3I92A

Structure of the cytosolic domain of e. coli feob, gppch2p-bound form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
261
structure length
257
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 80
structure length 257
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i92A01
1XJQA 4E22A 4FI3C 2O8FA 5EP2A 2NO0A 3F8TA 5D3QA 4OI0A 2RGEA 1RZ3A 1KO5A 1EX6A 4UNSA 4Q9HA 2F9LA 1SZPA 2GCPA 2R6GA 3KKMA 4M9ZA 4Z51A 4JT4A 1D2EA 1AKEA 4GRAA 1XPOA 4E07A 3HYTA 2GRJA 4PHTA 4GOKA 4I1OA 3DM5A 2AWNA 3M4YA 2IHYA 2GK7A 2AX4A 2WOJA 3B5JA 3EZFA 4LI0A 1YR9A 1GRRA 3PEYA 1JB1A 4NBSA 4E09A 2FEMA 2WZQA 1T4GA 4ZPXA 3GLFB 1A7JA 2J7PD 2MSDB 2QE7D 2H18A 3AGPA 1RW4A 4TT3A 1GOTA 4V0LA 1OHHD 1XTRA 3UMSA 4US1R 3U7EB 4OQLA 1JAIA 3J81k 1NRJB 2QT1A 1R0XA 2QGNA 1YKSA 3K0FB 5B30A 2VA8A 4L16A 4C0KA 1US8B 4G1UC 1KAGA 1OHHA 1JXOA 1YRBA 2PX0A 3P32A 1RRGA 4Q1EA 4BLSA 2NG1A 1XD2A 4V0OA 2O8BA 4ESVA 4S2EA 4IKEA 4AD8A 2C99A 4XWAA 2I3BA 2O8DA 2BKEA 1DAMA 4OQMA 1D6JA 4ITRC 3QBTA 4M1MA 1Z63A 4DVGA 3MLEA 4HAVA 5LB4A 4DCUA 3ETLA 2XSZA 4EPYA 4OHYA 1P9RA 5IK2D 5SZIA 3AKYA 4I4LA 4QJ5A 3FMFA 3GFTA 2OZEA 2HJGA 4JJZA 5EE9A 3VU9A 4B43A 2ZJZA 1CR4A 2WSMA 3C5CA 2ZJAA 3RRYA 1NN0A 4QKQA 1UF9A 5FOWA 4GNKA 2UKDA 2ZU6A 2C5LA 4DT1B 4QGGA 4B3XA 1KDRA 3BS4A 4PHFA 4MKHA 3QXHA 3RS3A 3HPRA 4YONB 4QBIA 2P0EA 1S2MA 1UKZA 2CK3A 4JBWA 3EC1A 4KFSA 4LV8B 3I62A 4TMZA 1IXRC 2X1VA 5G40A 3PIRA 4L15A 4LJ7A 3CRRA 4AIIA 4ZDKA 621PA 2H92A 2REXB 4GOJA 2HLDA 2CEAA 1KSJA 2AXNA 3SE0A 4C7OB 1U98A 1HV8A 3B9QA 1YZNA 1Q0UA 2ZPTX 4HAYA 5J5CA 1FMLA 1G6HA 3BBPA 3WY9A 1TL7C 2FNAA 2ZS7A 3IQXA 1HY3A 3O8BA 3WNCA 3U4QA 2W6IA 3MG9A 1A2KC 1Q1BA 2XZPA 4TWZA 5AJYA 5DHAA 1ZM9A 2R6AA 3W8NA 1LS1A 3BERA 1NSFA 3K1JA 3B85A 2AFHE 1DE0A 3AUXA 1L4YA 1RYHA 3AKEA 4PC3A 2WMNB 4RD2A 3FB4A 2OLJA 1R6BX 3K70D 2OXRA 1VG1A 1XTJA 3VMFA 1XTKA 4AKIA 2KB0A 3C8UA 3Q5EA 4TLDA 5K8LA 4OBEA 3RSOA 2YYZA 4M4SA 3ZIAA 2XITA 3SNHA 5KPJA 4DBLC 3L2OB 1W1WA 3BFXA 4H9GA 4S35A 5CLQA 5DHFA 2HV8A 3TUIC 3AB3A 1XNJA 2GCOA 3D7MA 4BFYA 1KK3A 3GJXC 3LXXA 1MRNA 1E69A 2O0JA 2VHQA 221PA 4KBGA 2PCJA 4DWJA 2D74A 1WMSA 2QNRA 1FX0A 1G3QA 2GBLC 2VLIA 1R4AA 5D3MB 5GJWC 4C2UA 2RB4A 4XTRA 1NKTA 1ZU5A 2DCUA 1Z07A 4XSGA 3U44B 3O47A 5HKKA 1T3SA 2IX3A 2J46A 3L43A 2FMXA 2A7QA 3KXLA 2L0XA 2DWPA 4IXMA 3ZH9B 4JLOA 1NY6A 1UDXA 5HKKD 3FVQA 2IK8A 3SI7A 3FHCB 4NPHA 4F7WA 2G1KA 2BJWA 1KO7A 2WICA 2WWWA 2ZI9A 4TSFA 4C30A 3THXB 3B6EA 4ASUA 1E2LA 5KPDA 3FKQA 3QXXA 3ICEA 4UJ5A 1HUQA 4HUQA 4BZXA 5F98A 2WBLC 3LQQA 5AUPB 1XWIA 1DAFA 3FKSD 4B48A 5DLQC 3LD9A 5B64A 4II7A 1E2IA 1GVNB 4FMBB 1W7AA 2ASEA 3C7KA 2XOKA 2IC5A 4LWZA 5L3SB 2JJ8A 2ZS8A 4B33A 5HPYB 1OKKA 1NLYA 1NMYA 1D2NA 3F5FA 3IIJA 4NYJQ 3TSOA 2VEDA 1Z28A 3SJCA 1OB2A 1E0KA 2GHIA 2QBYA 2QU8A 4XH9B 1DO2A 4KSCA 4TLBA 3VR4A 5AUNB 3L0SA 4JVSB 1II8A 1KI9A 1OKKD 5EP1A 2VSFA 1DAEA 2F7SA 2I1QA 5E95A 4C2TA 1JJ7A 3V9PA 2J3EA 4G5QA 4ZO4A 4GT1A 2C9OA 3A1WA 4OQXA 1JR3A 3FDIA 1G3MA 1XBTA 3N5CA 3T12A 1I4TD 1JQLB 2D3WA 1GILA 2NPIA 2W00A 3SYNA 4A0GA 3KXIA 1XRJA 4RVCA 3KB1A 1CULC 2QL6A 5EP4A 3A37A 4Q4HA 3NTUA 4G5GA 1I4DD 3PUWA 4NYIR 1QHSA 3TW8B 4W5JA 4PQYA 4IDPA 1N5IA 5EXSA 2PX3A 1XEFA 2W2XA 3LW8A 4JLDA 3AKCA 3LW7A 4OQNA 1EX7A 4PZYA 4XTCS 3U3JA 1JECA 3GEHA 5DH9A 2LKCA 1G8FA 2CCKA 3G5UA 2VPPA 3PITA 3QI2A 1NBME 1U94A 3OIWA 2P5TB 2K5UA 2VYFA 3CKLA 5LBIA 1R0WA 5H70A 1S4QA 1OW3B 2P3SA 2ZEJA 4Z8YA 3GEEA 3QF4A 4C0AC 1AS2A 1PUIA 2D2EA 1JR6A 3EPJA 3FMIA 1GKUB 1YZQA 4D81A 3QENA 5KNBA 4AK9A 4QGFA 4MQBA 4HI0E 5AK0A 4BECA 2LKDA 3LBHA 4YC7A 3NG1A 1YJ5A 3OEED 2A5DA 2EWWA 4QFMA 5LD2C 3T1OA 1R0ZA 3U7GA 3VKWA 4JL6A 2PL3A 1G19A 1TAGA 1TF5A 1H8EA 2E1RA 3R7WA 3LRPA 4A92A 2G9NA 2BWJA 3UK6A 1YZLA 1G6OA 5A5GA 3LVQE 3V00A 2ODWA 4JLNA 2ZR0A 4J0QA 3QUSA 4TQUS 4XVQA 5FOTA 3SHWA 1XEXB 5DNYB 4DDTA 2OFXA 1PUJA 3U3MA 1ZD1A 3W3AA 2QMUA 4M9SA 4CT4B 1KHTA 1NI3A 1W4CA 3ZVLA 2WJGA 1AZTA 1T0HB 1XTIA 3K9NA 3AVUA 5KSYA 3E70C 5KSPA 2GETA 1DAKA 3BXZA 5DI9A 4C0BA 4XWKA 2CE7A 3CNNA 1E1QD 4Q9IA 1P6XA 3DMNA 4LCBA 3TQFA 2NGRA 1U8ZA 3BOSA 1KNXA 3QEJA 1VDZA 1SHKA 5F3WB 2GF0A 2ZVPX 3CH5A 1OIWA 3KZ1E 1UEIA 4MGZR 2A5JA 1G7SA 1ZU4A 3LA6A 2FH5B 4UKDA 1T0JB 2PT7A 1NLFA 3AF4A 4DHEA 2YOFA 4LYFA 4YMTA 4OK5A 5FBQB 4GMDA 5JS8A 5ELXA 1NVXQ 4OQFA 4G3XA 4BLQA 1QHIA 2EFEB 1AGRA 1DAHA 4BFXA 3HU1A 2JJ1D 1L8QA 4R7ZA 3UWKA 1ZW6A 4KLZA 5FTJA 2QZ4A 4A2PA 2N1BA 5BN3A 3RANA 4TMVA 4KITB 5BWMA 4JLKA 4DSTA 4RCZA 3VTKA 3QKRB 3AVOA 1G7RA 1CJVC 2J9RA 4JYBA 4HAUA 2IEYA 2ZS9A 2OCAA 4D82A 3VR3A 4Q5IA 2QPTA 4E5UA 2YNMA 4F4IA 2IYUA 1ODFA 4A82A 4JS0A 2B92A 3A36A 2O8CB 1OFUX 1OYWA 1NMXA 1GZSA 2IF0A 3AVQA 4OHVA 3RC8A 1VYTA 3LWNA 2BEJA 3MAAC 2QMOA 4WVFA 3M0EA 2ZETA 5EXPA 4X8MA 4JSYA 2EFDB 3QNUA 1KO8A 3K8YA 1P2UA 1N5KA 2ECKA 1UJ2A 2B21A 1ONBA 3BB3A 4TYPA 1KDTA 4QBGB 5L3QB 5IDVA 3VNUA 4KV9A 3BWDD 2ZRHA 4O25A 2JGNA 2HDNB 3R8CA 5KNDA 4ESHA 4M1WA 3NH6A 4FWTA 3EAQA 3DMDA 2DPXA 4LHZA 4Q1BA 1S3SA 2ZI4A 2FU5C 4URXR 1B0UA 1YE8A 2V8OA 4PC1A 2HXYA 1II0A 4KVAA 3DM9B 4DSUA 3IO3A 2YKGA 4M9QA 2JLUA 3LO5A 1QG2A 1U0JA 3REFA 3Q7QA 3LBNA 1K5GA 4TLCA 4U02A 3C41J 3GLIB 1CLUA 3RS7A 4HSEA 4B2LA 2VSOA 2GXAA 1D2MA 1EFRD 2YOGA 1E0SA 2ZRJA 3LXRA 3K0AA 2RGNC 2QP3A 3I73A 2QQEA 2XSZD 2ZSEA 1Q22A 1NVWQ 2QORA 3WNDA 1NL3A 4CIDA 3L0PA 2QMHA 1MOZA 4LC0A 3IIMA 2CCJA 3C14C 1QHHB 4FW9A 1TF7A 2ZUDA 2H7VA 3B78A 3QY0A 3ZVRA 5LPNA 4JVLA 1JR3D 2FDCA 2XX3A 3GJ6A 2WWGA 1DBSA 1JPNA 3AVVA 2ZRBA 3ZS8A 4MKIA 4US2R 3GCGA 1S8FA 2JASA 3FTQA 2HUPA 2CL0X 4JLMA 1RFLA 2XAUA 3BB4A 4GDFA 2XTNA 4CEIB 2SHKA 4I1SA 2WKPA 1P62B 5EZ5A 1XCGB 4MRRA 3AP1A 3K0FA 3AKDA 1AGPA 3BH6A 4GP6A 4LJ4A 1BIFA 2R9VA 1HURA 1ZM2A 2DY1A 3WRYC 3X1XA 2UVQA 4RKFA 4DB4A 5FUWA 4EPVA 3EZ7A 1G21E 4M0LA 2C98A 3U3KA 2IYTA 1YR8A 5GVRA 1W36D 1IOZA 3BH7A 4A8JC 3K0EA 3JZAA 2GESA 4LGMA 3ZGXA 4PO1A 4XVRA 1XZQA 3KXKA 3CRMA 3D8BA 3IDQA 4TLEA 1EG7A 3AVTA 4NONA 1CBUA 2WIBA 4GBMA 5FH9A 5M04A 2GJ8A 2QQ0A 4IVQA 3KKQA 2ZU0C 2WM9B 2BIFA 2IT1A 3THXA 5FL3A 1SXJC 1ZUHA 4P0TA 4QRHA 3O8RA 1DVRA 1PLLA 5EXXA 4RCYA 5L3RA 3EG5A 4Z1MA 4DJTA 2OBMA 4QHTA 2REBA 2AWOA 3B60A 1YZKA 1GL6A 4FIDA 4N3NA 2IYLD 2PLRA 4A0RA 4B73A 2FPKA 3AF0A 3EWAA 4C4PA 3OFNA 3MWYW 4DDWA 3K9GA 2CHQA 3BGWA 3GLFE 4TN1A 2NPFA 4GOXA 1UKVY 4ACAA 3KQLA 5JWHA 5AUQA 4ACBA 5DI3B 1RYFA 2ZR9A 4DZZA 1MH1A 1MR3F 1NN1A 3OESA 5CIWA 5K8IA 1E1QA 1F2TB 4ON9A 1XB2A 1XMJA 2ZROA 3KKOA 2JLQA 2PLFA 3GLIA 4TL8A 4V0ME 1I2DA 2ATXA 3AQ4A 4UNQA 4V0MA 1XXHA 3SJZA 1AZSC 5DYIA 1X8LA 4EQ6B 1NY5A 4KBFA 3UATA 1G3UA 2R44A 1JPJA 3QVVA 3GJ5A 121PA 4Q48A 1E2MA 1GRNA 1P72A 1PZNA 3VKHA 2I4IA 2GEVA 1OSNA 2V3CC 1X8KA 521PA 2J5XA 1J90A 3QOFA 3KFXA 3LAWA 1A5TA 2W83A 2ZJYA 4GP7A 2ZSFA 1T3LA 3IQWA 5SZHB 2IXGA 1WB9A 1QVRA 1VKJA 4Q21A 2O8EA 1ZUNB 2G77B 5FL7A 2W0MA 3OAAA 2NMVA 2OSBA 1E9BA 1WF3A 3OHMA 1AIPA 1WBBA 4WBSA 1Z06A 2A5YB 3BRWD 1Q1QA 1IN5A 1JAHA 3IHWA 1VYVA 2JJ2A 1G291 3WRXC 4TZ0A 1E0JA 1KTVA 1IBRA 3HYRA 4HAXA 5LDDC 4XOIA 3RS4A 4N1AA 3T1QA 4K8OA 2OHFA 5DO9A 1VIYA 1NF3A 2CNWD 3U5ZB 3H2YA 1XD9A 1E9EA 2QGZA 3A4NA 3I4LA 1X8JA 4Q7LA 2JLYA 2D7DA 4BEBA 5FPTA 1H8HA 2ZIAA 1O87A 1SVIA 2ORWA 2QI9C 4D4LA 5KTYA 1W2GA 3C4JA 3WBKA 1NN5A 4D4KA 3THYB 2IWHA 1XU4A 1E9AA 3NHBA 1CEEA 3CUEF 1W0KA 3EIQA 2ANBA 5DSZA 1T3HA 2NOAA 1KY2A 3KQKA 2R6CA 5HCIA 1I4LD 4Q03A 2W6JA 5P21A 5J4YA 2E9SA 3N2EA 2Z0MA 2JATA 4PPFA 1DADA 2XXAB 1IY0A 2ZITA 3LDAA 5DYGA 4OK3A 3UANA 5B2ZA 4Q19A 4LBZA 5FUYA 3BFKA 4U00A 4Q00A 1DOAA 1LF0A 2BBTA 2IUTA 4JZKA 2A9KA 3B9PA 2W2TA 3DOFA 1G17A 1N0WA 1QRAA 5JZVA 3I92A 4XJXA 4C7OA 4M22A 3O8DA 3D31A 4Q02A 2KBFA 3MMPA 4BGDA 5DI3A 2GXSA 3A58B 3PG5A 1YVDA 2A5GA 4D6PA 4V0NA 2NO1A 1YRAA 5KNCA 1TEXA 1T5IA 1EFCA 4NCIA 5JSZA 2IL1A 1QF9A 4CEHB 1A4RA 5FI1B 4DCVA 4MDFA 2VHCA 3CX7A 3R9IA 2P5SA 2C2HA 2FEOA 1E98A 2ZRLA 5IF9A 2QAJA 3S1AB 3VR1A 2IEZA 5CB6A 4IJMA 4ZKDA 3CNOA 5EP3A 3VX3A 4BE7B 2BMJA 1ZMXA 1XEWX 1CJTC 5JECA 1OYYA 4TTPA 2WWYA 2RH5A 5EUQB 2ZYVX 4ILEA 1CIPA 4URZR 1Z0IA 3QE0A 5FUVA 2C04A 3K9LA 4L5BA 1QVAA 2H8KA 3Q85A 4V02A 1N5JA 4V03A 4JLBA 1G5TA 1O3YA 4A4DA 1SVOA 2OILA 1JNYA 4PQRA 2TMKA 2GXQA 3K70C 1W5SA 2BMEA 1SXJA 3KJGA 2MSEB 3TW4A 2W6ID 5CITA 3PXGA 1OXXK 2KJQA 2RHDA 3SBDA 5B57C 1YHNA 3DDCA 4RD0A 5JBQA 4QL3A 3UMRA 2V1XA 4TMWA 4LHXA 1M1YE 1SXJD 2PJRA 3NIBA 5J40A 1Q12A 3EWSA 6Q21A 3EXAA 2ZM5A 3TAHA 3T1TA 2RHMA 2Z43A 4JL5A 4ZI2A 3GLGA 2J0SA 5JRZA 2RGXA 1Q3HA 1GL9B 1NN3A 3C5HA 4JBXA 3WMEA 1IY1A 1YZUA 1KK2A 4DLTA 2F3TA 1CR0A 4EPRA 5G3YA 2VP2A 4JMPA 2R6DA 4M2LA 1G20E 2VL7A 2J1LA 4NCJA 3SR0A 1NNEA 4WW0A 1QG4A 1OH8A 2JDIA 1W0JD 2ZI6A 2OLKA 4MYHA 1GAJA 1QDEA 1E2PA 4BFWA 5AUOB 5JCZA 2RGCA 2ORVA 1LFDB 2YJTD 4IDNA 2Q9CA 1CRQA 2F3RA 4C0LA 1S1CA 4JKIA 4DEYA 2VP6A 3RS2A 1DPFA 1KSFX 1VG8A 2JLZA 1R2QA 3RVBA 1F3OA 1COWD 2KBEA 3GLHE 3PR1A 1PLKA 4GMXA 2A5FA 3K09A 3GD7A 4PC6A 2QAGA 2WV9A 3B8HA 3GEIA 1G41A 4M1TA 3PUZA 3LQRA 1M7BA 1ZNYA 4PXAA 1VG9B 3EW9A 3QIAA 5JEDA 4HAWA 4TSFD 1FX0B 3BC1A 4IEIA 2RGNA 2XTZA 1NKSA 3CZQA 4WZBE 3SEAA 1D9XA 1S96A 4RY2A 3B1VA 4NHOA 3QJYA 2XZLA 1ZIPA 5E7IA 4G01B 4M21A 2YOHA 3TAUA 4BLRA 4GPTA 2HXSA 5LD2B 5J47A 2AD1A 2D7CA 2QMEA 5F2EA 2W2VA 1C9KA 5FTKA 4EJSB 4ZI3A 5KUTA 2V6JA 4BFTA 3IBGA 5HTKA 1EGAA 3GLHA 3RHFA 2WKQA 2C96A 3QG1A 1GRQA 4KAXA 2B8TA 2IYVA 3BB1A 4W7SA 4B76A 3CX6A 2IYWA 3L0OA 4QXAA 1E4VA 1GSIA 2PBRA 3I3SR 2XXAA 3AP2A 2VF7A 1W46A 1E2GA 1WE2A 5CYOA 5KO2A 1SKQA 3B82A 4DB2A 3WMFA 2C77A 3PEWA 2FFAA 3SFVA 5IRCD 4PSAA 4DUGD 5KOYA 2IW3A 3TE6A 4CT5A 3OEHD 4BUJA 2JA1A 2OCBA 4EFLA 2EWVA 2F6RA 1R8QA 1VCMA 1Z0JA 4B47A 1G7CA 4PZZA 1PVOA 4Q01A 1SVKA 2ATVA 5JJKA 3ND9A 2LCFA 3MSXA 3TKLA 1G3IA 2C9CA 1N6PA 2ANCA 4KYUA 1FPMA 2ZJ8A 2Z4SA 4FCTA 1OFIA 1OF1A 2ODBA 1EWRA 3GJ4A 4L9SA 4XD7D 1FMJA 3WYAA 3MCAA 5HCNA 3NC0C 2VHTA 4QM7A 1X1RA 1XPUA 3H4MA 2WAXA 3U44A 3PUYA 2IUSA 2HYDA 1ETUA 1MO3A 2EVWX 4FN5A 4DKXA 5AJZA 5JHGB 1P73A 4DXAA 2JEOA 1YZTA 4Q9KA 3CB4A 1A82A 1JR3E 3BH0A 1LF5A 3A1TA 4URUR 3SQWA 2J0UB 1U0HC 2Z4RA 1AK2A 2QTHA 3SHFA 4TYYA 4BFUA 1V5WA 1T8TA 1U0LA 1BKDR 1Z47A 2AK2A 4MUBA 1ZCAA 2AKYA 1N6IA 2AHOA 1KKMA 2J41A 4A6PA 2CE2X 2JIZD 4C0HA 3FPAA 1IM2A 2G1JA 2Q3HA 4RKEA 5JJIA 3ZDQA 4A15A 5F9HA 2F9MA 3SQXA 2EFHB 3X1DA 4UQOA 4LJ8A 2EFCB 3RDPA 4B6FA 1S3GA 4LUCA 4NZYA 5C2JB 4IXNA 4PPNA 3A1VA 1UBGA 3NVAA 3GFOA 1G4AE 4F4JA 1VCNA 4HDOB 3M1IA 3BE4A 3IBYA 1NBMA 4IEEA 3EA0A 4YXWA 4B3FX 1FW6A 3SDZA 3LX5A 1CR1A 4LDJA 1ZINA 2ZI7A 1PV4A 1XD2B 3GLGB 1OPXA 2CLDX 2DFLA 1E2EA 1X3SA 1G1MA 1G8HA 3QG5A 2Z6VA 3KQUA 4LZZA 1U90A 4AWXA 4C0JA 3ZVMA 1HQYE 3IEVA 1N6NA 2CCGA 1ZAKA 2B7BA 2P6NA 4AG5A 2OFWA 1T91A 3V4FA 4TYWA 2ZXUA 1N0UA 4YMSA 2ZRGA 4RFSB 1DELA 1G16A 3AVPA 3TMKA 2F55A 4RSGA 1P75A 1ZM4A 4CW7A 3R9WA 1K8RA 4D4JA 2V9PA 3NBYC 4MYTA 4KCGA 2W58A 2QEQA 3NBZC 4YMVA 2O8EB 2FSGA 4A2WA 1IJFA 2JJ1A 2ZJ2A 2FE4A 1NIJA 1YR6A 2WSSD 5HE8A 4H1VA 3SN6A 1M34E 4Q9LA 2MMGA 4MYCA 1W36C 2IUUA 2QPAA 1KJZA 3OZXA 5C46F 2WHXA 4EPTA 4W9MC 3CLVA 1GNPA 2YVUA 3T1VA 1U99A 3U61B 4TQ9A 1E0AA 2FWRA 4QBFA 1GG2A 1I2MA 1SXJE 1XTSA 2GEDA 3AF2A 4QGHA 5JEEA 3CWZA 1WQ1R 3MWLA 2QG6A 2VP0A 2VHJA 3GLHB 1E99A 3ZQ6A 2EW1A 4IVRA 3FHOA 4BRWA 1R8SA 2R65A 2X19A 1C4OA 5EE5B 4P3YA 4G0NA 1QBKC 4BWYA 3FOZA 1XMVA 5DISB 3EIHA 3FE2A 4OHZA 1TADA 4CEIA 2PCLA 2DBYA 2EQBA 1AKYA 2D2FA 3DPUA 3HP1A 3VX4A 1JI0A 2Q6TA 5CIQA 1X1SA 2OAQ1 3H84A 1CJMA 3B1YA 3RRNA 1W4RA 3VQTA 1G7TA 2V4ZA 1QHHA 5JRJA 3KJHA 4QGAA 5FBLB 1QHYA 2Z83A 3WP1B 2VH5R 4YDSA 1LS6A 1E1RD 1ZYUA 4JLJA 3K9HA 3QPUA 2XOKD 3EPKA 1E9RA 2A2ZA 4DLWA 4PR0A 5EUMA 1CP2A 4DIEA 1NG1A 2WJIA 3GJ8A 1IXZA 4B32A 4CDGA 1U81A 5FI0B 2WPDD 2QTVB 4A0HA 3KJIA 4O0MA 2ZSDA 5FOUA 2GZDA 5SZKB 3CBQA 4QM6A 3GLIE 1R10A 1U9IA 1UKEA 4Q7MB 3WMGA 1AQYA 4P4UA 5EE1A 2QP4A 1F6BA 2QE7A 2IYXA 2CJWA 4M1KA 1LNZA 2DWQA 5KSZA 1ZNZA 1ZP6A 3W90A 1VMAA 4DLXA 4QHSA 3HPQA 1LV7A 1P7CA 3T5DA 3U60B 1Z22A 2XB2A 4PC2A 1FUKA 1EWQA 3QKRA 3TGPA 3AEZA 3MWJA 5FBVB 1G5PA 1D8TA 1FTNA 2ZQ5A 2P65A 4EKDA 1VPLA 2ZAOA 4MH0R 2DHRA 1Z0KA 1UBEA 3EZ6A 3AGQA 8OHMA 1G4UR 2AK3A 4WZ6A 5FTNA 1KI2A 1LY1A 1UEJA 1NLZA 2G88A 2ZRPA 4B44A 3RAPR 5FPSA 5TVKA 5IHPA 2FZLA 5FPKA 5FTMA 3DEFA 5FPYA 4EPWA 2P67A 2AFIE 3AP3A 2GBLA 3QEOA 2YZ2A 1JQJC 4IDOA 3UKDA 3OIVA 4LC1A 4QJ4A 3NEYA 3LVRE 5HZKA 1ZD9A 1HYQA 5TV2A 3EPHA 4PQFA 2FPLA 1CJUC 2FA9A 1WCV1 1AQUA 3CIOA 3FFBA 4OL0A 5A0FA 4ZKEA 3ADCA 1E2JA 5E3HA 3OEEA 2UZ3A 1M8PA 1WDTA 4W5HA 2XZOA 2QENA 4MA4A 3U3RA 1Z6YA 3FGNA 3CRVA 2DFTA 2HCBA 3RS0A 1HE1C 3W6OA 4PHGA 2CXXA 1HA3A 3MD0A 4JVMA 3BAFA 4MRNA 2D06A 1JEEA 1J7KA 2C78A 4NTZA 3AM1A 4RD6A 1VIAA 2AN9A 2RGDA 1TEVA 2ZYUX 3K53A 5DN6D 4B3GA 3FFAA 1P61B 2J45A 5EJEA 5C4GB 2PH1A 5FR1A 4HLCA 4X8OA 1KI3A 1KK1A 5EE3A 3OE7D 4LK2A 4KVGA 1Y3AA 4L4UA 3X1WA 1NSTA 4UXHA 1Q44A 1W0JA 1DG1G 2RCNA 3KB2A 5BN5A 2GJKA 4Q4AB 4Q1DA 3LLUA 4R98A 1SVLA 2A3RA 4Z8XA 4D4MA 4PAQA 2ZI3A 2ZJOA 2ZYTX 1E79A 2IS1A 1DG3A 4HB3A 3OIYA 3BORA 4JLPA 5CM8B 4FCVA 2BJVA 4RFVA 2E87A 4NDZA 4FMCF 2X8AA 4BLPA 2YV5A 1XFAA 5CB8A 2OBNA 3FMOB 2AR7A 1PJRA 4K81B 1X6VA 2ZRMA 5K8UA 5GJCA 3UMFA 2FN4A 3RWMB 1XD8A 2CVFA 2WIAA 3EA5A 3M6AA 1XCPA 4TYQA 4F4CA 4ZIRA 2N42A 2OV2A 4Z1MD 4TMKA 4HAZA 2VHUA 3TLXA 3H86A 3ZZ0A 3SZRA 3PJRA 4ZDWA 1W47A 3TR0A 2YC2C 4GSYA 1E9FA 1OXVA 4DRZA 3L8YA 2IYZA 3T15A 4KHZA 2VTKA 4IOMA 4XSHA 3TSZA 1OH6A 1E2QA 2H5EA 4UXIA 1CF4A 2ZVQX 4NP6A 1N3BA 2V7QA 3TR5A 2WSSA 1ZM7A 4MGKR 2BMFA 4EQ6A 3U6KA 4ZCLA 3UWOA 1VG0B 4B35A 2ZRFA 3ZQJA 1TX4B 1VECA 1J70A 1FZQA 1P2SA 3TNFA 1JEDA 4B3DA 4JL8A 4C3ZA 2VRWA 1ZBDA 2IS6A 2QROA 3PUVA 2JLWA 3Q5DA 5TARA 3DKPA 2RKOA 1T6NA 1XX6A 2JLVA 3QXJA 4JLVA 4DUGA 3QBVA 4PTLA 2YHSA 1OB5A 3OEHA 4WA7A 1OFTA 3ASYA 2R62A 4RZUA 4KFUA 5DGXA 4I1VA 2ZRIA 1ZD8A 4AURA 3GJ0A 4IDHA 4QG7A 4B2PA 2G6BA 4G5RA 1HQCA 4OI1A 4A9AA 2Q21A 1RIFA 1NVUQ 3CX8A 4W5WA 1F48A 2EFGA 1W36B 2KI5A 4URVR 4A8JB 4AYWA 1MT0A 3GJ3A 4LV6A 3CZPA 3DZDA 1OFHA 1BS1A 1H65A 1L4UA 1Z5ZA 4WAUA 1J8MF 2N46A 1FFHA 3PQCA 2IF2A 5ANRB 5TMPA 4CZ2A 3Q72A 1US8A 3QPWA 1FP6A 2GNOA 4KFRA 3X2SA 2W6JD 3PFIA 1E4YA 5FTLA 5EZ6B 1VCOA 1W48A 3CR7A 1KZGB 2EU8A 5JCPA 1U8YA 721PA 3W5IA 4NE2A 4JJKA 3X1YA 3U6BA 3ZD6A 1CS4C 1E2HA 2HT1A 2GAOA 5BQ5A 1B23P 5CK4A 1KMQA 4KJZA 5CM9C 1EFTA 4DLUA 5FOVA 1CTQA 1KSGA 4CEJB 1L2TA 3ZS9A 2H1LA 2J0VA 3ADDA 5BW8A 3CPEA 2XGJA 3KJEA 5EQTA 4Z54A 4JSTA 3AH8A 4HDQB 2X77A 3SFZA 4RZXA 1AS3A 2BKUA 3HR7A 5C1BA 2YWGA 4FMDB 3VNVA 4ZDJA 4Q4JA 4PANA 2QPOA 4PSVA 4O3MA 5J4VA 1GFIA 2BMDA 3U7HB 1E2KA 3VR6A 1FUUA 1JXMA 1LTQA 3KQNA 2CVHA 5L3SA 1TU3A 5JS7A 1QHGA 4LYJA 4IW3B 1FOEB 4D0NA 1TTTA 3DL0A 4UNPA 4TTRA 5GVSA 2QSZA 3TUJC 2ONKA 5FPHA 2D62A 4OKSA 3IUYA 1AM4D 4LBVA 1ZC3A 2F1RA 1KIMA 1RJ9B 3TIFA 5AR1A 4M9XA 3LH5A 4PSKA 1WP9A 3GJ7A 3LLMA 4LBYA 2ZRDA 3A4MA 2HF8A 1Q20A 3WBJA 4JKYA 1XPRA 4B74A 1L7VC 4HEJA 4JLAA 3GPLA 3NDBB 4HB2A 2BBSA 4BLOA 3KUDA 4ERNA 1T8UA 2QY9A 1LB1B 2WJYA 1J2JA 3REGA 1M6NA 2GF9A 2JIZA 4RFSA 3Q8XB 1CRPA 2R6FA 4BASA 1U8AA 1X86B 4LOAA 4ZDIA 3NWJA 4OK6A 4C0SA 2QM7A 2ZUCA 1GP2A 3MUFA 3RWOA 4US0R 3ADBA 2IA5A 4FWIB 5J4LA 3JVUA 1G9XA 3MRSA 2J0QA 1Z3IX 3P4XA 4LJAA 3QKSA 4NMMA 3WHKA 1RRFA 1ZM3A 2CL6X 1F2UA 4PX9A 4D0GA 4A1FA 2OT3B 1IN7A 1E2DA 1E2NA 1PLJA 3NDPA 4PAMA 1F2UB 2B8WA 2DR3A 2FV8A 2O8DB 1KAOA 4WIAA 4P31A 4FINA 4RZ3A 2JLRA 1KMHA 1E79D 2GILA 3IIKA 3LX8A 1TQDA 2Q3FA 1E9DA 3PUXA 4M1OA 4QBHA 4KYIB 4EDHA 1JJVA 5BXQC 4OYHA 1GKIA 4Q4LA 3I5XA 1XXHB 4KO8A 4JT2A 4M1SA 4I99A 1FNNA 4BFVA 4XWOA 1Z6TA 1OE0A 3RRMA 4BQSA 4HDCA 4TZ6A 1GL7A 2Q9BA 2V1UA 3CR8A 3CPHA 1VTKA 4HB4A 4LHVA 3DVLA 2ZRAA 2BBOA 3ASZA 4M53A 4QOSA 4DLSA 4EAQA 1FNMA 2VBCA 4LX0A 1IJEA 3RC3A 3W6NA 1IN6A 3DOEA 2HF9A 3Q3JB 4X8LA 5E4FA 2DFKB 4LJ5A 3KKNA 1E94E 3U3OA 2OCYC 4G5SA 821PA 2BM0A 4TL7A 1J99A 2ZR7A 3QKUA 4LSGA 3LFUA 4K46A 3JZMA 3WYFA 2GXUA 2OAP1 5SZJA 1KJYA 2PZGA 3MFYA 5CJPA 2WWFA 2QUZA 4GFDA 3TBKA 2REOA 1N6OA 2ERXA 2FSFA 1MV5A 3HWSA 4GZMA 4LYHA 5FOSA 3TRFA 1CU1A 4YDHB 4XVUA 4AY2A 1IN8A 1ZC4A 1W49A 2OXCA 4WOPA 3T35A 3R20A 1SHZA 2Q0HA 2ZE5A 2XJ9A 4LY6A 4IRUB 3EZ9A 1H8HD 3RSLA 3A8TA 2EYUA 1ESNA 1A2BA 3SC3A 2FFQA 1WRBA 1CJKC 1S1MA 4MKFA 3P4YA 1GIAA 2ZRNA 4Q4AA 4JIMA 1EXMA 3THYA 3CPJB 2R8RA 2A30A 2VSXA 3GLGE 4FXPA 2RMKA 3CRQA 4IFBA 4KSBA 1E1RA 4HZUA 3GQBA 1KNQA 3CWQA 5TY0A 4D25A 1XEXA 1XJ0A 3NC1C 4DSOA 1M7GA 3FKSA 2FGKA 3VAAA 1E32A 2O52A 1HTWA 1KDPA 2QM8A 3T06B 3ZZTA 2GDJA 4P4TA 3ZLJA 1Q1EA 2VP9A 3A4LA 1OXUA 2OM2A 3K0CA 1G5RA 3L82B 2CMKA 1HT1E 1U9IC 4DT1A 3A1UA 5KDOA 4P4SB 3THOA 1BO6A 4KI0A 3FYHA 5AWFC 1IN4A 1SULA 5FFMA 3RS5A 4B6EA 1Z0DA 2G83A 2J59A 2WWHA 5JLJA 5BYJA 2OBLA 3LV8A 1SVMA 3QKTA 1EFRA 2OUKA 5CDFE 4O2LA 2O5VA 1AJEA 2I1VB 1MABB 2OO7A 4LJ6A 3K09C 3QVUA 2CJWB 1KI6B 1BH2A 1RJ9A 1NP6A 3IPXA 4CF7A 1KI1A 1KOFA 4NYIQ 2O0HA 4TL9A 3HJNA 421PA 1AN0A 4Y0AA 2WJJA 4I1UA 4NCKA 4YLGA 5B58C 2Z5FA 3NHAA 3S1AA 1MRSA 1ZCBA 4F91B 2VIIA 3B7GA 2GVZC 4DIDA 1WA5A 3FWYA 3IGFA 1G3RA 4HLDA 3IPYA 4EJSA 4IOKA 1Z6XA 2CL7X 3SYKA 5JI2E 1LW7A 1II9A 3FHTA 1SVSA 4Q1FA 2QSYA 1D9ZA 4XD7A 1SKYB 2QA5A 1FP7A 3P20A 5KDDA 1F5NA 3NKVA 5HR5A 1XDBA 1KZ7B 3ECCA 4B34A 4HZUB 2QRZA 4LRWA 4X8HA 1Z8FA 2C8VA 1SVWA 1VHTA 2ZJBA 5FUXA 2PMDA 3MGCA 3ZYCA 2Q9AA 1EK0A 4AG6A 5IK2A 1UPTA 2OCPA 1II8B 1EFHA 2FSHA 3L0IB 1QHNA 2ORIA 2ZRKA 1BMFA 5L3QA 2AD5A 2V6IA 3G82C 1M7HA 3QF7A 4MKGA 4ZCMA 1NJGA 1UBCA 4EFMA 3LNCA 5C18A 1UADA 2YWFA 4IFEA 4HB0A 3VKGA 1H8ED 1BMFD 4P4SA 1TQ4A 4AKEA 3ZVNA 3ZIAD 1DARA 2G0TA 2KWIA 1IHUA 4M1YA 4QC2A 1FQKA 3B1XA 2O8FB 2QT0A 4E03A 3C16C 4B2IA 2HJVA 1KI7A 5JSZB 2H57A 1RRPA 2GK6A 4B75A 1ANKA 1TF2A 2IYQA 4NL4H 5C4MA 3ND8A 2KSQA 4P32A 5FBRB 3AUYA 1OV4A 3QPVA 4R2HA 1V43A 5E7JA 1YQTA 3EC2A 4DLRA 1Q21A 1OT3A 1N6LA 3A1SA 4U5XA 2WWIA 4AC9A 1JBKA 3I8SA 3NBXX 3IEUA 4TMTA 1WXQA 4EPXA 2ZSBA 5IT5A 4YXWD 1GUAA 4HLUA 1SQ5A 4BZQA 3NXSA 2C95A 3CONA 3SBEA 3U7FB 4BFSA 4DLVA 2DYKA 4AKGA 2RGAA 2IYYA 1MO4A 2GJSA 1GTVA 2PJZA 2F1HA 3O8CA 2QTFA 4BPBA 1E2FA 2V54A 3HU2A 2DFNA 2XNSA 5KU1A 2HCJB 2GCNA 3VU9B 2WJHA 3T61A 2CDNA 3OF5A 4MDEA 1XTQA 5JJLA 2ODEA 3L8ZA 1LVGA 3QSYA 3NH9A 4TL6A 1KJWA 1Z6AA 2BM1A 5TXGA 3SU8A 2CHVA 1AS0A 2NQ2C 2V7QD 1XEWY 4DLZA 5JHHB 4RD4A 1HE8B 4DLYA 4WZAE 3R8FA 3VHLB 4IDQA 2JJ2D 4Y0VA 1M74A 2QP9X 1P60A 1YZGA 2PZFA 2ZANA 3WXMA 1OLOA 1XXHE 2RAPA 2DWOA 4F92B 2UZIR 3IILA 5L8VA 3OIUA 4NKRA 2BBWA 3W5JA 1YR7A 3W9YA 2VO1A 1ESMA 4CEHA 4B3CA 2BVNA 2Q3MA 1AA9A 5TDHA 2ONJA 1XF9A 3VR5A 1KKLA 1G64A 4G5OA 3CH4B 4Q47A 3G0HA 2FPMA 4RZ2A 5BYKA 2VP4A 2J87A 3CF6R 2ZE7A 1RKBA 1OH5A 4D2IA 4NYMQ 1HEIA 4OJQA 1U2RA 2ZE8A 2GAAA 2IXEA 3GLFA 4KU4A 2PZEA 1Y63A 3K0SA 3SJBA 2ZRCA 2ZTSA 3SJAA 2JLSA 3RRZA 4NU0A 2RGBA 1ZNWA 2QAGB 4PPQA 1M2OB 2PEYA 3PV0A 2IBMA 4F93B 3V4RA 4MYUA 4OJKA 4OHXA 3PEVA 3TJZA 2NO9A 2V55B 1VYUA 4QNRA 2JLXA 3CM0A 3KUCA 3ZJYA 2FFHA 1RE0A 1KMHB 2ERYA 3W6PA 5KYKA 3BFVA 3CW2A 4B3BA 5JFGA 2O8CA 5H1YA 4DEXA 1W4BA 2GJAA 5JI3E 1KK0A 3EARA 1UFQA 1UAAA 2C03A 5HZHA 4RJLA 3NEJA 1XCMA 5AJXA 1ELOA 4Q4HB 4TTQA 2XB4A 1D5CA 1E96A 4CGZA 2BC9A 4PFSA 3JVVA 3RNLA 2IS4A 2GVDC 2ZREA 1MO5A 4NYJR 2ZI5A 1A1VA 5G53C 1KDOA 1Z29A 2AXPA 1Z0FA 2GKSA 2XNDD 2ZYWX 4N0DA 4GL2A 4Q66C 2MMCA 4UXJA 2VP5A 3B1ZA 1ZRHA 3PENA 4UNNA 3QF4B 1IONA 1P4SA 2WJVA 1SGWA 4JYCA 4OI2A 1UKYA 2ZAMA 1ZNXA 2MSCB 5H8WA 2QAGC 4HLUC 1RC8A 4P33A 5H68A 3MWKA 1F2TA 4TT3D 3TVTA 3WNBA 2FGJA 4AYXA 3F0TA 3IKJA 1S9DA 4GZLA 2NO6A 4EFNA 5DN6A 1CXZA 3HR8A 1N6HA 2CK3D 4ARZB 2FSIA 1KI6A 4C0QC 1T5LA 3ZD7A 3AV0B 1NG9A 4RD3A 3TK1A 4IOJA 4ARZA 3VHXA 4Q1AA 3P27A 1FL9A 2FG5A 3QXSA 4ABYA 2FJUA 1NMZA 2VF8A 1RVDA 1GNRA 3CRW1 4MITA 5AJVB 3MJHA 1UBFA 4CEJA 4LPKA 2AL7A 4R9UC 1GNQA 5FOXA 1S9HA 2IS2A 1GKYA 2OE2A 2GTPA 5E7MA 3GP8A 2HEIA 2IYSA 1N25A 3K70B 3QXCA 4V0KA 5FBWB 5GJBA 2KE5A 4TQAA 3DHWC 4Q4JB 3THWA 2F43B 2BHRA 4LPSA 4EUNA 5CDFA 1TUEA 3PEUA 5KDLA 2XTMA 3B13B 3I1FA 2G0NA 5A4JA 4U7DA 4LV5B 3IHLA 2GCOB 2WWXA 4A8JA 4URWR 1W5TA 5CLLA 3EX7C 2FX3A 2G3YA 4A2QA 5F9FA 3C15C 4PAOA 1T9HA 3OE7A 5CYPA 4DCSA 4GI7A 2IWRA 4BEJA 1K6MA 4Q1CA 1JALA 2FOLA 2NTYC 1DEKA 4ZIRB 1COWA 2HLDD 4XIGS 2DB3A 2PEZA 4I81A 3D3QA 5EXTA 4FCWA 1Z2AA 2IXFA 4A6XA 1FQJA 4D0LB 3K0AB 1SXJB 4PZLA 3AVXA 1P3JA 1GM5A 1KI8A 1G8YA 1TUIA 3Q7PA 2JDID 4DC9A 4LJ9A 5CJ2A 1RPZA 2OFOA 4KFTA 3WP0A 3NBFA 3U4QB 1P9WA 5CK5A 3AF1A 4KXFB 5FR2A 1DO0A 3GFPA 4D26A 2ODNA 1EFUA 1MKYA 2IHBA 1GWNA 2YC4C 4FMDF 3CO5A 1DS6A 1NIPA 3P26A 1KYIA 3UG6A 1E9SA 2J0UA 4MGYR 4ASUD 4WXPA 1G8PA 3CNLA 3TVDA 3I61A 2P6RA 4EIWA 4NH0A 4D80A 2A78A 4PC7A 1E3MA 2P2LA 2GEUA 1W44A 2C9YA 4H1UA 2PMKA 3B2EA 3FMPB 5JMTA 4B71A 2HYIC 2X2EA 3K0CC 4BLTA 4DCNA 1KO1A 2NZJA 3KX2A 1E9CA 1TPZA 3KDSE 4NYMR 4BZPA 3ONWA 4ZV4A 1GDDA 1R0YA 1P2TA 4FD2A 5L3VA 1NVVR 1N2CE 3TH5A 1OIXA 1NJFA 1QZXA 1TNDA 4IOLA 5GJVC 4A0FA 4DDUA 5JWOA 4UJ3A 4Q18A 2JCSA 4MUAA 4TLAA 4OI4A 4HYYA 3KTAB 1XP8A 2CNWA 4A36A 2CBZA 2EYQA 3W8RA 1Q1ZA 2J7PA 4KLNA 3U2QA 5K8TA 2GJ9A 5UKDA 1N6KA 3DO6A 3Q9LA 4HUQB 3H1TA 4AI6A 1HT2E 2NZ8A 4DCTA 1ZIOA 2R2AA 3SS8A 2RGGA 4HATA 2O8BB 3QKSB 3I5YA 4O2RA 2BCJQ 2YWEA 3EIEA 5DIFA 1G18A 4Q7JB 5GADl 3PVSA 3UG7A 3SYLA 4IHQA 2QN6A 4YMWA 2J7KA 4UNRA 2FFBA 1XMIA 2FF7A 5HE9A 3LBIA 1BYUA 3R9XA 2H16A 3SOPA 2ZE6A 2WVJA 1R5NA 1W2HA 4NCNA 1WBDA 1EESA 3ICQB 1F60A 2CLSA 1GITA 3MJRA 2Y8EA 4CYMA 3QQ5A 1N0VC 3N2IA 2BDTA 4KODA 3PCRB 1IQPA 1OIVA 1TQ2A 3BK7A 2FZ4A 1IXSB 3H0KA 3KFVA 4JVNA 1DAIA 5DE3A 4IVPA 4LBWA 2CLCX 3DZ8A 4QHYA 2F1IA 1KI4A 1DAGA 3WYGA 1P2VA 1IY2A 2F1JA 1N6RA 3I72A 3T34A 4NCHA 1ZVQA 2PT5A 1KGDA 1Z0AA 4RD1A 2WKRA 4OHWA 2XNDA 4HZIA 3E5HA 4Q9JA 1OXTA 3KTAA 2VQSA 2NIPA 5TB5A 4R71A 1E6CA 3D6TB 4WXRA 4QNMA 2BEKA 2ZSAA 3VFDA 4MRSA 4MRPA 1G8GA 5LB2A 3CF2A 1CKEA 1NBMD 5EE0A 2GZAA 1OH7A 5KHOC 3N70A 3E2IA 3E1SA 4MRVA 2ZJ5A 1VCIA 3EZ2A 3TUZC 3P1JA 3RABA 1J8YF 1NVVQ 2XJ4A 1TMKA 3F3YA 3AF3A 4CVNA 2P6UA 1Q3TA 1XMSA 4R2IA 2O0KA 3B1WA 3HU3A 2WAYA 1UDWA 3I32A 5AJWA 3TSWA 4PPGA 1DTSA 3KQHA 3BD9A 1OJLA 2LWIA 4DDVA 2B6HA 1KO4A 3EASA 1KSHA 1BYIA 3X1ZA 5J4HA 4MGIR 4URYR 3THWB 2QBYB 2JAQA 1K5DA 4PO9A 4YMUA 1BOFA 3R7WB 2D4HA 4CRWB 1P9NA 2ZUBA 1R7RA 1CR2A 1YU9A 2GA8A 3UPUA 2X2FA 3CF0A 1W4AA 2NO7A 3OFND 1C1YA 2QRNA 3KKPA 3WHLA 3T5GA 1Q57A 1R5OA 1ZUIA 4JBYA 2GWHA 1R5BA 3W3ZB 5FL7D 4N0EA 4C9BA 4QJ3A 2BOVA 4POAA 4BRUA 3DKVA 2WTUA 4TMXA 4HLQB 4LYAA 4YQFA 2H17A 2AKAB 4AYTA 1Z08A 4PO8A 1TQ6A 1Z83A 1IAQA 3KL4A 1RRCA 4TYNA 3ZZUA 4BFZA 3BIFA 3AVWA 3UIEA 4L8GA 3VR2A 4ZCIA 1HH4A 1SKYE 2YWHA 4HUTA 4AKHA 2OEPA 3GMTA 1FTSA 2GZHA 4F38A 4FMCB 1ZJ6A 2F43A 2YINC 4M8NE 5G3ZA 3AVYA 1VHLA 5JWRA 1S0UA 1OXSC 1N5LA 2HT6A 4EJSC 5J4KA 1TU4A 2WMOB 4Q7KA 5G41A 2IYRA 4DSNA 2OESA 3HDTA 5BN4A 2OG2A 5KSOA 3W34A 3RYTC 1W0KD 1XZPA 2W0SA 3ADKA 4LHYA 5D3MA 1XJCA 2WOOA 3TQCA 1P5ZB 1Z6GA 2CHGA 1KY3A 1Z2CA 1QHXA 3IO5A 1UM8A 4LHWA 3RLFA 3UXMA 3EPLA 3OAAD 4PHHA 2B7CA 3BJIC 4L9WA 3A6PC 3LY5A 1MABA 2XEXA 3I8XA 2BV3A 2WPDA 1MO6A 2BCGY 4LJYA
chains in the Genus database with same CATH superfamily
4E22A 1DQZA 4LMPA 1Y81A 5EQFA 3THSA 4BNDA 3KR9A 4WNIA 3F8TA 3B52X 5IAJA 2RGEA 1BEUB 1Z5VA 2R97A 3SM3A 4TKZA 1KO5A 5IC6A 3G3EA 1K06A 1QV6A 4QT4A 1SZPA 2GCEA 3O8NA 3I0ZA 3WISA 5IASA 1T4BA 3IAEA 3KKMA 2R79A 3CEAA 1AKEA 4DAEA 1H2ZA 5D2CA 1H05A 5AMXA 4H7EA 1WNFA 3IQHX 4KW7A 3M1AA 1UBRS 2A0XA 1VOTA 3PC4A 1ZBQA 4I1IA 2WYUA 3JRWA 4CHGA 5FWNA 2AX4A 2WOJA 3B5JA 5FPQA 5BQOA 4ARVA 1GRRA 1SIBE 4WERA 5IPFA 4NBSA 1JT2A 1GA4A 4ZOLB 4BKQA 4WQMA 2H51A 3GLFB 4RCVA 4D96A 1YQEA 4UZEA 2VYND 2BLLA 3EPRA 3C1UA 2AJDA 5EPEA 2RIRA 5EERA 1J49A 3KDAA 1Y33E 3ROPA 1GOTA 2X6TA 4CL0A 1VIVA 1OHHD 3U7EB 3SD7A 1JAIA 2BFMA 4KE8A 2QGNA 3BIXA 3UOWA 4ITVA 2FZKA 1SRQA 1V8ZA 2VA8A 3IBCA 3NOQA 1ZK0A 4L16A 4YJDA 4ZXFA 4UEJA 4DTIA 4G1UC 4BV2A 1YRBA 3BXEA 3OE1A 4XKJA 2HLPA 2JFZA 3UV7A 2CMGA 2DR0A 2CLEB 3TGLA 5CNIA 5AXBA 4RIIA 4YJFA 1TA4A 1R74A 5U4QA 1OTHA 3G17A 2BKEA 4XD2A 2O8DA 2HSZA 1V4VA 2WIFA 5G02A 1QNFA 3EF1A 1XEAA 4O4LA 1RJFA 4DVGA 2IPAB 4X6LA 4ZYXA 4D7AA 4IPTA 1X1AA 3ETLA 4GXTA 3ZKWA 5FJJA 4KQ2A 4RHYA 3PTAA 3LJKA 3B48A 1Z4MA 3DBRA 5IK2D 1QF7A 3I64A 4JJZA 2MU1A 4TV9B 3JRNA 4ENVA 2UVPB 2QRGA 2WYOA 2O2EA 4QREA 5AVQA 4E46A 3IQIX 1EK5A 1TUGA 3QUCA 3RRYA 5FBHA 1PR1A 1UF9A 3R7FA 4DUPA 2WZBA 4OH7A 2GDZA 3Q98A 4LFCB 1GSHA 1V48A 4DOMA 4DT1B 1ORDA 4QGGA 4U6QA 3I6YA 2EJBA 1VA4A 4Q3DA 3WKBA 1HDXA 3BDIA 4O2BB 4RF5A 3NZEA 3HPRA 3KALA 3N76A 4UMVA 4YONB 1DQYA 1F0PA 3BL6A 2KX7A 1WUYA 2C5SA 2GD1O 2ZGVA 1FNDA 3LCMA 3N6RA 4QBIA 1S2MA 1K6JA 1B8VA 2CK3A 2DTXA 3NDIA 1BN7A 1LGYA 5EMJA 1QCYA 3N58A 1R9JA 2X1VA 4I5GA 3PIRA 4L15A 2HLHA 4KK3A 4MWEA 5G40A 5TT0A 3W5DA 1KEEB 1W5AA 4ZDKA 4YFYA 2H92A 5H5JA 4GW3A 5AW6A 4F96A 3EMVA 1NVEA 1KSJA 5SY6A 2RHTA 4OM8A 1GCOA 1QVWA 3B9QA 3BAZA 1YC5A 1EK6A 1K7XB 1YZNA 3LQYA 4MKRA 2ZPTX 4G6ZA 3T38A 1ADFA 1SD1A 3QU9A 3OJEA 1TB4A 5MN5A 1MF7A 2VQEB 3WY9A 5CT4A 3OE4A 1KPIA 4N18A 3IQXA 3N2LA 1HY3A 5DXAA 3ZCRA 2FX2A 4TV8A 3U4QA 1X87A 1A2KC 1BVRA 1Q1BA 2P9BA 2Q5LA 4Y67A 3OU2A 5IXJA 3S8YA 1NBWB 1QAMA 1TJ5A 4Q24A 1F6WA 1W2WB 4HX2A 4BC1A 2AFHE 2X8JB 2GX6A 3DYBA 1DE0A 4WKNA 1K0FA 1IJBA 3LCVB 3H5RA 3S81A 1FP4B 1R6BX 4YCMA 1XTJA 5JXWA 1UPBA 5CYGA 2KB0A 1Q5PA 3M9WA 1GEEA 2YYZA 1CUDA 1PD1A 3IALA 3RIMA 3ZIAA 3ZCPA 3BGDA 3QUBA 4NATA 1JHQA 4JU9A 2XVMA 2C57A 2HV8A 2O23A 1F7UA 3C45A 2FZ5A 2Z95A 1TTPB 4AG3A 1CYEA 3ITKA 1KJIA 1P7YA 1G20A 1ZI8A 3KYBA 3LXXA 4TTTS 1N8KA 2O0JA 1R3UA 2XA2A 3VJMA 2PCJA 2D74A 2QNRA 2GBLC 1NPTO 1R4AA 1T5TA 3GGJA 5GJWC 5CEFA 3EJ6A 5BQFA 1SHJA 4GBGA 2D59A 1UP6A 3D4LA 2C2WA 3OUZA 4RA9B 5HIAA 1X2EA 1Z2EA 4QELA 5AJTA 2A7QA 1KVSA 3JQRA 1IE3A 3IEKA 5JDCA 3KLNA 4L78A 1EAYA 3PJDA 4HVTA 4RH3A 3WLPA 1TEHA 1UDXA 3P9RA 4BX3A 4EJ6A 2AQIA 3FVQA 4MR8B 3AETA 2W22A 2G06A 3KAKA 4DM3A 5HJ5A 1FC0A 3AHEA 3MTGA 2WICA 4TSFA 4C30A 1WS6A 2VFAA 3B6EA 1QIEA 3QXXA 4G9GA 3ICEA 1HUQA 3ONDA 1CY8A 4BZXA 3ZJ4A 3NW9A 1G8JA 2GCIA 4YJ3A 3ZHOA 2QVCA 5FHRA 4M98A 1V8OA 1I7SB 1QLHA 1ZSNA 1DAFA 3H2ZA 4MAMA 2XXBA 2RJNA 4B8ZA 4MIEA 3ZU4A 5DLQC 1JTVA 4WZBA 4O0LA 3CLKA 1EGMB 1E2IA 2EBHX 1GVNB 4FMBB 5BOVA 3UMVA 1NF8A 2OOSA 3KEGA 2VJQA 2JIOA 2XNHA 4DEVA 2BHTA 4K6HA 4DG9A 3C7KA 1EVIA 4HFRA 1RRKA 4UHHA 3GBPA 2IC5A 4LWZA 5JSFA 1JDBC 4B33A 1NLYA 1J2EA 2FZWA 1D2NA 2VDJA 3TSOA 5K0BA 2VEDA 1LU9A 3DDNA 1NBOA 2DZDA 1PJQA 2DBZA 4MHOA 3SVTA 3PRKE 1DO2A 1W5EA 4KSCA 2XVYA 4TLBA 5AUNB 2Z30A 5KQSA 3WRWA 2ALJA 4JVSB 2WTXA 2I34A 4PZUA 1KI9A 4ZHQA 2VSFA 3BE5A 4JC0A 2FZVA 1K97A 3KYIB 4PRKA 4C2TA 1JJ7A 3V9PA 4FC7A 1AV7A 3MELA 5K9ZA 2H1RA 1QGUA 2G0AA 1X3LA 3A1WA 2PH5A 4OQXA 5E1DA 4PHCA 5EQJB 1JNXX 2OCXA 3N5CA 1JQLB 3A1EA 3MOIA 1GILA 3ONEA 4RMHA 4A0GA 4MINA 5K0ZA 3KB1A 4MPJA 4F8YA 4QU9A 5EP4A 4QSMA 4Q4HA 4G5GA 4GI3A 5BSHA 5I6DA 1LI7A 4Y6LA 4O2AB 4XQ0A 4EK9A 1KJQA 5EXSA 1XEFA 2W2XA 4J8PA 1FVOA 2AZDA 1PS9A 3HB1A 4D4IA 1N5RA 3HUEA 4B4DA 5G1NA 4PZYA 1WB6A 4LEIA 1SRRA 1F8YA 1JECA 2POQX 4IHKA 4D79A 4KXMA 4F12A 4AECA 1X1DA 5JDCC 3TPFA 1N0IA 4IDBA 1QZ3A 1AD2A 2CCKA 4MWDA 4O4IF 3VR6D 5ALIA 5AO9A 3HCCA 1NBME 2B5OA 4XR4A 3PE4A 3ELDA 3TNLA 4FZ5A 1LBIA 2VYFA 2IEIA 3I39X 3LY7A 3N87A 2XOEA 2ZEJA 2PX5A 3TDKA 4Z8YA 3UK1A 3GEEA 4QODA 4RW0A 3M9XA 4BVJA 3WLTA 2WA2A 1T1GA 1N5OX 1YASA 4PIPA 1GKUB 3W5VA 5HILA 3QENA 5KNBA 1C7EA 3AWDA 4QGFA 4E7OA 4EG0A 1UT5A 3HZZA 5AK0A 5ITVA 4BECA 4ID3A 1I13A 3LBHA 2H2GA 5EIWA 3P4UA 1YJ5A 1JVNA 2A5DA 3HB5X 1LSUA 1T26A 2GN2A 2Z8XA 3GMDA 3T1OA 4PN7A 3U7GA 2IPLA 4JL6A 2PL3A 5T6BA 3I4CA 3PQFA 5E2BA 2QW0X 2GN8A 4HJXA 1C9DB 3NYRA 4PIVA 2BDUA 1WXHA 5A5GA 1ZKDA 3LVQE 5DXFA 5FWYB 5SY9A 2ODWA 2OFFA 3PUKA 3V00A 2MYNA 1Z8DA 4DNPA 3FCCA 3LQFA 2PSDA 4FEEA 4ZEMA 3H4VA 1OX6A 5LDHA 5DNCA 3UKOA 3FMVA 1ECCA 1NF9A 4I8XA 3TLMA 5MGBA 5DM0A 3TD2A 3HFRA 4DDTA 4K40A 1LLQA 3R7NA 3P2IA 1PUJA 3DH0A 3UMGA 1NYQA 5FWAA 2QMUA 1FU7A 3ZCQA 4CT4B 2VN8A 2WJGA 4KRGA 1A5BB 1QHEA 2JPDA 2WT4A 1LFAA 2QL9A 1XMOB 4W5TA 2IZ5A 2Y0DA 4XWKA 2RHHA 5JSQA 3E9DA 1RLIA 4Q9IA 3PC6A 1DMRA 3TQFA 3NQ41 1U8ZA 2E0IA 4A6DA 3TCXB 3V4PB 1JKMA 1TCVA 1KNXA 3QEJA 2NU7B 2GF0A 1WY7A 4P36A 1JV2B 2ZVPX 1KC3A 1OIWA 2A1TR 2A5JA 2VXOA 4YFVA 1GRVA 1G7SA 5J2TF 1G42A 5CGZA 4DQDA 4MWTA 3ZU3A 2PT7A 2RAFA 4ND8A 4DHEA 2EV9A 2Q62A 4GMDA 4OK5A 1NVXQ 4BLQA 4EG4A 1ZXLA 3LDGA 5IS2A 5H59A 5I7OA 1O5OA 2EFEB 1C4KA 1AGRA 4M8LA 4DSZA 4ZRDA 1UQUA 3NT4A 2FRVA 4CMAA 4R7ZA 3I2GA 3UWKA 4A2PA 2ES4A 1OPRA 1L8AA 4KWTA 1M0SA 1BU5A 1L1EA 3RANA 1VE5A 2NNWB 2WTAA 2YZGA 2C4MA 4JLKA 4RCZA 1G7RA 5E4JA 1Y3HA 2J9YB 4M0UA 2ZS9A 4D82A 2E6UX 4RHXA 3VR3A 4WI1A 3LGSA 3QE2A 4E5UA 3TLZA 2YNMA 4D9HA 1IMOA 1WIWA 1OLXA 1DBRA 1E6MA 1XQ9A 2PZJA 3GNLA 4JB2A 1V71A 3CUTA 3A36A 3IHTA 4QDKA 3WRVA 1OYWA 1NMXA 2IF0A 2MTBA 3WWZA 4BTEA 3FCEA 2LCQA 1MC1A 3LWNA 3SCZA 5ALQA 5J1TB 3OF2A 3M0EA 2ZETA 3IPLA 3PWZA 5F76A 5HZMA 1DL5A 5EIOA 3K8YA 4JT9A 4DNOA 1UOPA 2QDKA 1UJ2A 2B21A 1H6BA 4MS1A 1CZHA 1U8CB 1KDTA 2GBFA 3IR7A 4PR3A 4PBSA 1DIBA 4XYBA 2Q1XA 2JFUA 2QJTA 3SQDA 1ZWKA 2BHNA 3IJEB 4YQEA 1V5GA 2KLBA 4TKVA 2WU8A 1NVGA 1V1RA 3OEYA 4XLLA 3E1GA 1TYEB 4PZAA 4FWTA 3UWSA 4M6WA 3TB6A 3EAQA 3DBHA 5CX4A 2QTTA 1YGPA 2C1EA 1LRJA 1JA1A 2PKCA 2AMVA 2FU5C 2Q4RA 3BWCA 1JJFA 4ADSG 2HXYA 2RONA 1UP4A 2JHFA 3KR0A 4KVAA 5FLYA 4I50F 3RLIA 3V8EA 3WNZA 3E2MA 1QG2A 1SUDA 3REFA 3F4KA 3LBNA 4I9FA 1QCZA 3IAHA 4NICA 2P11A 4RGQA 1FIUA 1FRQA 1CLUA 3JQFA 4LTDA 1XIVA 2VSOA 3L05A 4GDMA 3B6IA 4WFIA 4I4IA 4A23A 5A3RA 2E5LB 1O4WA 4OXRA 2E2WA 1E0SA 5GPBA 3LXRA 5KMGA 3PPWA 4QECA 2HA4A 3AJAA 4L22A 1EPUA 2QQEA 2RBGA 1NVWQ 1Q0QA 2CNLA 4WZBB 3BWVA 3K6JA 2CFRA 3JQ7A 4CIVA 3OOYA 1BXRB 1SXGA 2B99A 3RVNA 3T3HA 3Q3GE 1UBHS 5BR1A 5C3MA 2H2WA 1QHHB 2XBMA 1IG0A 2F1OA 3QY0A 4JVLA 1CUAA 1JKFA 1DUIA 4MWSA 5ERXA 1RQ7A 5LQNA 3A6KA 3AVVA 4DV3B 3AW9A 3GCGA 2JASA 4GLJA 2PX8A 4JLMA 4QWMA 1WTCA 1X8XA 4UJ3A 3ZK9A 4GDFA 4I1SA 1CB7A 3TMAA 2VBIA 2WKPA 3NAQA 4TZTA 4HTFA 3W9SA 1XCGB 5ALRA 3WKEA 2GHTA 1GPBA 2WJ4A 2G9ZA 1SY7A 1QUEA 1HURA 2A1UA 3BPSA 3WRYC 4C7KA 2C8LA 2TMDA 3UH1A 1H2XA 1G21E 4M0LA 5TQVA 1E8NA 1FS4A 3U3KA 2IYTA 2XWJI 4W63A 1T0PA 1DUVG 2Z08A 2CXUA 3MMXA 1H2EA 4A8JC 3QVGA 3I0MA 1TGYA 3KU4A 4YP5A 4TOIA 2GFIA 4LGMA 3C6KA 1WVGA 3A9WA 5JVDB 3DZJA 3IDQA 2HR1A 3CJTA 4X1YA 4EMBA 1EG7A 3AVTA 1WHTA 3G85A 4NONA 2P9EA 5I8WA 2WIBA 5M04A 1GFZA 4YCCA 3IOMA 1UINA 3IT0A 3QVJA 3QYAA 1LBTA 1H42A 1KZ4A 2QQ0A 1CQJA 3KKQA 5H82A 1UZAA 3ODGA 1JQ5A 4MX8A 2G4VA 1EMDA 1U28C 1NBHA 4HWPA 1LXCA 3WFIA 2J9ZB 5FL3A 4ZZIA 2D8MA 4WASA 1NW5A 1GU0A 2AG5A 6REQB 1DVRA 3KT6A 5MN4A 3KKZA 3L8EA 4HPXB 2QN9A 3NLLA 1AA6A 3BKXA 3EG5A 1XDSA 3R7SA 4EKNB 3UT5B 3C6XA 2Z5VA 3H6HA 4A10A 1R1DA 3ISTA 2BGLA 2REBA 4FIDA 3V4SA 1GL6A 3P2MA 3FDFA 2IYLD 2PLRA 3OE5A 4HDNB 4A0RA 5DW0A 2IP2A 4P6VF 3O8QB 3OFNA 4DDWA 5DW3A 3R74A 4EP1A 3C6BA 3PJFA 3GLFE 1TAQA 3LS2A 1EXWA 2BZGA 3H4IA 4F3RA 1C7RA 2VEOA 4TN1A 3ET5A 4EO4A 3COPA 2P9QA 3LY8A 3L77A 4GOXA 4Q6BA 1WB5A 2EBUA 3D6AA 5TQ2B 2VYQA 1N9GA 4I19A 5JU6A 1FNCA 2W2KA 3N9IA 2ZR9A 3O84A 4BNZA 1O8CA 3OESA 3QI7A 1OXKB 1T8PA 3S55A 3QLVA 1T8RA 1ZD5A 4G2TA 3WFJA 1XMJA 4TMYA 3AR6A 2PLFA 2B35A 4IZHA 3V1YA 4MW6A 3NUGA 3T4EA 7AT1A 1CZOA 3FLAA 1PD0A 1QFSA 1JR4A 4U7PB 4ZV7A 3SJZA 4DV7B 1W88B 4MMYB 5DYIA 2HX1A 2B8NA 2FFJA 4AY5A 1X8LA 3TCNA 2XOXA 4EQ6B 1NLMA 4KBFA 1A27A 1XXLA 4CMEC 2PGNA 4MIOA 4CBVA 1NM5C 1UFOA 3UJ9A 5MDHA 4QFCA 4EO9A 1GRNA 1NRIA 1P72A 2I3DA 2V7XA 3I2IA 1ZA2A 2GEVA 4H6WA 4RQTA 1PX2A 2V3CC 5AW3A 2GD2A 1IOVA 1JU3A 1PHPA 1O0SA 1J90A 1RXIA 2IY7A 3E7FA 1HTTA 3HH8A 3IQEA 3LAWA 4NFLA 2XWSA 1EWTA 4AUEA 2FPRA 1FS5A 1T3LA 3BRQA 3IQWA 4FDAA 1QVRA 4Q21A 2O8EA 1ISIA 3G2HA 4R41A 1QE5A 2NMVA 3NHKA 2R4TA 1RZUA 2X5XA 3LM8A 3EDRA 4LJRA 1KYQA 1WF3A 4F86A 5KQLA 4EW3A 2Q4EA 2PIAA 3QBJA 3VR3D 5MF6A 4EI9A 1X15A 4NE9A 3A11A 4KQXA 4KREA 3E8SA 4HN4B 2FLKA 3QLUC 1RWKA 2FF5A 3MWGA 3CCFA 2H9IA 4XWWA 1Y8CA 1G291 3H42B 3ROEA 4ZJZA 5JPCA 3R77A 1IBRA 3HYRA 4HAXA 5CTAA 3RS4A 1XZIA 2EOAA 2OD2A 2NXNA 3U5ZB 2QGZA 4IDCA 3JQPA 2JLYA 2BMVA 2D7DA 4GRIA 5FPTA 4BEVA 1TAHA 2PU5A 2Q5OA 1SCUB 4JB3A 2HMSA 5G4LA 2ORWA 1JU9A 3C4JA 1EA5A 4D4KA 5ESWA 4P58A 4QDUA 3THYB 3JATB 1WU8A 4RU1A 4DA0A 2YJGA 1E9AA 3NHBA 3ZZNA 2X0FA 1CEEA 1XQYA 1XZGA 2CLKB 2PSHA 4ZQIA 3V1LA 2H1SA 5E8JA 5K3CA 1XN4A 2CLHB 3BG5A 3LYUA 4Q3BA 2X2OA 5JZSA 4R9RA 4HDNA 1JKXA 2E9SA 2JATA 3EXFA 2XXAB 5GINE 1Y4UA 1CP3A 4E33A 3KHKA 2H1OA 4FFBB 4Z9FA 3EUFA 5DYGA 4O1MA 3BCSA 3M4NA 4WBNF 3QZUA 4FGUA 5KJ6A 1L5MA 4Q19A 3BFKA 5IUNC 4QOGA 1LF0A 1XR3A 5HM8A 1PG5A 2JA2A 2NUAA 3SDSA 5AT1A 5JUWA 3DOFA 1AF4A 1DMSA 2P91A 4BNJA 5JZVA 3I92A 4XJXA 4C7OA 2QB5A 2BKXA 3O8DA 5JQWA 5LMUB 3ZWQA 3LFTA 1KXZA 1YIOA 1YZFA 2NV0A 3MMPA 2HK8A 3FUTA 2GXSA 3A58B 2BEUB 4BIMA 3ND5A 1YBMA 5AK3A 2A0UA 3PT5A 4G8DA 4OFXA 4IFTA 4RPHA 3R5FA 4C14A 4D6PA 2WB2A 1U2GA 1KAMA 3BXXA 5LZ8A 5KNCA 3GGOA 1KAEA 3CLRD 3INRA 3D7NA 3O82A 1IEXA 1SCQA 1KP3A 2Y92A 3QE3A 4JC8A 4Q9AA 5ALVA 1TVKB 2YRWA 4ISCA 3VRHA 3WOHA 1N2IA 2C2HA 1IY9A 4OA8A 4BB9A 2I0FA 3O03A 3A6EA 2ZRLA 3HDQA 3PBKA 3ZIUA 1H4VB 1TUBB 5BRNA 3U3ZA 1J2TA 2QD1A 3MQ4A 4JR1A 3HB7A 2FZEA 4U8GA 2XBLA 4TV9A 4BE7B 3IE2A 2BMJA 3MYYA 3NIGB 3TTXA 1XL0A 1YL5A 3EVDA 5JECA 3L0ZA 3GB9A 3V48A 2VDQB 5F7OA 3U3XA 5JNVA 3WZMA 2ZYVX 1ZLYA 3D64A 3Q9UA 4ILEA 4EBBA 5AVXA 5FUVA 2BGWA 1RM3A 2C04A 2UZAA 1Y42X 4LWOA 1YB5A 3IJ5A 4CT0A 3ZXXA 1GO2A 4RWEA 5BP7A 2HWUA 3Q85A 5KYWA 1V7PC 4V02A 4EFDA 3R75A 2R4QA 1IZYA 1FNBA 1P1CA 2GNAA 1XG5A 1O3YA 1XYYA 2E82A 4AO6A 4OQQA 4YRZA 1MVOA 3H0CA 3KKEA 1JNYA 2Z1DA 3OZWA 4YAOA 1GPNA 2GXQA 4Y2JA 3RRXA 1YVUA 4ZMBA 3EE6A 4UVHA 3JW8A 4QRIA 4YP1A 4N65A 4RK1A 2C4UA 1TFRA 5EJ8A 1A9ZA 1U28A 1I32A 2CXQA 2C61A 4FNMA 4OMFG 5LYJB 5B7NA 3I9V1 4MO2A 4TMWA 1MAAA 4YRKA 4LHXA 4PFJA 2PJRA 3N86A 1SB9A 1QK4A 4UQLA 3NIBA 1T0IA 6PFKA 2HA6A 1YULA 2Y71A 4RL6A 16PKA 2Z43A 3MTDA 5JRZA 2RGXA 4DVJA 3WMEA 1NN3A 3C5HA 5ALSA 4P3OA 1YZUA 4QNNA 1S8NA 1M2VB 3V6LA 1DWPA 2JNWA 4GL4A 1QK3A 3F7NA 5KI6A 4HDKB 4DMRA 4OL9A 2VP2A 5JAUA 5H16A 1U1DA 1NFQA 3EFBA 4IJUA 2HV9A 2VL7A 4MICA 2WYIA 4BQFA 4TV9F 3NETA 4P2BA 4ALIA 2JDIA 3M5CA 4MYHA 3IERA 2XRYA 1GAJA 1QDEA 2RHRA 2RGCA 2YJTD 2J3IA 2F3RA 2Q9CA 2VHZA 4FSXA 4JKIA 1RAGA 3H9QA 1M5RA 1PS0A 2J5QA 3D4IA 3I52A 1L8XA 3RS2A 1VG8A 5KB3A 4NXNB 2AI3A 3IAS6 2WQ7A 2ZTUA 5AKZA 3WQQA 3JZIA 4ZEVA 3OY7A 3PFGA 3PE3A 2HADA 4ZTZB 5B6JA 4FGWA 4UAGA 3K09A 1CRZA 3GD7A 4ARAA 4Y2RA 4C43A 3B8HA 4NVRA 5HQ3A 4QDZA 3U3DA 3P52A 1M7BA 3HV0A 3VPDA 4FZVA 4RS3A 3EW9A 3QIAA 4MYRA 4HAWA 5I5EA 2R1ZA 3ZCUA 2XCRB 3NAMA 2XTZA 1NKSA 3WL4A 3CZQA 1FY2A 1ND6A 3H9UA 1FFEA 3G6WA 3GDFA 2YNMD 4X93A 4DMKA 2H31A 4AJLA 1KEEA 3QBDA 1WEKA 4RY2A 4XZ3A 2XZLA 2BPOA 2YQ5A 1MEEA 1WSAA 4YRRA 2BEWA 3TAUA 1I2BA 1Y37A 4GPTA 2AFHB 4XGKA 3WGIA 3G9ZA 3HCNA 2W2VA 1C9KA 2V7BA 5FTKA 2V6JA 3PNPA 3L06A 3NXKA 4LTMA 5HTKA 3LHDA 3UHAA 3WWCA 1E89A 4IIJB 4MV0A 1OYOA 2B8TA 4Y1EA 4AZWA 4K9SA 4W7SA 3BB1A 2H85A 2FX5A 3BREA 2XVXA 3WJAA 3HO1A 1DDGA 1DQPA 1WLYA 4A0SA 3KKKA 1JFTA 4QXAA 3CZRA 1GSIA 4AJNA 4KXNA 3AP2A 2VF7A 2A33A 1W46A 1WE2A 1XQ6A 1SKQA 5EY5B 1XE3A 1R88A 2GM3A 4C01A 1RAHA 3O93A 1U9ZA 4WKCA 4BNIA 3L7NA 5KOYA 2IW3A 5DPMA 4C4ZA 4ZYUA 5DTMA 1HPLA 4PZ9A 4BUJA 2JA1A 2NYUA 3P0HA 4LY9A 2F6RA 4JEHA 1C14A 1R8QA 1VCMA 1Z0JA 3HCOA 5SYAA 2VK8A 4B47A 4MZXA 1OREA 3NR2A 4ZCQA 5KOHB 1TRHA 3L4BA 3ND9A 2LCFA 2Z5GA 3MSXA 3OT1A 1QYXA 2D1QA 5AI8A 3SQLA 1KEZA 2ANCA 1FPMA 4EUEA 2ZJ8A 2Z4SA 2GPBA 4WFKA 4FCTA 1U7DA 3MAGA 5HW0A 1HGXA 3GJ4A 3WYAA 4MGHA 3FNFA 3MCAA 4RDCA 2VHTA 5B1IA 2COEA 1DZ3A 3H4MA 3UO8B 4AZVA 2BUCA 2C7OA 1XPUA 3DV0A 3OQHA 5MFZA 5C4IA 2AFHA 2DUJA 2IUSA 2V74B 3AJ9A 4W6QA 2EVWX 5I8PA 1RXWA 4JI4B 1XCLA 2QTBA 4MWZA 3GRUA 5KC9A 1M2WA 3N7TA 1KE1A 4R3UC 1MDBA 1GCGA 1RC1A 1A82A 4NK5A 3K8ZA 4QA9A 4F5WA 2W9XA 1DIAA 4C6RA 1RZVA 4KI7A 3QGMA 4PCUA 3MC1A 1WV1A 2P4UA 2NUPB 3BXFA 3T5MA 1QC5B 1WHSB 3MILA 4IWXA 2R7MA 2GYUA 2VPZA 4XWGA 4LZOA 3EDQA 4BFUA 3ZJTA 1C9JA 1U4SA 1BKDR 1Z47A 2MYTA 3WLLA 2QLNA 3W1WA 2XEDA 4DG8A 3O4VA 1WLSA 2YYAA 5KWSA 2CE2X 2JIZD 1C3LA 5C34B 4FI3F 1DAOA 4RTQA 1N7HA 4HQ0A 3SQXA 3EGIA 3Q7EA 4DY6A 3TG2A 2EFHB 4ETWA 1QX3A 1R4MB 3X1DA 1DX4A 2FI1A 4LJ8A 2ZIXA 1G5IA 2YXLA 4B6FA 4LRXA 3TBFA 1P29A 4DANA 3RYIA 4GOMD 1O0BA 4D41A 5C2JB 4IXNA 2PS9A 4YP9A 1GR1A 3A1VA 1UBGA 1AE1A 3NVAA 1QV9A 4WOKA 1VCNA 1PDWA 5IEJA 1GYRA 3M1IA 1Z88A 5TJ9A 4OHMA 4C4SA 2Q1TA 1E18A 1QYDA 1VJTA 3LUGA 3LX5A 1GCIA 1CUEA 3OFVA 1L1QA 4XYMA 3I04A 4NDAA 4CIAA 1PFUA 5KX5F 3H7AA 5A05A 2CEKA 2X7HA 3FRIA 5CEJA 3USES 1RP7A 1CUYA 1G1MA 4BNYA 2XDQB 3Q7SA 2Z6VA 1ISJA 4NX2A 3ORRA 4I3HA 2HD4A 4H35A 3CW9A 2VQ3A 2KS6A 4NOJA 3U4HA 3MJSA 2Q6VA 2B7BA 4AG5A 5JZMA 3AERB 4ZO7A 1ZJ5A 2WHRA 1FSZA 2ZXUA 1E4OA 3IUMA 5CFZA 1P1RA 3OJOA 3GMIA 2PA3A 3R23A 2Z5LA 3BF7A 1RI1A 1ZM4A 3JYPA 3R44A 2PG3A 5AW5A 4H0NA 4BMDA 1MGOA 4C76A 1K8RA 2PKRA 4HWRA 3R9WA 2AH5A 3NBYC 3QWFA 3KUUA 1E6KA 1JJAA 3OQIA 1D1SA 1ZH0A 1PR5A 1UMDB 1XRNA 4PG8A 3OWXA 1IJFA 4MPTA 3WNQA 1NIJA 4LFAB 1NW7A 3L7DA 4GYJA 1M34E 4ABTA 3KVVA 2I9PA 1G4HA 4MYCA 2V0GA 1W36C 1NTOA 3YASA 3L8GA 4HNAB 4E11A 2Z3WA 1F5SA 4H4CA 5EGNA 1CY6A 3WLSA 2P9JA 2VXBA 4EPTA 3AU8A 4TQ9A 4RPIA 2X9QA 3PDIA 1Q6ZA 4FX5A 2PPVA 3NP9A 5JEEA 3CO0S 5FA8A 4AMYA 4J49A 2UU9B 2QG6A 3P0EA 2BZ0A 2VP0A 4OB6A 4ZTUB 1D6MA 3GLHB 3ZQ6A 1RAFA 5I9NA 3FHOA 3BJEA 4BRWA 4GAEA 1GJRA 3Q7TA 3F6EX 2XNJA 1C4OA 4WADA 3V97A 2AZXA 3FSJX 3TM5A 3ZNNA 1QBKC 1QTRA 2AJLI 1XMVA 2C58A 3FCAA 3WIDA 1KPHA 2KQUA 3BD8A 5DISB 5JTUA 1TVMA 1ZL0A 3EIHA 3FE2A 4ME6A 4RK6A 1TADA 3FWZA 4L8YA 4J03A 5LQJA 2DBYA 4CEIA 2XT0A 3HM9A 1DCTA 2H4JA 1E7QA 4M87A 5ENZA 3L4JA 1Y7HA 2XHEA 4FT4A 1M8FA 1ABFA 3H84A 3KQMA 2C29D 1W4RA 2V4ZA 3GZTB 1Z4IA 2J33A 3NOVA 4JX9A 4WN9B 5F12A 4D4HA 1R9MA 1WWKA 5GGYA 5SV2A 5ER9A 3QPUA 3ON5A 3SIWA 4D5GA 2VRNA 3HACA 3F5QA 4OAOA 3M6LA 1ZI9A 3WAKA 4IH1A 2WAMA 1KA9H 4HGPA 4DIEA 3OJCA 1LTKA 2WJIA 4CDGA 5EHQA 5AIAA 1ZH4A 2J9FB 3I6MA 3TZEA 5JISA 4B7XA 3CBQA 4QM6A 1XLWA 2VQFB 1PN3A 4OB8A 3WLEA 3NORA 3WMGA 1K9SA 4TVKA 4P4UA 5EE1A 2XUFA 3O2NA 1JQAA 4KXWA 1QKIA 1VI2A 2VYNA 5KSZA 4JLSA 1BA3A 3NHLA 3LSTA 4DLXA 5ITSA 4QHSA 2R66A 3BGIA 1P7CA 3AHHA 3HPQA 1MOQA 3QKRA 3UAZA 3AEZA 1V26A 1W85B 3CZ5A 2VDPB 3JASA 3LC0A 5F7ZA 3OT5A 3ZG6A 2ZQ5A 3IAAA 3K30A 4Z4QA 1C1XB 3ZHCA 1SC1A 1VPLA 2ZAOA 3RFTA 2I7TA 2DHRA 5IFLA 3DOUA 1CY0A 5KMGB 1PTJA 3ESQA 1UODA 4X0EA 5IDQA 1H66A 2MIIA 3CPSA 2VPWA 1GPYA 3PIIA 1PFVA 4WZ6A 3OX1A 1AURA 2XMRA 1J8DA 2OYCA 4G1FA 4V1CI 1UEJA 5A3VA 2ZRPA 2NV6A 3IXMA 4B44A 3RTEA 2AJ8A 1ORHA 2W6NA 4RVHA 2FZLA 5IN5A 5FTMA 5TVKA 3V55A 4BWFB 5FPKA 1XHLA 5FPYA 4EPWA 1PP4A 1SR8A 2BFNA 4PINA 4CQLB 1JMVA 2GBLA 4GQIA 1G6Q1 4EB0A 5TX7A 1GPDG 2YZ2A 2QJRA 1JQJC 3JTEA 1V25A 4WA8A 5F1OA 5GONF 4ZEWA 3TJRA 3UKDA 2I65A 5K45A 5HNKA 3CZMA 1XWFA 3NEYA 3CZ9A 5AK4A 3T7SA 1U2DA 4Q3AA 5KTKA 4Y9SA 3EPHA 5ITWA 2CN1A 2GR9A 2WZDA 2FPLA 1RHMA 1EXDA 2Z98A 2RSLA 3PGLA 1AQUA 4XM2A 4X5OA 4OL0A 4ZKEA 1OXMA 4IUBS 4A91A 4DA4A 2ZCUA 5JCOA 1CR6A 2P3OA 5AVTA 2Y6UA 3AY3A 1USKA 4W5HA 2UYCA 4MA4A 4JYZA 3U3RA 2JHAA 2O2IA 4RYLA 1EHYA 1QR2A 1Q1NA 1MGPA 2A4MA 1UBMS 3IA2A 1E62A 3CRVA 4MR8A 1VGRA 3GLSA 3L7CA 3AFNA 2AG1A 2WYVA 2CXPA 3GIWA 1HE1C 1KR5A 2W98A 3D3EA 4UHBA 4ZOBA 4A1OA 1G5QA 3R1IA 5AJHA 1Q14A 4DZRA 9GPBA 1V6AA 4JVMA 3C5EA 4ZHQF 2D06A 3JD4A 2FMIA 1J7KA 4LE2A 3AM1A 1ZWLA 4NU6A 1VIAA 3IVXA 5DN6D 3DSRA 2ACWA 2J45A 5EJEA 3WLAA 5FR1A 2HC9A 4HMOA 4BVEA 4X8OA 1OZHA 4QFDA 3RQSA 2VC2B 1NJ1A 1ZOIA 1KYTA 2WABA 4ZMSA 1Y3AA 2B98A 5ALUA 4BQIA 4I4TF 5B36A 3RB8A 2W6QA 5LYJF 3KB2A 3QY9A 4CIYA 3E9ZA 1BA2A 1FVHA 1ONPA 3KYJB 4QFBA 4Q1DA 3S7TA 1KYVA 3TZKA 1MQSA 4TX1A 3H8JA 1RTTA 3ONVA 2ZI3A 2Q4OA 3NHSA 2AZ4A 3OIYA 2R00C 1JIXA 3E9NA 1L4MA 1WCWA 3A10A 3SVLA 5CGQB 2GSWA 5CM8B 2IYNA 4NDZA 1AK9A 1F9EA 4BLPA 4WK0B 1KQFA 1UK9A 4MEJA 1CW2B 3FPSA 4CU5A 2WYHA 3LL4A 3FMOB 3Q0EA 3QPCA 1HYBA 2PMBA 3A27A 5H9WA 5I01A 1XJ5A 4RZQA 2FPWA 2O3QA 5C8ZA 4BMYA 1XD8A 3HUUA 2I7DA 2IEAA 3LC7O 5BYBA 1BCRA 4CN8A 2QUAA 1RNLA 4ALNA 2I2CA 4E0BA 2N42A 2OV2A 3I30X 4NBVA 3R09A 5C3UA 4C07A 4TMKA 5A02A 3JV7A 4Z3DA 3TLXA 4U39A 3SZRA 5GV7A 4GSYA 4W99A 3UUGA 1E0DA 2VTKA 2H2FA 2WU4A 4IOMA 5BYAA 1C7ZA 1QWSA 1SCUA 1E2QA 2H5EA 3O2JA 5AVVA 2OGUA 4M36A 4MCHA 3H19A 1P7WA 2IHJA 3ZWXA 3GJRA 3M83A 3MRTA 3BJZA 5CUQA 2BMFA 2FKNA 3FB1A 5EIBC 5GZ3A 3U6KA 1VG0B 3OP4A 3ZQJA 3VNRA 1ZXBA 1UFKA 1K8YB 1NURA 4ZK2A 1J70A 1AMUA 5I7EA 1IPFA 1F0KA 2JLAA 5C0OE 4KL8S 2H7XA 2I99A 2VRWA 1GA1A 3EFOA 4M9UA 1ZBDA 4C3ZA 5IWAB 1QM5A 3PUVA 1IZ9A 3MT0A 4K2HA 5K6RA 3DLCA 1T9BA 1T6NA 2RKOA 1R4ZA 3RJ9A 1PZFA 3UC9A 4ALMA 5REQB 3M70A 3O8OB 1PGOA 3KPUA 4ESEA 3AIIA 3H2KA 4WA7A 4H15A 2FYTA 3ASYA 2R62A 3N2NA 1I0ZA 4DLNA 4BMCA 1NW6A 2PXCA 2VHXA 3OTWA 1LCIA 3EGEA 1EKXA 4J7UA 1JZSA 2IU0A 3UJCA 4QG7A 4B2PA 1E7YA 2D5AA 5DCUA 5K0TA 1FMFA 3CX8A 4Y1RB 3WX0A 2VJOA 2P35A 1RYEA 3PDCA 1VP9A 1ZA1A 4U7GA 3T3IA 4BNGA 4DM7A 4URVR 1I0IA 2H08A 1GQOA 3GJ3A 4AYWA 4JGIA 3A3NA 4EPVA 1MRZA 3KOYA 4GMGA 2HSGA 3PDWA 5KTYA 3HO8A 1NPDA 4WAUA 2N46A 3RBXA 1KXJA 5A62A 2IF2A 2EP5A 1ULSA 3ZX4A 1VJDA