 4XVQA 3G17A 2GUGA 4DLWA 3FCUB 4WUVA 1R10A 4GQIA 1IRXA 1FZQA 1H22A 2KQUA 2WUEA 4TQ9A 3KFLA 3KL4A 3H1GA 1A8HA 3DEKA 3EGXA 4HNVA 1LNZA 3EZ7A 2ZWOA 1EBFA 3HSSA 4IIXA 2ZVPX 3NBZC 4Q4HA 5EOVA 4V1CI 2JCVA 1EBBA 3GRVA 3ISJA 4XIGS 3R5TA 4EL0A 3DBIA 4NAHA 4J4TA 5ECDA 3EF3A 3KAQA 2UV8A 3GD7A 4S1TA 4G1VA 1T0UA 2GEBA 4HZIA 4UNNA 1NVWQ 4ZQFA 5CFOA 4BKPA 4WDQA 4EP1A 2GEDA 1VB3A 2XUFA 1O8CA 1N0UA 2DUMA 2X9LA 4HWRA 4JXXA 2Y1KA 5KTOA 4YCCA 1S2OA 2XYGA 3DBHB 4HBGA 2WFAA 2NAFA 5JQWA 2IL1A 1VMAA 2FRDA 1EK6A 1M6YA 1O6CA 1P2TA 1V96A 4WIAA 4BS9A 1V95A 4ER0A 4A0FA 3PCRB 5FPKA 4XJVA 5EHNA 3MG9A 2H1LA 3I5XA 1SC9A 3INTA 2E89A 4AXBA 5JDCC 4DDVA 4Y67A 4NKRA 3QVWA 4MVWA 3HN6A 1ZW6A 3LBYA 4HNSA 4W8GA 3HK2A 1SXQA 2Y71A 3Q7TA 4OGFA 1R88A 4EJSC 2QN3A 4A16A 3D6AA 4YJGA 5C2JB 4OGWA 3GQBA 3LVFO 4HB4A 2J9XB 4L16A 1A9XB 4PV7A 3CA8A 3T35A 2QZ4A 2VDNB 3VGJA 5JQGB 1ARZA 1T5OA 2VG8A 4TWIA 3WL5A 4AO6A 4AT1A 1NOIA 1OYYA 1YR1A 3M1AA 1UDRA 4CUJA 3ZD6A 3PLAE 2QM0A 3ENKA 1KYZA 2VP4A 4P9NA 3T9CA 4COKA 4DUYB 4IUYA 4K6OA 3FTEA 1NJFA 2XZDA 2Q1SA 4XYEA 1AZSC 2J3HA 2WWRA 1BFKA 4FBMA 1M10A 4GR9A 4RJLA 1TW3A 5IVHA 3NWEA 4KSCA 2QRGA 3FA2A 4HATA 1IHUA 1N1GA 1VLMA 3G3EA 3O84A 3EGIA 4Y9UA 4UHHA 1J7JA 3SHWA 3ML1A 2HLPA 5G4KB 3LGSA 1A7UA 2A14A 3D5EA 3CH4B 1NXQA 1SC6A 2C20A 1DC4A 1AV7A 3DNFA 4RK4A 2LV8A 3KU1A 1P1IA 1G20E 1R00A 3VI3B 3LBHA 5TARA 3Q88A 3TRJA 2CUZA 4D4MA 4N3NA 2EFJA 5AHKA 1PRYA 3LUFA 4LTNA 1YS7A 3NX4A 3RBVA 1P5JA 2SCUA 4I5GA 4D80A 1T1IA 2QP9X 3H0CA 2VWGA 1Z26A 2CUNA 1ECCA 3A4VA 4R41A 5IUKC 3D4PA 3V80A 5CYPA 5GZ3A 1E2GA 1OH5A 2XNDA 4J91A 4HN9A 2RC5A 5KNCD 2JLQA 1JUDA 4V0MA 4QUGA 2H5EA 3JQFC 3CUS