3IGFA

Crystal structure of the all4481 protein from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr300
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
333
Chain Sequence
ALILTFLGKSGVARTKIAIAAAKLLASQGKRVLLAGLAEPVLPLLLEQTLTPDPQQIAPNLEVVQFQSSVLLERNWEEVKKLEAQYLRTPIIKEVYGQELVVLPGMDSALALNAIREYDASGKYDTIVYDGTGDAFTLRMLGLPESLSWYVRRFRQLFTNQVNNFLDKGKEALADPKRVAAFLVTTADPLEVVSVRYLWGSAQQIGLTIGGVIQVSSQTEGDLSAEFTPLSVTVVPDVTKGDWQPLIDALPNFVEQAEQAPKPITIDTHNRQVRLFLPGFDKKQVKLTQYGPEVTVEAGDQRRNIFLPPALSGRPITGAKFQNNYLIISFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords All4481 protein
publication title Northeast Structural Genomics Consortium Target NsR300
rcsb
source organism Nostoc sp.
molecule tags Atp binding protein
total genus 101
structure length 333
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3igfA01
1ETUA 1KI6A 1Z6GA 4HAZA 4IW3B 2ZE6A 4O2LA 4DUGD 4IRUB 3DKVA 521PA 2IUSA 5DS2A 1E32A 3BFXA 1OE0A 4NYIR 3PJRA 4OQFA 3G5UA 5UKDA 1S0UA 2VSXA 1P7CA 3OF5A 3OIVA 4A0RA 4JBXA 3U7HB 4K46A 2AL7A 5SZKB 5EUMA 2FSGA 3LLMA 4US1R 1EWQA 4HAXA 3L8ZA 4H1VA 3CONA 5LB4A 5EZ5A 3WRYC 3DMNA 2WVJA 4C0LA 1TU4A 1O3YA 3SI7A 4M9ZA 2JCSA 4B43A 1IN8A 4HUTA 2HJGA 3RHFA 2Q9BA 1GZSA 2V4ZA 4FCVA 1AK2A 4BZXA 4GT1A 1ZCAA 3ZQJA 4HDCA 1KO7A 4QXAA 5EE5B 1P73A 2V7QA 1D9ZA 4TMKA 4V0NA 4C7OA 3QI2A 1TF7A 2CCGA 1ZUNB 4BUJA 2P3SA 4NCNA 1RYHA 2D7CA 1SGWA 4TSFA 3RRZA 4NPHA 4Q66C 3OESA 2NO9A 1W5TA 2BEJA 3FHOA 1N5JA 4V0ME 1KO1A 1R0YA 3TW4A 2YJTD 1XXHA 4MDFA 3F5FA 3IQWA 2ZYUX 4DLWA 1TPZA 3EA5A 2EYQA 3K9GA 5HKKD 4EUNA 4P31A 1CEEA 4PAQA 4JJZA 4KYUA 2VHUA 2FFHA 3CX7A 3SBDA 5EXTA 3LDAA 4Q1BA 3THWA 3WNDA 2FPMA 3PEYA 4JLBA 4YMSA 3HDTA 1X86B 2PX3A 3C16C 1ZNYA 2XGJA 4F7WA 5AUNB 1U0LA 2VF8A 1X5MA 1UF9A 1IY0A 1G7SA 3MCAA 1ZD9A 3RRNA 3PENA 2VSFA 4HB2A 1MO6A 4HZIA 4OK3A 1JXMA 1PUIA 3EC2A 2RGXA 2YKGA 4QM7A 3GCGA 5G3ZA 1RJ9A 3L8YA 1KI1A 5FFMA 5CITA 4MYTA 1XFAA 3C5HA 1P9WA 1D6JA 4M9SA 4M53A 4KFTA 5JWRA 1E2QA 1X3SA 4WXRA 1T4GA 1W36B 4EPWA 5EJEA 1ANKA 2PH1A 3BERA 5G53C 3X2SA 2G3YA 1XBTA 1NNEA 1ZP6A 1PJRA 5F9FA 2QM7A 3QUSA 1OF1A 4NL4H 4WZAE 1XTKA 2QP3A 3AUXA 1KI8A 3VQLA 2MSCB 3AVOA 1NVVQ 5IDVA 2FDCA 4IDOA 4CW7A 1IJFA 4Q00A 5KSZA 4PQRA 3SJBA 1E2HA 3OEED 5BYKA 1T3SA 4CT5A 1NMZA 3TVDA 3SQWA 2R6CA 2QG6A 4Y0AA 1Z08A 4Q1FA 5AJVB 3H84A 5L3RA 3CZPA 1T8UA 1ZUHA 3O8CA 3VU9A 1LFDB 2CL7X 2FGJA 4GMXA 3IBYA 2WBLC 3NC1C 4DUGA 4QFMA 2IS6A 1Z29A 1T0HB 2W6IA 1DO2A 3MWKA 3VR1A 2XJ9A 4B6FA 4A36A 3LW7A 1KHTA 3DEFA 1SVIA 3PFIA 5FI1B 3WHKA 4BGDA 1AQUA 4PAMA 3OFND 1TQDA 4YL9A 2IC5A 2WAYA 3BFVA 2HXSA 3FKSD 2CJWA 2IBMA 2J45A 1G5TA 4U7DA 1NJFA 4DB4A 3ADKA 4D6PA 4TLCA 2GBLC 3R9IA 4CIDA 3L2OB 4YMUA 3K70D 4YMWA 1IOZA 2BHRA 2QENA 2GZAA 4LJ4A 1KDRA 3AF3A 4Q1CA 4JUTA 1XRJA 3HU1A 4JL6A 3BFKA 3CH4B 4LBVA 1HT2E 4JT2A 2XTZA 1IN7A 1KI7A 2PJZA 4D81A 5HR5A 1XTIA 3L0SA 4LJ5A 1UDWA 2W0MA 1NVUQ 5LBIA 1OV4A 3DM9B 2I4IA 3RSLA 3K0SA 4DT1B 2BKEA 1KSFX 2WWGA 1YZUA 2QTFA 3V4RA 1GWNA 3KJIA 1BYUA 3SOPA 4PHGA 1HE1C 2CHGA 2YV5A 4YLBA 2F3TA 4LCBA 1W0KD 3IUYA 1CJKC 4KJZA 2ZRJA 2O8FB 3ZJYA 1GAJA 1OFUX 4DJTA 1G7RA 3THOA 4BFVA 1ZUIA 2IHBA 3QF4B 1G19A 2C99A 3PITA 4FINA 4C0SA 3LX5A 2B7CA 3GJ4A 2QAGC 1LW7A 5IK2A 1CKEA 1N3BA 1R5OA 5BW8A 5JI3E 4JBYA 4WA7A 3U61B 3B1YA 2HCBA 3IPXA 4JT4A 4NU0A 3GJ0A 4ESVA 2Z5FA 2QP4A 2WKPA 1RVDA 1KO5A 1G5RA 5J4VA 1NJGA 5FOXA 2VA8A 1E9EA 1MABB 2DWPA 4TLBA 1LY1A 1ZC3A 1OSNA 2DFLA 2FV8A 2YVUA 3NKVA 4M2LA 1E2GA 4AG6A 1W0JA 2C78A 4Q9IA 2GXAA 1TX4B 2RGGA 1PVOA 1IHUA 3EZFA 2IYYA 2ODNA 3P4XA 3A37A 1OJLA 1ZCBA 3OIUA 3Q7QA 3B9PA 1E94E 3UK6A 3Q5DA 2AWNA 2ZE5A 3LX8A 4OHWA 2WJVA 4YXWA 3U7EB 3LBIA 2UZ3A 3EASA 1Z0JA 3FVQA 4DLSA 3OE7A 4RFSB 3KUDA 3UATA 1WH0A 4ACAA 5M04A 2PX0A 5H1YA 2XOKA 3UMFA 2XOKD 2WWFA 1XEXB 5FPTA 4DLYA 1TF5A 1AS3A 4GSYA 2BMEA 1GRNA 2W2XA 1M7GA 2DR3A 4A2WA 2BBSA 2IXFA 3CPEA 1R8QA 2N1BA 4GP6A 5FTLA 1X6VA 2UZIR 4HDOB 1NVWQ 2CLDX 1M7HA 4YMVA 3PUWA 2UKDA 1UFQA 1S9DA 5BN5A 3N70A 5EQTA 4IOLA 3EWAA 4LOAA 4PR0A 4IHQA 2ZRCA 2AXNA 5EE9A 1II8B 4ARZA 2CNWA 1VHLA 4LWZA 1DPFA 2G83A 2FSIA 4G5QA 4OQMA 1XP8A 3PR1A 4ITRC 4P4SB 1JAHA 1YZNA 3P4YA 1G7CA 2IT1A 2Q3HA 3CW2A 5EE3A 4I1UA 5FOVA 2QAGA 1KI4A 1F2UA 2VYFA 5FL7A 3VHXA 4HUQA 5CIQA 5FL7D 3AGQA 2PBRA 4BZQA 1OB2A 5GVRA 4C0HA 4ACBA 5JCZA 2GXQA 2W0SA 3IILA 1E9SA 2O5VA 3VKWA 2OSBA 1HT1E 1G3UA 3ASZA 2I1QA 5CDFE 3WMFA 1G5PA 1R0XA 1K8RA 1U98A 1P2UA 1SKQA 2BJVA 3R8FA 1R6BX 4MRRA 4UNNA 4US0R 1GM5A 1EJFA 3AF0A 3LWNA 4B74A 4H1UA 2KLRA 1UM8A 3GLHB 4JVNA 4W5JA 2O8EB 3A1SA 1JR3A 2WOJA 3MWJA 4I99A 3VR6A 1G8FA 2HT6A 4POAA 1JJ7A 2DFNA 1ZNZA 3KKMA 1E2LA 4UXIA 2QY9A 2C98A 1E2JA 1CR2A 2AFHE 2ZJ2A 3ND9A 4K81B 1P6XA 4WVFA 4A0FA 4YMTA 1G8HA 3HU2A 3EAQA 2OCPA 2O8EA 2KI5A 3NXSA 1Q22A 4B35A 1Q3HA 4EJSA 4Q4HB 4Q47A 5JJIA 1DAHA 1R4AA 4RZXA 4GI7A 2ATVA 1EX6A 4AKIA 2K8QA 2JLZA 1JR6A 4Q1EA 3VR4A 4M9XA 1BS1A 4MGIR 4PQFA 2ZI6A 3DOEA 1HEIA 3SC3A 2JLYA 1NLZA 5G3YA 2BMJA 2CK3A 2CVFA 4MUBA 3GT6A 1G291 4TMWA 4F38A 2J1LA 2HDNB 4B71A 4UNSA 1VMAA 4R2IA 2OBNA 4MDEA 1P9RA 4P4SA 3K9HA 5AR1A 1GVNB 4PC2A 1S2MA 4QGAA 1ZC4A 1IXRC 1FUUA 2ZRDA 1GL6A 2J0UA 4GOKA 2ERYA 4LYHA 3DMDA 4M1MA 2ZE8A 2ZIAA 2BMFA 2ZRNA 2OILA 5KDLA 1SHSA 3FHCB 1KK2A 1AKEA 2P6NA 5FBVB 1P75A 1WF3A 4PO1A 4KHZA 5KYKA 4DLXA 3ONWA 5KOYA 1M2OB 1M7BA 1FX0A 1RRPA 2IXEA 4LGMA 1VECA 5HZKA 2FZ4A 1RE0A 2GESA 3TE6A 1M6NA 1JR3D 2IWHA 4E5UA 2BBOA 3FWYA 3NBFA 1E1RA 4ZIRB 1W46A 4N1AA 4J0QA 1N0WA 5JSZB 2OM2A 4ZI3A 3AVUA 3T34A 3LRPA 4DZZA 2H57A 3Q9LA 2H8KA 4OI4A 1FOEB 4HAUA 1Z83A 2X2FA 3AV0B 3Q3JB 4HDQB 1N2CE 4Z1MD 3LVQE 4XSHA 5GADl 2MSEB 1TNDA 2AX4A 5C4MA 2EFGA 2JLQA 1XCMA 5TMPA 4UQOA 1GOTA 4BLSA 3ZD6A 2WPDD 5HCIA 4CRWB 4QBHA 5K8IA 1UBEA 1XTRA 5F2EA 1UKZA 2BBTA 1ZMXA 1COWA 4OQLA 2IYQA 2CEAA 3C4JA 4LPSA 4FI3C 2X2EA 3B13B 3ZYCA 3BRWD 1GNRA 2WWHA 4BQSA 1DOAA 4B33A 3LBNA 3C8UA 1G6OA 4B3XA 4KODA 4PPFA 1XTSA 4KV9A 3CR8A 4YXWD 3PUXA 1VG9B 2FMXA 2R6DA 2JLUA 4V0LA 3A1WA 3BWDD 3N5CA 2E1RA 4HYYA 2YWFA 3DZ8A 1Z0IA 4WIAA 1F60A 4A8JA 5CIWA 2J7KA 4M1KA 4RD4A 1E98A 4OL0A 3VHLB 1KI2A 5D3MB 5J4LA 4MA4A 3K0FA 5JZVA 1HURA 5TXGA 5DIFA 2QAJA 3U7GA 4QJ4A 1AM4D 1NBME 4HAWA 5KU1A 2O0KA 1TL7C 2ZSDA 3AM1A 4MGZR 1P61B 2GAAA 3KXLA 4DLZA 3CF6R 3SJAA 2GJ8A 2LCFA 4II7A 4YC7A 1R2QA 2A5JA 2CHQA 2KE5A 4TYNA 3FOZA 4NYMR 3KJEA 1Z0KA 4C0JA 5FOTA 2ZSAA 1Z06A 1E1RD 4JVSB 1RIFA 4PTLA 2XITA 4YDSA 1X8KA 2ZRKA 1AJEA 4ZI2A 1E0JA 1T3LA 2J87A 3ZGXA 3I8XA 1CIPA 2GHIA 1EK0A 1RRFA 1JR3E 1G3MA 1LS1A 1U8ZA 2MNWA 1P4SA 3I1FA 3QKSA 4RCYA 2YC2C 3PEWA 4MKHA 3W5JA 1KIMA 4PO8A 2RHDA 3HYTA 4DDUA 1PUJA 4MGYR 4BFYA 4AY2A 1CTQA 4M4SA 2CJWB 1E79A 4IDHA 1BYIA 2FH5B 5C46F 4URXR 1F3OA 1W44A 1NI3A 4S35A 2GDJA 4G5RA 2IYVA 1KZ7B 3TBKA 4OK5A 1SXJB 3SE0A 2BIFA 1CBUA 2J59A 2ZI9A 2JLVA 2B92A 1JEEA 4IDNA 2O52A 3CH5A 4B44A 3HPRA 4GOJA 3GLIE 4DCUA 4M0LA 4JLPA 3EPHA 2IL1A 4BLRA 1U99A 2I1VB 1VCOA 2W6JD 5CM9C 1Y63A 4IKEA 1Q1ZA 2AKYA 3MWYW 4KXFB 3QORB 1E2DA 1Q44A 1YZTA 3K70C 2D06A 4PZZA 2YWGA 5D3QA 1KMHA 4O2RA 2HYDA 4G01B 1WQ1R 3TNFA 2J7PA 4NYMQ 4DKXA 4ZDKA 1OH7A 3TH5A 2ZYVX 2KJQA 2Q9CA 1E2NA 4ILEA 2F55A 3WY9A 4TL9A 3TLXA 2BBWA 3MWLA 3QENA 4LHVA 1JB1A 3SQXA 2R9VA 2D4HA 2ANCA 2C95A 4IXMA 4OHVA 4DDVA 3TUZC 3P26A 3WRXC 2JLRA 5FPYA 4LJ6A 3IHWA 4NTZA 5FBRB 1FP6A 4TZ6A 2AK2A 1E69A 5F9HA 1Q21A 4DSNA 1Q12A 2H16A 2Q0HA 5DN6D 1Q20A 2G88A 2FN4A 2O8CA 1AGRA 4UKDA 1OYYA 1XU4A 2DWOA 3G0HA 3QXCA 2C77A 1KZGB 3SEAA 1AS2A 4LHZA 3AF4A 1JALA 1ZNXA 5AUPB 2V1XA 1W5SA 2H1LA 4X8LA 4LPKA 4OQXA 3NHAA 4B75A 1BO6A 4Q9KA 2CNWD 5KUTA 3LH5A 4W7SA 3ZDQA 2WWYA 2WJHA 5FL3A 2ZSFA 3QBVA 4FN5A 2JKIS 3IQXA 3TAHA 1AA9A 4PCKA 1XMIA 3KQNA 2RGBA 4MYHA 1W4RA 4B3DA 1A2KC 1KAOA 1D2EA 2VP6A 4KYIB 3ZVMA 1E0AA 3DZDA 4KI0A 4DLUA 1G7TA 2GZHA 4TLEA 4A1FA 3ETLA 4D80A 5FTJA 3SYKA 3I62A 1S3GA 4C4PA 2ZE7A 1Z0DA 3F0TA 5C18A 2BKUA 1G8GA 4DEYA 1G21E 2JA1A 2NOAA 3AKYA 3GPLA 2ZJYA 2GCNA 3QEOA 1TF2A 2HEIA 2NO1A 2V6IA 3DOFA 4P4TA 1N5KA 4Q1AA 1UKEA 3OE7D 2HLDA 2PLRA 1H8HA 2GWHA 4EIWA 2OBLA 5DYIA 2NPIA 1COWD 2FPLA 3KQLA 3K8YA 3B9QA 4JYCA 3ZH9B 1FTSA 1CR0A 3K0CC 3AGPA 3IO5A 4MKFA 4URVR 5GJVC 5HTKA 4RD2A 3O8RA 4CEHA 5J5CA 3AACA 1NL3A 1J8MF 1KJYA 2RH5A 3C5CA 4NE2A 3NBYC 4ZDWA 4HAVA 1YR6A 3UKDA 3AH8A 5DSZA 3VR5A 4G1UC 5HE9A 3IO3A 2RHMA 2PCLA 1J7KA 3R9WA 3AF1A 1GKUB 2C2HA 1W1WA 1NLYA 1NRJB 4JZKA 4RSGA 2ORWA 2ZRBA 2O8DA 3PEVA 4CEJB 2JASA 3AKEA 2O0JA 4V0OA 1EFRD 3NEJA 4A8JB 2V9PA 4PC7A 1M74A 4W5WA 5A0FA 2XSZD 2ZU6A 5EP2A 1AS0A 3HYRA 1RW4A 5E7JA 1KK3A 1G3IA 1MOZA 1NG9A 3NDBB 3ZZUA 2G9NA 4LHYA 4ZCMA 1WBBA 1XDBA 3GD7A 1CF4A 4C30A 4D0GA 4LBZA 2PEZA 2QZ4A 2R6AA 3CKLA 2XB2A 1P3JA 2WIAA 2DY1A 3AUYA 3TSOA 1OXXK 3GEHA 1ZW6A 2HCJB 3C14C 2OXCA 2PMDA 3AP1A 3FB4A 2CG9X 2GEDA 1CULC 3H1TA 1J99A 2GKSA 5DN6A 2GK6A 2CLCX 4PO9A 3TSWA 1PLKA 1KMQA 2ZUDA 4N0DA 1MV5A 2VRWA 3MAAC 2WPDA 5JWHA 3A4NA 1KMHB 1XWIA 4MRPA 4IEIA 4TYQA 1E9BA 3ICQB 1IXZA 2R44A 3FMOB 3QE0A 1OB5A 3JVUA 1V5WA 3QORA 4XIGS 4F93B 2JDIA 1G1MA 1B0UA 3SN6A 1SVWA 2X1VA 5JMTA 3L0OA 3V9PA 2N3JA 2RGDA 1XEWY 1D8TA 2VL7A 4Q02A 4R9UC 2REBA 5KSPA 4WW0A 5BN3A 1UADA 2W58A 4Q4LA 4HLDA 3A8TA 3O8BA 2P65A 1L8QA 3T15A 3UXMA 4NZYA 2GA8A 4KFUA 2MMGA 5CDFA 1CJUC 2PLFA 4OI2A 1W47A 3L0IB 3GLAA 3IIJA 5BQ5A 4ZJ9A 2QUZA 2ATXA 4AYTA 1GNQA 2K5UA 2VHJA 1YQTA 3RS0A 1DAFA 3ZLJA 1XJQA 3B8HA 4D0NA 2WM9B 1KDPA 3CPHA 1N6IA 3WNBA 1DBSA 2R2AA 1GITA 5TB5A 3U4QB 4B6EA 2PJRA 3QKSB 1VKJA 5JS7A 1HYQA 4HZUA 5JEDA 1P2TA 2XNDA 1RZ3A 1R10A 1W7AA 3NBXX 1N0UA 2JLXA 1HQCA 5JLJA 1W36C 2Z83A 4Q4JA 1ZM7A 2DBYA 4PANA 4OI1A 1UAAA 1N6LA 2O8FA 2XTNA 2A9KA 3B6EA 3PXGA 2W83A 2QMEA 5TARA 2ZRGA 3HJNA 4LUCA 2YOHA 5BXQC 1RFLA 4E07A 1Z22A 4QJ5A 4EPRA 2ONJA 1E2FA 1OIVA 1I4DD 1NP6A 1S1MA 1CR4A 4LYFA 2HF8A 2VP0A 3EPJA 4AURA 4G0NA 1G4AE 2NPFA 2CXXA 5TV2A 2PCJA 4DDWA 4Q7LA 1GUAA 5K8UA 4OYHA 4HZUB 4M5TA 4JLVA 1JECA 1FMLA 5BN4A 1C9KA 2GXSA 4F4IA 2RCNA 1OFTA 4HLCA 2LWIA 3WNCA 1YR9A 2N46A 2XZPA 2J0QA 3IGFA 3PG5A 5DYGA 4LV5B 3DM5A 5TVKA 8OHMA 3B2EA 3ASYA 4CDGA 1YZLA 2CDNA 2Z43A 3G82C 3O47A 1XNJA 4MGKR 4C2TA 3SBEA 4F4JA 3AVYA 1R5NA 4B2IA 4BFWA 2ZJ8A 3EXAA 2E87A 4TT3D 2R8RA 2A5GA 5GJCA 4TT3A 4X8HA 1IY1A 4M1WA 5LB2A 3RRYA 2QAGB 3LXRA 1VDZA 3TRFA 4IOKA 4Q4AA 4AWXA 4B47A 1N5LA 1T9HA 2HF9A 2EFDB 2FGKA 2PL3A 1ZU4A 2V54A 5EE0A 3RWMB 1VG8A 2YINC 4L15A 3KZ1E 5JSZA 3VMFA 3RSOA 4ARZB 3SR0A 421PA 2CE7A 1X1RA 4BEBA 1KK1A 4BPBA 4CEIB 4XVRA 1Q0UA 4B3CA 5FUYA 1WE2A 4TN1A 4JKYA 1XEWX 3W1ZA 3OZXA 2Q9AA 3RS3A 3W5IA 2BMDA 3RLFA 5A4JA 1IAQA 2VIIA 4BLOA 1QHGA 4XWOA 2DFKB 3I5XA 1SVOA 1VYTA 3BIFA 1GRQA 3TAUA 4MJHA 1GKYA 1UDXA 4WZBE 2H92A 2FFQA 121PA 3QNUA 3ZVRA 4D25A 2DYKA 4WOPA 1WRBA 1FUKA 1Z63A 1QG2A 1CRPA 1EFHA 1TQ2A 5FPSA 1NY5A 3KQHA 3VQTA 3BS4A 1MKYA 4RFSA 5L3QB 1TEXA 4Q4AB 4TWZA 4AIIA 2G77B 1IONA 5DLQC 2BV3A 3LD9A 3WP1B 3QEJA 1ZM2A 3X1XA 1WB9A 2EFHB 5TDHA 4URYR 3FYHA 4XJXA 4BRUA 1SQ5A 4JS0A 1IM2A 2IXGA 5H8WA 3CRVA 1KOFA 4I1OA 4DLVA 1TTTA 1I2MA 2QPAA 1SVMA 3IBGA 3O8DA 1L2TA 4JLDA 3NG1A 1P9NA 1YHNA 1QDEA 3WXMA 3TQFA 2Z0MA 3U3JA 2QPOA 4AK9A 2A7QA 2KMWA 2NG1A 2VP2A 2P6RA 2J5XA 1ESNA 1GSIA 4EJSC 5DH9A 1OIXA 2BM1A 3QPWA 4EJSB 3T1VA 3LW8A 3L1EA 2ZR0A 3FGNA 2RB4A 2FA9A 1WCV1 2PZEA 4LHXA 4URWR 3P27A 3QIAA 2VLIA 4L16A 4A82A 2J46A 1P2VA 5P21A 4I4LA 4ZV4A 3VQMA 4OHXA 2FJUA 3CNOA 2IWRA 4CEHB 4A6XA 4PPQA 1VIAA 1XD8A 5SZJA 1R7RA 4QNMA 3E1SA 2XZOA 1P5ZB 1GNPA 1NF3A 1S96A 3HPQA 5HPYB 3EUDA 2OFWA 621PA 4PAOA 3U2QA 4AC9A 2V6JA 4ON9A 1A7JA 1VYVA 2Q21A 3EX7C 1ZAKA 5FTMA 2UVQA 4M1TA 1E0KA 2NZ8A 2G0NA 1EX7A 1G16A 4A8JC 1SVLA 5JRJA 4A0GA 4RD1A 2HXYA 3VNVA 1ODFA 1SXJC 3LVRE 4FCTA 1GMEA 1U0HC 2OAQ1 2N0KA 1DAIA 1W36D 5AUQA 2CHVA 1OXTA 4OQNA 3WBJA 4L8GA 4TTRA 3UWKA 4JLKA 1CJTC 4IXNA 1HH4A 3EIQA 4TTPA 1NN3A 2ZJOA 1E99A 3ND8A 4QL3A 4BFXA 4M21A 3OHMA 2W00A 2JJ1A 2A5DA 1G4UR 3FFAA 4G5GA 1QHHB 2ZYWX 1J90A 4PHHA 5H68A 4QNRA 4BLQA 821PA 3I61A 1E9CA 1YRBA 3AP2A 5LDDC 2YC4C 1R0WA 3K0FB 2D62A 1Z2AA 4MYUA 4BZPA 2NZJA 3RWOA 1Z47A 3BC1A 3EG5A 4DSTA 3N2IA 1X8LA 4KCGA 2A30A 1EG7A 3QY0A 3M1IA 5AWFC 2C03A 5EP3A 1KY3A 4NCJA 3AVVA 4KBFA 1JNYA 2F1RA 1JQJC 2BJWA 1XB2A 5HCNA 3M0EA 221PA 1E9DA 4KLZA 5IHPA 4MKIA 3CO5A 2PEYA 2OUKA 1Z6XA 1A4RA 2GETA 4ZCLA 3J81k 1VPLA 3B82A 1PLLA 2PZFA 2Y22A 1Q3TA 3GEEA 4TLAA 3GJXC 2R62A 4HEJA 3QXJA 4PC6A 2J7PD 1YZGA 4HSEA 2GTPA 4LHWA 4GL2A 1WDTA 1S3SA 4B73A 4G3XA 4XSGA 4LJ8A 1LVGA 2WSMA 2HLDD 1MH1A 4W9MC 3A58B 4B34A 1KJWA 2EWVA 4A92A 4E22A 2W2TA 5JHHB 1KO4A 2I3BA 3BB4A 3N3EA 4TQUS 5FOUA 5JRZA 1NMYA 1R8SA 1T0JB 1NSTA 4M5SA 3SFZA 3U60B 4BFZA 4M9QA 2AWOA 4PC3A 2IEYA 2VSOA 3CF0A 2CCKA 4TTQA 4V03A 3BB3A 1ZD8A 2QI9C 1E9FA 2YWHA 4TQAA 5BYJA 1TAGA 2P67A 4LDJA 3QF4A 1F5NA 2O8DB 2DHRA 3C41J 3A4LA 2IYWA 3CRQA 4G5OA 2J0UB 2G1KA 4PX9A 4DXAA 1QHHA 1UKYA 3CUEF 4RZ2A 3T5DA 2F9MA 1SULA 3TMKA 1NMXA 4X8MA 2JIZA 4TMZA 1L4YA 1OXVA 2ZRAA 4QHYA 1N6NA 2SHKA 5J4KA 3MFYA 4QGHA 1HE8B 3OIWA 2GVDC 2REXB 5JCPA 2VH5R 4PHTA 2FZLA 3ADBA 1DAGA 3ZD7A 2YOFA 3AQ4A 1CJVC 1Z5ZA 2FFBA 2HV8A 3EZ2A 2MSDB 2QRNA 1RL1A 1ZU5A 2WMOB 1U94A 2ZAOA 1G3QA 1D2NA 3RS4A 2RGNC 1CS4C 3TSZA 2OFOA 4B76A 2NMVA 3TW8B 2WJYA 1E2KA 2Z4RA 4X8OA 2ZETA 3RRMA 4LY6A 2IYXA 2JJ1D 4RCZA 1IN5A 2B7BA 2WSSA 4OI0A 5CK4A 2IUUA 2IW3A 2CL6X 2V55B 3BORA 3CM0A 3Q7PA 4WBSA 2ZU0C 4JKIA 4B2LA 2IF0A 3QORD 4GZLA 4YDHB 2ZRFA 4BEJA 3C15C 4LZZA 5D3MA 4DCSA 4NONA 3LA6A 1IN4A 2GEVA 4XWKA 3CPJB 1E4VA 3U5ZB 4A6PA 3U6KA 1CP2A 2BCGY 2JLSA 3GLHA 3IHLA 1GKIA 2VPPA 3L1FA 3TIFA 2WJ7A 4D4LA 2FG5A 3KKQA 5DI9A 1ZM4A 1FQJA 2GF0A 1ZM3A 2Z6VA 3KB2A 4LX0A 2EFEB 3L43A 3B60A 5DHFA 1J8YF 4JLNA 2QE7A 2O8CB 3RVBA 3BH0A 3OEHA 5KPJA 4HAYA 1N0VC 2C96A 2XEXA 4CT4B 4Z8YA 1U81A 3GJ6A 4RFVA 4H9GA 1EFRA 4ZCIA 5L3QA 4C2UA 1OH8A 3HP1A 1WP9A 3PEUA 4GBMA 4P3YA 2ZS8A 2LKDA 4EAQA 3LLUA 5FOSA 4BRWA 5FTNA 1YJ5A 2FU5C 1E1QD 5FTKA 2X77A 3BOSA 1P2SA 4ZIRA 2WWXA 1UKVY 3TVTA 2AHOA 3MUFA 3K9LA 4Q18A 2JAQA 2QPTA 4S2EA 3RC8A 5SZIA 1QHYA 3SYNA 3U3MA 4ZDJA 2RKOA 3KXKA 1OXUA 3PUZA 3W90A 1DTSA 2WKRA 1U9IC 2QL6A 1N5IA 3GJ3A 5C1BA 1F48A 2D2FA 3EIEA 1W4BA 5KO2A 4AKGA 3NH6A 4MQBA 2QMOA 2BDTA 3WMGA 1F6BA 1JQLB 1JBKA 4L5BA 4EPVA 1XD2B 3AEZA 5J4YA 4CEIA 4ELDA 1G20E 4Q7KA 2VF7A 1QHIA 3THWB 3OAAD 1MO3A 1MRSA 3MSXA 1ZM9A 1KDOA 1YZKA 4FCWA 2OESA 3KJGA 4D0LB 4CYMA 3CNNA 3A6PC 2C04A 4TL7A 3F3YA 1Y3AA 3FMFA 2C9YA 5L3SA 5C2JB 4JLJA 4Z1MA 3CB4A 1XMSA 2ZRMA 5CK5A 5FBQB 4Z8XA 4U5XA 1E96A 1IXSB 4O25A 4KITB 1P72A 3FFBA 1DG1G 1XZPA 2EYUA 3OEHD 1E2PA 1TEVA 5EP1A 4DCTA 4TSFD 3KB1A 1R0ZA 4ZPXA 4Q4HA 4HB0A 3ZZTA 3M6AA 4OKSA 4I1SA 1KKMA 3VTKA 2VHQA 1G8PA 3FE2A 4I81A 1XZQA 1RKBA 1DO0A 1SVKA 1DVRA 4DC9A 3DVLA 2WAXA 5KHOC 1NY6A 4MITA 1QBKC 1GG2A 1U2RA 3OEEA 3QBTA 5AJWA 3H4MA 1YVDA 5DI3A 1U8AA 1KNQA 3EC1A 4DEXA 2RH0A 5E95A 3HR8A 3H2YA 1K5DA 2PMKA 4Q7JB 2KBEA 5E4FA 4I88A 1US8A 3FKQA 4NH0A 4IJMA 4A0HA 1A1VA 4EPYA 2JLWA 2GF9A 1CJMA 1P60A 2XAUA 4JVMA 1JJVA 1P62B 3SFVA 4IVQA 4Q4JB 1E3MA 4EFMA 2DFTA 1U9IA 3U3RA 4BFSA 4GPTA 4XD7D 1Z2CA 3FTQA 3K53A 4YLGA 1PV4A 2QTHA 2FE4A 4HUQB 4NCKA 5EUQB 3I4LA 3VR3A 4KO8A 1E9AA 2J41A 4YDZA 4KFRA 2R6GA 2NTYC 2WV9A 3A1TA 1F2UB 1DEKA 4QC2A 2QMUA 2BOVA 2OHFA 4B48A 1Q1EA 3W3AA 2PT7A 2DCUA 3VR2A 2WIBA 3DPUA 1T91A 3EW9A 1I2DA 3V4FA 4QG7A 3QORC 2XX3A 1II8A 3HWSA 2GJAA 3JVVA 2ZUCA 1S9HA 4FEIA 2IYTA 1EFTA 1F2TA 3T61A 1I4TD 1U0JA 2NO7A 3X1ZA 4BECA 2CVHA 2XCMC 2RAPA 1W48A 3QG5A 4QKQA 2FPKA 4HI0E 3W34A 1C4OA 4KSBA 2VO1A 3OAAA 5EE1A 4A15A 2L0XA 4OHYA 3E2IA 1Z07A 1SVSA 1E2EA 2B21A 2WTUA 5IT5A 3OFNA 5CB8A 5ELXA 4AG5A 3GJ5A 4R7ZA 1J70A 3DDCA 1XTQA 3THXB 3REFA 2D3WA 2IYRA 4F92B 3WP0A 2V3CC 4NCHA 3PVSA 3CIOA 4P0TA 2P6UA 3D6TB 2EU8A 3CRRA 3I3SR 4DLTA 721PA 3T1OA 1LF5A 1NG1A 1E6CA 3X1DA 3SS8A 2AK3A 4QBGB 2DB3A 3EZ9A 3KDSE 2OLKA 1GL9B 1SHZA 3A36A 2H18A 3SJZA 3C7KA 3ZS8A 5KDDA 1RPZA 5EZ6B 4RKEA 5JBQA 3K1JA 4EFLA 2HYIC 1OHHD 4I1VA 2BCJQ 4L9WA 1QRAA 3PQCA 4JL8A 4FWIB 1AZTA 4ZKEA 3AABA 5TY0A 4UNQA 4BWYA 1KO8A 5DNYB 3Q72A 3WYAA 1MO5A 1ZD1A 4R98A 1BKDR 3IIMA 1TQ6A 5EXXA 2ZAMA 1KAGA 4XVQA 1RYFA 4O3MA 3A1VA 5IK2D 4FXPA 4JYBA 1X8JA 4PZLA 1OFIA 5FUVA 3CF2A 3D31A 5JS8A 3PV0A 1FFHA 3GUFA 1YKSA 3KFVA 3NIBA 4IDQA 2ZJ5A 1GTVA 4QM6A 1II9A 5F98A 2WICA 2O0HA 4EDHA 2GCPA 1FQKA 4CEJA 4LI0A 1QG4A 3MMPA 4OHZA 2QM8A 3AVPA 1WA5A 1QHXA 3D8BA 3E70C 5HZHA 4URUR 2F1HA 2FEMA 5C4GB 3TKLA 2YNMA 2XXAB 4W5HA 4JLAA 2AFIE 4RY2A 1XJCA 3R7WA 4UJ5A 4DT1A 5FPKA 2PZGA 1OXSC 3LAWA 1D9XA 1SKYB 3EZ6A 4XD7A 1FNNA 2XSZA 2QTVB 4IEEA 2QGZA 2GEUA 3SHFA 3AKCA 1A5TA 3TK1A 4EFNA 3QXSA 5AJZA 5KSOA 3UPUA 1XPRA 3U44B 2B6HA 6Q21A 5J4HA 1H8EA 3K09C 2QU8A 2DPXA 2GRJA 4OBEA 2ZI7A 3GEIA 3AVQA 4FMCB 4PQYA 3THXA 1DELA 2CL0X 2TMKA 2BOLA 3V00A 3RS2A 2OCAA 3NHBA 3QJYA 3UANA 1W4AA 1BH2A 2GXUA 1AQYA 4AI6A 1OKKD 4ASUA 3LQRA 3N2EA 4ZO4A 3B1VA 3Q8XB 5FH9A 2AXPA 4V0MA 5A5GA 3ZS9A 2ZSEA 2YZ2A 2P2LA 1ONBA 2ODWA 4F91B 3AKDA 1H8HD 2KB0A 4E03A 2Y8EA 3KFXA 3ADDA 2CBZA 1TMKA 2XNDD 4HB3A 3FHTA 4TQ9A 1QHNA 3CWZA 3SDZA 1NKSA 2BC9A 1FW6A 2JGNA 3MG9A 5JI2E 1KGDA 2EW1A 2BWJA 2QQ0A 3LNCA 2ANBA 2F9LA 3NH9A 4HLQB 1OHHA 1LB1B 1KYIA 4LV8B 2VTKA 5L8VA 5CJ2A 1Q1BA 2ZRLA 1IJEA 2GBLA 2JJ2D 2V1UA 2W2VA 4NMMA 4KVAA 2F3RA 2IS1A 4FIDA 1YR7A 4FMBB 4IVRA 4QGGA 4BE7B 4US2R 1EESA 1VCMA 4JMPA 1OPXA 4KBGA 2NGRA 2IEZA 3GLIB 2ZQ5A 3KKNA 5GJBA 3T12A 4RD3A 3K70B 1WFIA 1O87A 2ZI3A 2WJ5A 2GJKA 1YRAA 2C9CA 2WMNB 5J40A 5KTYA 1PZNA 3VNUA 1BMFD 4C0KA 2QBYA 1SXJE 2ZR7A 3QVVA 2OLJA 4R2HA 4DLRA 3QKRB 2OXRA 2NO6A 1NIJA 3ICEA 1KY2A 3GFOA 5DS1A 1VIYA 3K09A 2J9RA 3T1QA 2V7QD 5AJYA 3ECCA 4KLNA 4TLDA 2VP5A 4TYWA 1W49A 4FMDF 4B3BA 1CXZA 4NKRA 2B8TA 4G5SA 3GJ7A 3PCRB 3CLVA 3TUIC 1E4YA 1XMJA 4ABYA 2AKAB 1KSJA 1UBFA 1GFIA 3QQ5A 4RD6A 2G6BA 4KFSA 3WYFA 3GLGA 1D5CA 3SU8A 4DSUA 5L3SB 5HKKA 3UG6A 1XPUA 4IFEA 2REOA 4DIDA 5FBLB 2DWQA 2BEKA 4FMDB 2ECKA 2IYSA 3IIKA 1HA3A 3RS7A 3AVTA 1SXJA 3R9XA 4Q48A 4ZDIA 3AB3A 4P32A 4EPXA 2VEDA 3S1AA 1FNMA 5E7MA 2OG2A 5E3HA 5AUOB 3QKUA 2QQEA 4NP6A 4C7OB 3I92A 3TGPA 4EPTA 4N3NA 2CR0A 4OJKA 1ZYUA 3AF2A 4PXAA 2ZXUA 3QXXA 2GNOA 5G41A 2OCBA 3KL4A 4D4KA 2IS2A 5CLLA 1DAEA 1T8TA 3CWQA 1EFCA 1NKTA 4PZYA 5CYPA 3X1YA 5B58C 1FTNA 3QG1A 4DSOA 4AKEA 5IF9A 1JI0A 3FKSA 1R5BA 1LTQA 5JJKA 3EA0A 2WJJA 4WXPA 1Z8FA 4Q9JA 3QVUA 4MRVA 1S8FA 4M1OA 3U6BA 3E5HA 4C0AC 4D4MA 2A3RA 5DGXA 1N6OA 4Q21A 1HQYE 3LFUA 4C0BA 1XCPA 4WZ6A 2QP9X 1Z28A 2IHYA 2JJ2A 1VCIA 2OE2A 5FI0B 1KJZA 3MJRA 3TUJC 4A2PA 1VYUA 4Z51A 4NCIA 1HTWA 3M4YA 1HY3A 3CRMA 1KI6B 1NIPA 3SYLA 3UMRA 1XCGB 1QHSA 2O8BB 1K5GA 1DAMA 1XF9A 1QVRA 2JEOA 4EQ6A 1HUQA 1GDDA 1KI3A 5LD2B 2WOOA 4P4UA 4GZMA 2ZRHA 3K0EA 1YU9A 4ERNA 2KWIA 4FW9A 3EZ7A 3THYB 5E7IA 1AGPA 1DADA 1Z0FA 2MMCA 4UXHA 3ZQ6A 3DKPA 4EKDA 1XTJA 1CRQA 2ODBA 4EQ6B 1C1YA 5FR1A 4QJ3A 3GFTA 1N6PA 4BASA 1EXMA 1Z6TA 2WZQA 5F3WB 4TYYA 2OT3B 3GP8A 2OZEA 2ASEA 1FP7A 2ZR9A 3UMSA 2IF2A 1E79D 1K6MA 1RC8A 4OK6A 4BLTA 1VHTA 1XEFA 4LSGA 4XVUA 3P20A 1WXQA 2A78A 3WHLA 4RJLA 1UBGA 2CLSA 2Y1YA 3RAPR 3RYTC 3W8NA 1ZVQA 1UEJA 5GJWC 3ZIAD 1GIAA 2YYZA 5DO9A 4D4JA 5B57C 1ZIPA 2P5SA 1HV8A 2CMKA 5FR2A 3VX3A 2HT1A 2Q6TA 2IYZA 3OIYA 1FZQA 3D7MA 4IOMA 3TR5A 2IK8A 1RJ9B 5J47A 5H70A 4GDFA 3FDIA 2QROA 1G3RA 1LV7A 3IDQA 4PFSA 2QT0A 1FX0B 3W8RA 4QHTA 2IA5A 2IS4A 4WAUA 2FFAA 4TZ0A 4UNPA 4AYWA 3IEUA 5JHGB 4DB2A 2IYLD 5B2ZA 1T3HA 1Z0AA 2H17A 1KKLA 2XXAA 1XD9A 3QXHA 2FWRA 4JVLA 1WBDA 3RNLA 2ZJZA 4PHFA 3R20A 1NBMA 1YR8A 2VQSA 2WJIA 3EWSA 4QBIA 5AK0A 1QF9A 2ERXA 1DE0A 2ZRPA 4DHEA 1N6RA 4OJQA 2YHSA 4RZKA 1MO4A 3I32A 2JDID 5B64A 2FSHA 1H65A 1YE8A 2ZROA 2GJ9A 4NYIQ 4GRAA 5KDOA 3U7FB 1XXHE 3GLGB 3LO5A 1E1QA 1NVXQ 3NTUA 2F1JA 3KTAB 1KTVA 1AIPA 1NVVR 5KNDA 4V0KA 3BK7A 4C3ZA 1E0SA 2GCOB 2WKQA 5CJPA 5G40A 3DO6A 3NDPA 2WWWA 3EPKA 1JPJA 2QORA 2WSSD 4U02A 3FMIA 2ZTSA 4LV6A 1IN6A 1W0JD 2P5TB 1DARA 2R65A 3PIRA 4QGFA 1EFUA 1DG3A 1TUIA 1XX6A 2EWWA 3BE4A 4NBSA 3KQKA 4MRSA 3AP3A 2GAOA 3KUCA 4BFTA 2BM0A 2OCYC 3GLFB 2Q3FA 1OW3B 4LBWA 4PPNA 2OO7A 2FOLA 3CR7A 3D3QA 4LK2A 2GK7A 3F8TA 3ZZ0A 3GLIA 4GP7A 2NO0A 1JXOA 1ELOA 3THYA 3WMEA 3BXZA 3W3ZB 2QA5A 3L1GA 1VTKA 3ADCA 3K9NA 2XB4A 4AD8A 3KXIA 2V8OA 2XTMA 5JEEA 3RANA 4L9SA 2KBFA 3HU3A 2F1IA 2J3EA 2QRZA 4LRWA 1V43A 4C9BA 4E09A 3EPLA 2IX3A 4MH0R 3FPAA 2FX3A 1KK0A 5JJLA 4GFDA 5L3VA 4R71A 2O30A 1T5IA 1U90A 1XPOA 3I72A 4A4DA 1CLUA 2ZRIA 3LV8A 4YE0A 2ORIA 2OV2A 3X1WA 4PSVA 2AN9A 4MYCA 1OT3A 1FL9A 3PUVA 2PT5A 2G0TA 2ZM5A 2XNSA 2EQBA 5EP4A 1MRNA 2B8WA 1AZSC 2QSYA 2WWIA 1E2IA 3ZVNA 2A5YB 2QSZA 3GQBA 4PPGA 2RGEA 4LYAA 3DL0A 5KNCA 1S4QA 2F43B 1JAIA 4P33A 4F4CA 2RGCA 1N25A 3BAFA 5FBWB 4TMTA 3CX6A 4IOJA 5KPDA 5IRCD 3CBQA 1NBMD 2J0VA 2QNRA 4D26A 3P32A 3JZMA 1OKKA 4ASUD 4M8NE 2QEQA 3TJZA 3ZIAA 5KSYA 4B3GA 1WGVA 1VCNA 4HLUC 4Y0VA 3CZQA 5BWMA 2C5LA 2FSFA 1XEXA 1E2MA 1BOFA 3KJHA 1US8B 2JIZD 4AKHA 4UJ3A 3BH6A 3DHWC 3P1JA 4FWTA 1LS6A 3B1WA 1NN5A 1NSFA 1XJ0A 3SHWA 3UG7A 4XH9B 4ZKDA 1LF0A 4RZ3A 3TR0A 3W6PA 2D7DA 4BLPA 1PLJA 4LBYA 1N6KA 2FEOA 3VFDA 2GZDA 2C9OA 3GLFA 1T5LA 1LNZA 3R7WB 2ZREA 4LC1A 4Z54A 3LBHA 3I5YA 1KNXA 1NN0A 2WJGA 3I8SA 1Z6AA 3LXXA 3QKTA 4DIEA 2N42A 1SXJD 2ZS9A 3FMPB 2QE7D 3KKPA 1FMJA 4QHSA 1KDTA 2QT1A 4XWAA 1KSGA 1GP2A 1A2BA 1W0KA 3B1XA 5FUWA 3QPVA 3K0AB 5CLQA 2VHCA 1MABA 1QVAA 3B85A 2Q3MA 3K0AA 4Q9HA 2ZI4A 1UBCA 4JBWA 3L82B 3W6NA 3H0KA 1CR1A 4QRHA 4PBDA 3IPYA 4Q19A 2VHTA 5LD2C 1JPNA 1GL7A 3MJHA 2QGNA 3L0PA 4YLCA 3VKHA 3IEVA 1XMVA 1ZNWA 2CK3D 1SHKA 1RRGA 2YOGA 4MRNA 3TQCA 1W2GA 4M1YA 4BFUA 2ZS7A 5CYOA 2JJ8A 2G1JA 1NLFA 3IKJA 1BMFA 2KSQA 4LYJA 3AVWA 1J2JA 4JSYA 3ZVLA 2GILA 1N6HA 3NWJA 3RABA 5CM8B 3VAAA 3PUYA 2C8VA 1T6NA 4IFBA 3U3OA 2AD1A 3QOFA 2IYUA 2RGNA 4TMVA 4CF7A 2ZVPX 5LUMA 2W6ID 1G17A 4LC0A 1AKYA 5DHAA 1BIFA 4TL6A 1M1YE 3RC3A 2ZJBA 2EFCB 4PC1A 1RRCA 4JL5A 4DRZA 2LKCA 4Q01A 1OLOA 3BGWA 4L4UA 2A5FA 3B78A 1I4LD 1KI9A 3GLHE 3MD0A 4PSKA 3RDPA 4LJYA 4HLUA 4UNRA 2ODEA 5DISB 1G18A 2ZI5A 2W6JA 2ZPTX 2OFXA 1E9RA 1FPMA 1M34E 4GNKA 4CVNA 3QSYA 4MKGA 3T06B 4YQFA 3NEYA 1OH6A 3BD9A 3SJCA 4QOSA 1IBRA 2F6RA 4HB4A 1G41A 2RMKA 1EGAA 2D74A 4UXJA 3B1ZA 3I73A 4V02A 1TADA 3CRW1 4RZUA 1Q1QA 1B23P 1A82A 3EIHA 4MUAA 2CE2X 3BBPA 3GMTA 3LQQA 1QZXA 4JLMA 4JJKA 3W9YA 4FD2A 4GMDA 4JLOA 1VG1A 2A2ZA 5K8TA 1X1SA 5HE8A 1KSHA 4QBFA 3VU9B 4M1SA 4DBLC 4TYPA 5FUXA 4Q1DA 4JIMA 5CB6A 4XOIA 2VP9A 3NC0C 3A4MA 5B30A 1G64A 4M22A 3KKOA 4O0MA 3AVXA 3B5JA 2IUTA 1TU3A 4D2IA 4YONB 1JEDA 4LJAA 3U3KA 1TQ4A 4B3FX 4RVCA 3U44A 5AJXA 2VP4A 4KSCA 2NIPA 1OH5A 4HATA 4ESHA 2FF7A 4KAXA 4CGZA 1G8YA 1M8PA 4DDTA 4CZ2A 4U00A 4JUSA 2HJVA 3WBKA 1II0A 1ZJ6A 3UWOA 2CCJA 2E9SA 1TUEA 3MRSA 4NYJR 4DCNA 4RD0A 1W2HA 2GJSA 5JWOA 4Q9LA 1DAKA 4A9AA 3K0CA 3Q9PA 2OBMA 1MT0A 2QMHA 1ZBDA 4TL8A 4Q7MB 3Q5EA 2Z4SA 2XJ4A 3UIEA 1G6HA 1GRRA 4Q03A 4LJ9A 4PSAA 4FMCF 4IVPA 3A1UA 2GCOA 5DI3B 1ZRHA 5JECA 3T35A 1ZINA 3KTAA 4RKFA 1OYWA 3BB1A 3T5GA 3BJIC 3HR7A 3CX8A 3GFPA 4URZR 1EWRA 2H7VA 4B32A 3QPUA 5FPHA 2OAP1 3U4QA 1L4UA 1MR3F 3T1TA 3MLEA 2J0SA 2ZANA 3GLFE 2XZLA 2RGAA 1OIWA 3NVAA 3VKGA 4XTCS 3LY5A 4DWJA 3SNHA 3Q9QA 5LPNA 5JFGA 3S1AB 4KVGA 3GJ8A 3R8CA 2NQ2C 3CNLA 5EXPA 5DE3A 3KX2A 3QF7A 1D2MA 4TMXA 3REGA 5GVSA 1Q57A 4NHOA 2ZEJA 1ZIOA 1AN0A 2F7SA 3BH7A 3SZRA 2ONKA 1NN1A 2BVNA 4B2PA 2VBCA 1IY2A 2ZUBA 1SZPA 1XXHB 3MGCA 4K8OA 1UPTA 3GLGE 1G9XA 1ESMA 3NBZC 1OFHA 2P0EA 1H8ED 2ZITA 1WMSA 4Q5IA 1S1CA 4LJ7A 4A2QA 2JATA 2Y1ZA 1XD2A 4C0QC 4NDZA 1SKYE 2WHXA 4JSTA 1UJ2A 2ORVA 3EARA 2GVZC 1GILA 3W6OA 2EVWX 3H86A 1L7VC 3WYGA 1U8YA 2X8AA 4AYXA 1IQPA 2H5EA 2YWEA 3J07A 5EXSA 3QKRA 2F43A 2FNAA 3JZAA 2QBYB 1F2TB 5ANRB 1Z6YA 2QN6A 2ZYTX 4IDPA 4DCVA 1Z3IX 4N0EA 5K8LA 5KNBA 3KQUA 4NYJQ 5FOWA 3Q85A 3B7GA 2OEPA 3VX4A 5SZHB 4XTRA 2ZSBA 2ZVQX 1W4CA 1YZQA 2R6FA 1CU1A 2ZJAA 2AD5A 4KU4A 1UEIA 4GOXA 1DS6A 4DVGA 2AR7A 2X19A 3RS5A 2HUPA 2D2EA 4D82A 2O8BA 1VG0B
chains in the Genus database with same CATH superfamily
4WFFD 1KI6A 4X6CB 1A7RH 2VDNH 1JPFB 5IZ4A 1FFOB 4N0RA 2PSJA 4Z2AA 5CWSB 3L0CA 3ZL4H 1EZUA 2ZG1A 2FSGA 4PSCA 4PJFB 4HAXA 1OP5K 2CNZA 2V7NB 1CDZA 1F4LA 3PHOA 4JB3A 3D34A 5IJVB 5DD0L 3L17A 1AK2A 4EDXB 1O6FA 3GGCA 2YQGA 1U9ZA 2O61A 3RSFA 2CO2A 5H35B 2ZWMA 3S55A 3PWPD 5ID0B 4P4GA 5K3AA 1O6SB 3T1WA 4E2OA 2IPNA 3INNA 3TW4A 2VKXA 2YJTD 3HBNA 4ZX4A 5FYKL 3C7CB 1SG0A 1U11A 5JV5A 2A1TR 5HGJA 2WJ4A 2XYPA 4TROA 5DVMA 3GAZA 4DN3L 3CX7A 2Q5IA 4U2KA 2RH8A 4L3CB 4YMLA 5IHXA 3HDTA 2WQUA 2XGJA 3C08H 3L79A 2I03A 3T4UA 4WXMA 1J1ZA 2NY5L 4RULA 1FBNA 2EKSA 3H5NA 3IAQA 4JK0D 1X1DA 3RRNA 1PUIA 4KR6A 2RGXA 3S2UA 2FPWA 3GCGA 2J71A 2RONA 4PGZA 3AX6A 5DW3A 3DA0A 2PP7A 3F65A 4GVPA 5E4EC 1SU7A 4AVJA 4FQ5A 1IFXA 1H2EA 1JZ8A 4B7ZA 2UY7A 1YB5A 4FERA 5GY7A 4LNRA 4OLYL 4GUOA 5EGNA 2FDCA 4DP9X 4DSAA 1GZ3A 1I6LA 3OKOA 4XMVA 1M6VA 2FVYA 1N75A 1E9OB 1T3SA 4EN2A 3MYRA 3WEBA 3LAFA 2BVEA 4YAQA 3HZZA 4MQXC 3ZNPA 3DVRX 1YC2A 3TL2A 2CRIA 2X3BA 4J8RA 3TOZA 1UJ5A 1EIZA 3GWZA 2HPVA 2ITCA 3CSYB 1OFVA 5LXGL 4J0JA 5B39B 1XN1A 1ZH2A 4X62B 1J1XH 4I3RL 1NTOA 2WUEA 4RGOL 2VNAA 2YXVA 5FLKA 4AC4A 4Y4KB 3HG7A 2FATL 2FEDD 2J2ZB 3T77A 4Q1CA 3BAJA 3BFKA 2IY7A 4ZS7L 1EBAA 4I1IA 1A9TA 1MHHB 3UH1A 4NNXB 3NZEA 1NVUQ 5LBIA 3IS0X 1PS9A 2R8EA 1A65A 4B6ZA 3MOBH 3F05A 4ZMPA 1WIWA 1GAJA 4RFEB 2AKEA 4LRNL 4EHAA 3SOBL 1GXSB 3DA8A 4BKOA 3DXAA 1IIRA 4P2CG 2K3HA 4NBZB 5FHQA 3AS2A 2QZQA 4F3FB 4B3MB 5JHBA 3SJVA 3BMNB 3DP9A 5E99H 5IQNA 3P2OA 4OFZA 4Y6PA 3O6VA 4PWKA 1OSNA 1VJRA 4Y16C 3NKVA 4AH2A 3VD4A 2RGGA 1IHUA 2W9DL 4K9NA 4CMHB 4HFJA 1YZYA 4MXDA 3L81A 1ID5I 1MIMH 3EY9A 4QUDA 3WB1A 3GPSA 4FL4C 1DLFH 4MHSA 5CF3A 4HC1H 1BZDA 4D45A 2UUDK 3QZLA 4RAUB 3AZQA 5J1SB 2KX7A 1MRZA 2X0UA 3R3YA 1X5XA 3L7NA 2J8OA 3CPEA 1S7XA 3IMTA 5DM1A 5E23A 2OGWA 2FQQA 1OX6A 2R9HD 1M7HA 1IZYA 3UJ3X 2WFZA 1JIQA 3RB8A 1VFNA 1VGQA 3SK0A 3GGWA 2HWYA 3PR1A 2ZP9A 2WOBA 3B3JA 5B38B 3EEOA 5HP5A 5D70L 3AGQA 2PBRA 3NAAH 1LI5A 3UBXA 3H6HA 5A1AA 3W6UA 3TMAA 3IEXA 2CSPA 4KE7A 3SCMC 1G5PA 5CFNA 3ZNNA 1S6YA 5FO7B 3R8FA 2DB8A 1KXTB 2UUBB 4YFLI 3DTXA 1A3RL 1KJ3H 5BV0A 4MI3A 3MWJA 4P0PB 5JIPA 4XX0A 1AQJA 3A4FA 3DAFA 1XF2A 5AAMC 4EVIA 4Q47A 1P5UC 3RX5A 5H37G 4GI6A 3MJ7A 1S7QB 1E3JA 1EHIA 1M2HA 3GPEA 4TVPH 4ZU6X 1N4XH 1JFHA 2WE8A 1EEZA 2LBPA 1FEZA 3FCEA 4YWGH 2O5ZH 1WO2A 4B7LA 1FP4B 4MDEA 4EZMA 1BJ1J 2YZKA 1U0QA 3P0RA 1IKNC 1FUUA 4CHGA 4EW6A 5I1AA 3KVNA 1EHNA 2Q7DA 1PY0A 1MORA 3FM9A 1KK2A 1JDAA 3GHEH 2P6NA 5L4JA 3ONWA 4BNNA 1N2ZA 4R7GA 2IXEA 1JWAB 2FUCA 1LQTA 2ZPKL 3VXRA 1V7NL 3SHOA 2B4YA 4PZDA 1JR3D 1TB4A 5D93C 1UXSA 1W46A 5G0VA 3JQQA 4DR3B 3T34A 2R69H 2P91A 3AV0B 4D9JA 2NR6C 1I53A 4S2SB 5C1OA 4ILDA 3IM1A 3KQOA 4ZOAA 3DDGA 1K4KA 4KQMA 3BE5A 4YMUA 1FPTL 3FQUB 1JPGA 1MX5A 3C1TA 4BQSA 3HV0A 2Q5OA 2FX7H 1ITZA 1TCMA 3RCBA 1OW0A 3TVMD 5EC2B 1P44A 3UL4A 2JLUA 4FYRA 3HCRA 1GTSA 4Q0MA 3RZCA 1F60A 2PVPA 4WIAA 3QFFA 5CEZL 4DK6A 4AGPA 2GSIA 4X6BB 2FQFA 5IS2A 4HWZB 3FOBA 4ALMA 4MGZR 2GAAA 1YDPA 3CF6R 4AGNA 3BWEA 4MINA 3QJUB 5EZIL 1A47A 3O6ML 3LGSA 1GQYA 2XD4A 1HETA 4BNKA 1E1RD 3M5PA 3GEWB 1JQAA 2FZWA 4I5EA 4L0YA 4QOKA 2VXTL 5DUJA 3NHMA 1BYOA 5CP3A 1U8ZA 3I1FA 2J3IA 3O94A 2HCFA 1FFSA 1HZZC 3I6KB 4YXLH 3U0WH 3R5TA 4AQYB 4KKZA 2J72A 2NU8B 1KEMH 3R6WA 5JAIA 2X3YA 3JTEA 4LSRH 2QTWB 4PX2A 4MRMB 2HU5A 3TE7A 4JLPA 4BNZA 2DSNA 5AAPA 3FT0A 4L57A 3D4ZA 5CM9C 4EITA 4GR5A 3E6HA 3WUWA 3P11L 1L7EA 3LZQA 2VZ1A 3MWYW 2AKRA 3GB7B 2H8PB 4Q3EA 4EVSA 3BXEA 2UU9B 2IE8A 5IT2H 4PJDE 2YWGA 3OHSX 4NU8X 1KVRA 4NT6B 2YXLA 4JR9L 5HHNB 1X7TA 4CF4A 3LHSA 1VDMA 1CQWA 4TL9A 3QIWC 3T0FA 4PLWA 1RS0A 4HKTA 4JHBA 1RBQA 2XVLA 4MKXA 4R05A 1ADBA 4GM1A 4HJJL 3Q5TA 5FBRB 1Q12A 1I3KA 4HJIA 4X6DF 3DVNA 1Y3IA 1I6WA 2ZCVA 3IPAA 3LZOA 4E32A 2X7LA 2DHEA 4X5WA 5G4LA 3BWUC 1PEKE 2RH9B 3T3DA 4BZ2L 3OJLA 3HI1B 3CZAA 4CBZA 3HN2A 2XTJD 4WEOA 3IQXA 1AA9A 1T5OA 2XKJE 4HEMA 3OKEA 2X2HA 3NUZA 2CLVB 3CXUA 5HHVL 2GZHA 1OU0A 5GGTL 4ZW6A 2OMTB 2PR4L 3L2NA 1TZCA 3N0WA 3UY4A 3MOQA 4JZOB 1V27A 3T0EE 3LTEA 5EOQH 3DOFA 2E6PA 4AF7A 4NZTL 4L8DA 2XUOA 5JQGA 4YZWA 2EKLA 3VHRA 1WHTA 3CZMA 1GPOL 4D97A 5LNK1 3VDBA 3KWTA 3NCEB 3AO0B 4H0NA 2PFSA 1MXFA 2X53A 3TLBA 4S1VA 1Q7GA 1CZOA 3DUHA 1B4JL 1MRFH 2C2HA 1NVMB 3E3QE 3QE5A 3PEVA 2MSWA 3R40A 2F1OA 2H7CA 1PWXA 1H05A 3EF4A 3GSNB 2JHAA 1NIBA 1LSSA 4WVLA 5A2GA 5D7JD 1IK6A 2GQHA 1HDIA 3SE8H 4C30A 3AERB 2JFHA 5J1TB 1HFWA 5ISZE 4GKSA 3G9VA 5AHKA 2CLCX 4N2HA 5ER9A 3MR9B 5GRVK 2FQYA 1QZTA 4OQDA 3UJ8A 5JWHA 4DQUA 4GW1A 1J22A 4U6YA 1PIGA 2O2IA 2P2NA 2RHOA 1V5WA 2VIRB 2YY6A 2NSMA 2Y66A 1Z68A 1XEWY 3NZUA 3WLHA 1Z0UA 3UXMA 1OAQH 5TH2B 4E94A 4MWFB 4FE9A 2MMGA 5C97A 3WHIA 1R00A 2V7HB 3ZLBA 4HDRB 3P9LA 1X7ZA 5F2NA 4OLJA 1BMZA 2FQDA 2K5UA 4A7PA 2BFFB 3OJ2C 4NQSA 1R3KB 5G0WA 4C7KA 5KYUB 5GGTA 4B6EA 1OP3K 2DQHH 2GAJA 1EEUA 1XIWB 3SZOA 5E00A 1SEQL 1Y8CA 4UCFA 3ZWNA 1NFDA 4N3CA 4L8YA 3L0BA 3MCVA 5CHNA 3KPPB 5I17A 3CN2A 2GLTA 2ZRGA 1L0PA 3MJ9L 1GQSA 3UZQA 2R0WL 5F4ZA 4B9ZA 1GGJA 2ONJA 2WILA 5JVDA 1CR4A 5G4OA 2HF8A 3BULA 2AJYL 1EJ0A 5LYYA 4CQMB 3GMRA 4DIKA 2O4EA 4UINL 4APQB 2A0LD 1GUAA 2X09A 3FU0A 4H27A 5FO8A 4FCAA 1E3ZA 4RA9A 4AFNA 1YR9A 1UACL 5DYGA 3U4AA 2CLRA 1MH5A 3I0NA 5HHQA 1JQ3A 1NUPA 4Z5XA 4NCXA 4HIHA 3CH1B 4KWEA 3VHXB 2VSCA 1FSFA 3PSHA 4OT1H 5EO1B 5JDCA 1CC3A 3TZVA 4IO1A 1A8JH 4RZCA 1MU0A 2PR7A 4B3CA 4CJXA 1EI9A 5FDWA 1WE2A 4Z77A 2WAOA 4ZTEA 1D09A 4TN1A 2H3EA 2WN2A 1N5YL 2BMDA 2PXYD 1K6JA 3I3BA 4RIEA 1J8VA 2VN6A 1Z26A 3AM4A 2PMCA 1JZHA 1SVOA 1D6EB 1ZMRA 5LKRA 2FFQA 3C9NB 4HMEA 3G2NA 1BLNA 1FUKA 4IIQA 1PG0A 2OV4A 1GCFA 4WKGA 4ALAC 4DKDC 1KCSH 4HLNA 3E3LA 4U2GA 1ACMA 4XPIA 3G7NA 1H1LA 5EEHA 4N6OA 3QVSA 1BS9A 3ZMEA 2R1UA 3O6FD 3IBGA 4O51B 2ZLBA 3U3JA 3E9EA 5BN4B 3L1EA 1Z34A 2ZR0A 3GW8A 1RM0A 4OLBA 5GS0L 2VLIA 3B6SB 1P2VA 5F7UA 3U7WL 2APVA 2JJVA 2E27H 2FJUA 1R3JB 4JI3B 5ITBL 1IEWA 4BO5A 1K86A 3WS7A 1GNPA 2JCGA 2G36A 4AS3A 2GFBB 2OFWA 3UT5A 4FJ6A 4HUJA 3M5CA 1T4KB 2VUHB 4KGDA 4S1DD 3U2QA 2Q21A 2EC8A 4WN9B 2RI0A 2EG5A 2EDBA 3K2BA 4CMEC 1YGYA 1BWSA 2OAQ1 2N0KA 1OBCA 1T04A 4BQBA 1G8MA 4QRRA 4BO9A 5E4JA 2YPLD 3QUQA 4H2DA 5I5GA 2VLKA 3MRKB 1CRZA 5LQBL 2G75B 1E28B 3OKMA 3C6XA 1EGQA 821PA 1G9ML 5ECJE 2GN2A 4QNRA 2EH7L 2OW7A 5DDIP 1Y4SA 4KI1A 1ZUD1 2VRAA 2H3NB 3S37L 5CH8A 5D72L 2Q3DA 1Z45A 3OC0A 3RVMA 5B3NA 4PY2A 1JFRA 1A4CA 2G0KA 1Z32X 1JNLH 2O6DA 4MS3A 2DMHA 3ZHSA 1IXYA 1F1AA 3C6LD 2XA8H 3FHAA 1TJMA 2P7TB 3DVGB 2H00A 3I2KA 3TFKD 1AO7E 2V5AA 5FM4A 2NW2A 1Y82A 1ML0A 1A5FH 4KJQC 3TC9A 4ND4A 3FRPG 4PGCA 1QG0A 4WECA 1YIOA 2ZULA 3BB4A 1Z1WA 5FOUA 3EHBC 3JWNC 3K6DA 2CCKA 5LXGH 5HGXA 2P9FA 4AW9A 3WY4A 1UT6A 2Q5EA 3VA2C 1IGYA 5SY4A 2VHVA 5DMXA 2XI9A 3DBRB 5IDWA 3FQXB 3LCMA 1QMGA 2C7PA 4MCIA 3RNKB 2XWPA 2ZRAA 3ZT6A 4DEWA 3LM8A 2SHKA 1HWHB 2C5SA 4MV4A 3DXFA 1AGDA 3O8QB 4V0RA 5C8DA 1CJVC 2FFBA 3HPLA 3LRGA 3DX1A 1NNLA 4XOCA 5C0AB 4PS8A 3VU3A 1KVQA 3KPWA 5AYVA 3ZL2A 4DGIH 5A06A 2RHWA 3CZCA 2IYXA 4RCZA 2G5BA 3UPAA 5CK4A 3R7BA 2VYVD 1QLJA 4B2LA 2BJMH 3QORD 3EJWA 1U5CA 3WMSA 2ZIFA 4MO2A 4BV3A 1BWMA 1CP2A 1A3RH 4OBWA 2PCPA 2XVBA 3QC6X 1OSZB 2OL3L 3KPVA 1L7DA 4FG4A 3QJFB 4WBNB 1ZE3C 1YN7A 3BXFA 3LZFH 1QRNE 3ZQ9A 1QFZA 1PR1A 1U8HA 3TS1A 3VFOA 1NLDH 2OD9A 4UUJA 1EFRA 4LF7B 5IT4A 3TCLA 4IEFA 4E51A 1U6AL 1U2DA 3HP1A 1WP9A 1JLSA 5L3ZA 2H45A 4E7OA 3L5XL 5K01A 2WHEA 5FTKA 3GRAA 5JXWA 4Q18A 2DOCA 5B1JC 1ECCA 4N4YB 4ZAFA 4DIBA 3DFFA 4ZO6A 1L1RA 1T5WA 4CU2A 1F48A 3SKOA 4O08A 3Q9UA 4L5BA 1SA0A 3H5VA 1G20E 2G06A 4HY3A 4AJNA 1QPZA 5FLYA 1U6IA 2V5UA 3P19A 3HOGA 3LKPB 2ORED 1L0YA 3VFSA 1JE0A 4HNTA 2X6BA 2C04A 5HTOA 2VNCA 4DMRA 3FCSB 4Z1MA 1XV8A 5BS0B 2W60A 2ZRMA 5JIMA 1G5HA 1IXSB 2AG1A 4O25A 2HIMA 3H4IA 1V16A 1MZYA 1FRQA 2NVUB 1IBLB 1KAHA 3AUTA 1IUKA 4F4HA 2ZOTA 1NFIA 1RKBA 4QEZA 4TTTS 4MD4A 2Z3WA 4FT4A 4MUJA 4MQFA 4X7PA 4ZZIA 2R97A 1BJKA 4CM4B 4EHHA 4NEQA 1T21A 3TH2T 4PJDB 1JHOA 4AJIA 2I76A 3ILPA 4OATA 2FO4B 3WQSB 1E3LA 4LGPB 1J1UA 3HZVA 3G89A 5JXAL 5L8LB 4KO8A 5C0BE 2J41A 4LZWA 4C3OB 2PYEE 4M87A 1X5JA 3O4LA 1QS0A 5I30H 4FNSA 3HHRB 4EQ3A 4N90D 2QRJA 1Y8RA 2F54D 2ZE0A 4YO0B 5H9VA 1UD8A 4G67A 1OQOA 4DTGL 2FMIA 3K9CA 5BSTA 4KP7A 2CRMA 1XRLA 4WGWB 4JJ8A 4ZFQA 3M3PA 1T10A 1KP2A 3WDJA 4RWHA 1VRVA 1B2WH 1HHIB 3HKCA 3BTUA 2P2GA 4R7ZA 4HMDA 2QMQA 5JOFB 3VWKC 5AK3A 4RF2A 5DNVA 3RHTA 4ZTZB 3WP0A 2XA1A 4Q3DA 3HCCA 4RGND 3CIOA 3TLJA 3QHPA 3QQDB 3I3SR 3U1PA 3D0OA 4ZOLA 4Y5YB 3KPRB 2HB0A 4QBGB 3IPRA 3A36A 1RPZA 1ONQB 2R86A 2EDFA 3ME0B 3N85H 4AY4A 1B0AA 4FWIB 4NIYE 4C4BA 5TY0A 4BWYA 3GMNB 5DNYB 4X7BA 3UGJA 1JKIA 1OT1A 2V8BA 5D7SL 4DOHB 2XGMA 3FIJA 4R7NA 2ORBL 5IK2D 4PZLA 3VM5A 3N2YA 2HU8A 1J9TA 3PV0A 1ZSDB 1KN4L 2SECE 1AGXA 2V37A 3FIUA 3WLRA 3KYMA 5IIEB 5TLSA 4ZTUB 2C5FA 1PJBA 2JZNA 1WBYA 2BI7A 2UAGA 4ZARA 1AHIA 2PPVA 4XFKA 1YI0A 1EP2B 5CSGA 2VTBB 2VEOA 3BT7A 1F20A 3LAWA 3RLIA 4MQXD 4C4AA 5B4MC 4LKCA 4IEEA 5HGHB 1RI1A 5GRJL 4KWCA 3AKCA 2V5VA 4I4IA 3LGAA 4XRCB 2QVXX 5J58A 3P2YA 2CHXA 3LWZA 1P4AA 3O73A 3IRVA 5HDQA 3WE1A 3FQRB 4PXSA 3KZXA 1NQVA 3OWXA 5D86A 4I87A 4XXCA 3ZKMD 3LQRA 2PBZA 1KF0A 1F86A 1T1WA 3M6XA 1XSOA 1J0AA 2AXPA 5EOQL 2UX7A 1CUHA 3LK7A 4OJYA 3RC7A 2KB0A 4AF6A 2PLNA 2VZTA 3MQ2A 4BZ1A 3VVBA 3NJLA 2CH8A 3A6ZA 2EW1A 3QUXD 2H3HA 1KYIA 3POCA 5EESA 2XH8A 3QH3B 1MJ8L 2VQFB 1ZPLA 4LF5B 1T21B 5I1KH 2CKDA 1ZHKA 3CW9A 2QVIA 2WQSA 1A9YA 1FZMB 4G8BA 3DKHA 4AX3A 5CXQA 4P3KA 2C2ZA 5TX7A 3R4CA 4MD4B 1AGYA 1JWSA 3CVDA 4HIJA 4KQ3H 2OLJA 3CFTA 4PJIE 3O8LA 3GFOA 4U1HA 1TQUA 2PWHA 2WSLA 2V7QD 3PHQB 1A7BA 1TJGL 3O6FA 5TMEA 4CF6A 3N7TA 2VR7A 1O6TA 3L06A 5IJKA 3JV7A 2YVAA 1XNHA 3U0BA 4OH7A 3A23A 5BW4A 5LWQA 5MEND 1HZKA 4O1IA 3HDGA 2AGJL 4K8RH 4CJ1A 4ZDIA 4IQ8A 4XWWA 2VEDA 1I1RA 5K59E 4RH0A 3MMSA 2CR0A 1BXKA 2ZSVA 4Y2DA 1MOPA 3BSFA 4FULA 2CC2A 1Y81A 5H3CA 4NO2A 2H29A 4ZVNA 4Q9JA 2H6UA 3CU7A 3ESOA 3OPYI 4B4DA 3OLGA 5HG0A 1CU4L 2JK1A 5D1XC 5D1XB 3OM3B 2AC2A 3RBZA 3TCLB 1CUJA 3LFUA 3HY6A 3E9QA 4WZ6A 1EERB 2EX0A 3LX4A 5HUHA 2XWBB 1C3JA 4A6DA 2BHSA 1LEIB 3CDZB 4ZX6A 5JHDA 3UFXB 3TZHA 5CCGE 4EQ6A 1HUQA 5CCKL 4UT7H 3GI1A 2A1UA 2XVYA 5TE6L 4DANA 4S1SH 4C14A 1NWHA 2BX5A 1LLQA 3UKOA 2C7BA 4EDFA 2ZD0A 5CBPB 4GLRI 2WZQA 3KKLA 3GP8A 1IGTA 2ZZUT 3DCJA 1ZA1A 3KQMA 5J2TB 2ZJSL 4OGYL 1N5AB 3ARGD 2DWTA 2HX9A 4W9ZA 3V8MA 1IARB 4QXRA 2A78A 3C3PA 3I2IA 3RFCA 3OZGA 4KH2A 1JKJB 1KB5A 2GD0A 1DB3A 3IR6A 2WXPA 4YJ3B 1RJ9B 4GI5A 1YULA 1K4CB 3HRZC 3HPLB 3ZU4A 1ZN7A 1I1OA 2IPMA 2BPOA 3CLEL 5KCZA 4JH0A 2IYLD 2AI0L 2YSSA 1JDZA 1VFMA 1RAMA 1MQ9A 5I7HA 3QXHA 5ABDE 2WJIA 2F8VA 2LD4A 1O9BA 4PFEA 3HLYA 3OX8B 4YDQA 4JDUA 4NBTA 2FT6A 4TUOB 4CMIB 1GOFA 1HNZB 3NW9A 1SUAA 4K03A 2BFMA 4JO8A 5KKCA 2ZAHA 3NWBA 5IR1B 4YV0A 1W0JD 1FG2B 1MF2L 1UH5A 5A04A 4YAEA 2FT8A 5ILTL 3NBAA 2ZSIA 3D0LA 1F4YL 4P8QA 2X88A 5DJZA 3EDJA 4CTKA 1A9SA 1OB1B 1XV5A 3VSQA 4RPHA 3MREB 2NX5A 4X6FB 3VSVA 3EPLA 4IDAA 5H59A 3PD0A 5L3VA 4BNTA 1U90A 1DCMA 1ZKAA 4ZUUA 1MN4A 2O2HA 3LCYA 3CGTA 3G9XA 2ORIA 4RMBA 4HS6A 3ENQA 1CFMA 5C81A 2PT5A 4MRBA 2C3HA 4OFYD 3BDIA 3JQCA 4L4YA 2IFFH 4IX9A 1NPUA 3GIVB 3EFBA 3PGMA 2J5QA 2JKLA 4K6OA 3VTAA 3C39A 4XC1H 3DL0A 2E6UX 1VBMA 4TMTA 3O3EA 5IRCD 1WDLA 1JX6A 2QNRA 3VG9B 4ASUD 4M8NE 3ZIAA 3AR5A 3PUCA 4AYID 3PJLA 5AI6A 3CZQA 1AHWC 3QFSA 1BOFA 1VL6A 1KZ6A 3ZYOA 1NZJA 4OHRA 4OXNA 3DBXA 4JRYE 2G70A 3C12A 1I9EA 4D6XA 2D7DA 4O4LB 4MD5B 2CFIA 2UZIH 5JDCC 5K1NA 3L04A 5EU4A 4AS2A 5FBHA 2YCLA 4QO1B 3ETGA 2QT1A 3GDHA 3TBSB 4YHKL 9GPBA 3QJQB 4HC1L 3ZSSA 2IGBA 4KZDL 1XYVA 3CCHB 3BW9B 5FWDA 3DMTC 1UKAA 2KZKA 3DUUB 3IPYA 3BIOA 2WU3A 3D69A 1SHKA 1PVHA 1JI3A 4DR1B 4N2KA 4A5OA 4M1YA 2NSLA 1SEQH 2BJHA 5JW3H 5B3JA 4GX5A 4PY7A 4REMA 3EO0A 4FYPA 1JI1A 2UYOA 4AJWA 2RHRA 3EWIA 2A1TS 3IEMA 4DM7A 3QDGE 3MROB 1RQ2A 5BUGA 3K46A 3KZCA 3H1BA 7MHTA 3MD0A 5I7FA 2ODEA 3MO1B 1NGZB 4RZCB 4B0OA 4YQFA 2IIQA 1XMXA 3TEUA 4E5XG 4TKWA 3PQYD 4RNCA 3DJZA 2OB1A 1JTFA 2RHGB 4O2EA 1EQ2A 3R7SA 4KHXL 8FABA 1O96B 3WJJA 4JLOA 2EP6A 5HTSA 2A2ZA 2WZ0A 4IGKA 4PJ7A 5HDQL 2I25N 1RDFA 4Z9YA 2A4MA 1BXAA 1T4CB 3U3KA 4JW3A 1LBIA 1WB4A 3JWNG 4J4PA 2Y76A 5AVZA 4KRPB 5A4FS 2OCKA 2OHGA 4DESA 4OV6B 1RUAL 1E3EA 3AL2A 2HT3C 3BPLC 1UATA 2C9SA 1XZEA 1LVEA 5AVYA 5KSAC 4MNGE 3M8OH 2FHFA 1TUEA 3LHDA 3VH2A 4L2IB 3AAZA 3TT3L 1MT0A 4AEIL 3OWHA 4F5EA 3D18B 1QV6A 3ML1A 4MV5A 2H51A 4PWGA 2H0FA 4IWYA 3Q2KA 3ZU5A 2B7LA 3AY0A 4R8VA 3T35A 5E00B 3OIFA 1TI7A 3QIBA 4QSHA 3S29A 5DC0A 3W78A 4P3OA 1MR3F 4PN7A 1Q91A 1ZXKA 3ALWA 2CZQA 4GL4A 2F53A 4HJGA 4N47A 5C9JA 2XV1A 3RU8L 5JO5A 2BOCB 2ZPKH 3SNHA 3GMNA 3QVOA 2PQ6A 4UWQB 2CHWA 3T4AB 2VWPA 3KX2A 4RBPK 3E7XA 3QF7A 4TMXA 3REGA 1BQSA 1ZS8B 1BA3A 2WWTA 3VYVA 3WWEA 1PJTA 1D7DA 3S9DB 1OAXL 5T1MA 4V3BA 4ZOLB 2ONKA 3LBFA 3SZRA 4EJ2A 3BWAB 2YPLE 4EUPA 4C5CA 4XVUC 4R3UC 4UM7A 5F3FA 5IHLB 5KNDD 5ALCH 2VITA 4GLFA 4LJ7A 1QIHA 3EUAA 1N8ZA 4C0QC 2BC4B 1D07A 1N8NA 2QQNH 1OTXA 3SVLA 4IXTA 2GPZA 2EVWX 3UWSA 2VXCA 2VDKL 2IUYA 3DEIA 3FBGA 3QRWA 2JAPA 2EIEA 4Y9UA 4KAFA 5CA0B 2F67A 4DV3B 3OMIB 2AQ8A 1DIOB 2HV9A 2CUNA 2I67A 1JHMA 4FGSA 2GJ6E 5C70A 1TCUA 1FL5B 3DC0A 4KU4A 3FSAA 4M0UA 4KWUA 3IKMB 1E61A 5I5RA 1IYZA 5KYYA 2YK1L 2VZ8A 3UMGA 1OAOC 3Q7EA 3X2QB 2FO4A 2B16A 3A9RA 5B38G 1BKYA 3HHSA 1OF0A 2A86A 3QX8A 5UKDA 4ZI7B 3KSMA 3T4YA 2WV7A 1EWQA 5I2IB 3P3TA 4F8OA 2JCSA 4ZWNA 3RYFB 3O41A 3D6UA 1KC3A 3R5FA 2Z04A 5DDHA 4YMGA 4TMKA 1Y1LA 3PV7A 1W5BA 4YHNA 2CCGA 1I14A 3HZYA 2W60B 3FW1A 4Z76A 1B2WL 1VDGA 2VYNA 5F0LB 3HLAA 4BBPA 2G1AA 2RBEA 4Z7VE 3N3AC 5A7HA 3TPUA 3NFPA 2A6KA 4YP1A 4YJKA 4G8EB 3DYPA 1O9HA 4JJZA 1SMKA 4Z7QE 3F12A 5EXTA 1ZRNA 3WNDA 4HFMA 3V6MA 3HJUA 5IAEA 3S97C 5AUNB 5HF6A 2EZ0C 2NZUG 4ZDHA 1W6RA 3ZK8A 1I9RL 3TAXA 3CVIH 1MV8A 5CITA 2QSTA 4MYTA 5KVGH 4GI1A 3EG9A 3ZIYA 4PREB 1UXWA 2QV2A 4A66A 1NLBH 2Y7QA 5LP6C 5JG7A 4J3TA 5G53C 5HPMB 3ZQKA 3QZBA 1QLEB 1QTRA 1C41A 1A9RA 2Z2XA 3QR0A 2X7JA 2AJSL 3CG0A 4QZVA 1QR2A 1QFSA 5KKNB 1NVVQ 1ADQL 5AVUA 3B9KD 1HZZA 1X5GA 4YGAB 4ZVSA 3O6KH 3C3AA 5IKXA 1P4RA 4LSQL 1C29B 1M7XA 4CT5A 4UFPA 3CVVA 2X4LA 2EQAA 3GH3A 2NY2D 5BW7A 5L3RA 3MRJA 1HMPA 3VU9A 3B7UX 2X8BA 1EHYA 2PSFA 4PRZA 1T0HB 2NVBA 3MLSL 2XUGA 1FDLL 4OSOA 3TYGH 3KYBA 3L7MA 5LGJB 1V7ML 4KX5A 2J45A 3T52A 3KU4A 4H8WC 2IX9A 2FQGA 1BEZA 4CIDA 1EVKA 3SNKA 2X9VA 3CH7A 4QIRA 1PL3A 1RHKA 4C6SA 3LT1A 4LJ5A 3LT4A 4W9EC 7ADHA 5LLIC 1FFCA 3SOPA 4GAJL 3PDIB 3W7VA 3KPQA 2FZ5A 2I4OA 3ARQA 4J75A 1TU2A 2R3SA 2Q8PA 3FQTB 3V4LA 2D1RA 3ITKA 4Y2JA 2AV7A 5J5EA 2NW3A 4I1YA 5REQA 4JT4A 3JQRA 4JZNA 1G5RA 3G49A 4QRPB 4XFDA 4W9FC 3DMRA 2WP0A 1R9NA 3WKQA 4CUCA 2GM9A 4Y9TA 4EKYA 2A1IA 1VERA 4A27A 5FA4B 3Q5DA 4JDEB 1Z2OX 3LX8A 3LYUA 4PEEA 2R69A 3U7EB 4LSTL 3KUDA 5AW8B 4DGQA 5AW3B 3ILDA 1MCLA 2R96A 4PGBB 1CYEA 3GBPA 4LVNB 5KSUA 1B0ZA 4GSYA 2AZMA 1W1UA 1R4MA 3MODL 1ZEAH 2IXFA 4LBAA 1BN6A 5BWOA 5IN4A 4WO4A 3O1LA 1VQ1A 2Q45A 3PUWA 3U80A 5SV3A 4EJ6A 2ZRCA 1ZHFA 3L1KA 5HOQA 2IT1A 2QAGA 2RKWA 3VNSA 2JH2A 1J7VR 1W75A 2Z98A 5FL7A 4RW0A 3DOJA 5GVRA 5JJCA 3RGVA 5D2CA 4KTYA 4KO4S 2A0FA 2X41A 3AM3A 3MAGA 5KC8A 2X4QB 3GIZL 3BZBA 3LWNA 3DBOB 4MWGA 3K5HA 4TKLA 2WOJA 1M2KA 1JJ7A 3KS0H 1MIEH 3SDCB 4Y16A 3B2UD 1UQRA 3WWOA 3TF5A 4GQPH 4B35A 3N0XA 1S7VB 4EJSA 4EI8A 5C35A 3I39X 2PUWA 4G4GA 1ZTMA 5CVTA 1R4AA 1DVZA 4EA6A 1UK9A 3U4IA 4HWGA 4LLUA 3HB3C 3CFQA 2H52A 3CDCA 5AHWA 2X1HA 2VMDA 2CXQA 5G3YA 5TE9A 4Y1AD 4F38A 3OFJA 1QB7A 3NRPA 5ALTA 2FP3A 1OOAA 2QTGA 5EEUA 4ZYKA 3N6RA 4U6QA 3R77A 1AOZA 1E27A 5TR9A 2FH6A 4ND2A 1RKRA 1J5OH 1XJ5A 2NTFB 2O2GA 4RY0A 4C4ZA 4Y9SA 4RGOH 3WIIH 2MYUA 4OZHA 4C5BA 4NOFA 4QCIA 4Z77B 4AEHH 4P49A 2I4RA 1HDXA 4KLAA 1RHHA 3S98A 1NQAO 3H54A 3NBFA 2QR3A 3AK4A 1RWQA 4WNCA 5A4IS 4MX7A 1NFDF 5AW6B 5JVDF 1BMQA 2DRIA 2XKSA 5GADl 3HG1A 4YRSA 3KPOA 2E6KA 1S7UB 4GW3A 1OAUH 1XXFC 4NPKA 1E5AA 2HQSA 3GMOA 3WISA 3WGUB 1P5UA 4LPSA 4UAUA 2X2EA 4GQIA 1QGYA 1G6RL 1DOAA 2COKA 1WV0A 3DBVO 4L3EA 4KODA 5FDFA 1X1EA 4RA9B 3F2LA 2FMXA 4GUPB 3N5CA 4I66A 4WU7A 3SGJA 2R7AA 4X92A 1Z0IA 1NOLA 3L4EA 5AD0B 2VJMA 3GVCA 5JZVA 3ZKQD 1CF8H 1A9ZA 4QYIB 4HNUA 4GH7B 5DHVB 3H9HB 4YRFA 5IHBA 4ETQA 2M8XA 4HAWA 1MTZA 2XBZA 5E5MB 5D8JL 2C4FT 4GAYB 2I2XB 3WL4A 3BMWA 3NJIA 4MXWH 3TYFA 1YYCA 4UDUA 3GI8L 5LCVA 1G84A 3ZGXA 1CIPA 3K2KA 1JR3E 5A5DA 3V5HB 3K0KA 4RMQA 4RCYA 4NBRA 3SN6N 4Y4HC 1P33A 1QBLL 3QOXA 4D42A 3O8XA 1N18A 4Z6AT 4KI5D 2BOBA 3OWRA 3VCLA 4BCXA 1UKBA 1XGQA 4D9LH 1WU8A 3NEEA 2G5RA 3C2SA 3GRUA 2OSVA 2P77A 2QYSA 1I7LA 1QZNA 5EQDA 4RJTA 3UTSE 3V4UH 4OUDB 3OU2A 2AKYA 2VUKA 1M6VB 3IMGA 4KKAC 1D5IL 1VPDA 2YMXL 3SMQA 4LYEA 1OHQA 3KLBA 2IIJA 3K32A 1Z6JT 4FE3A 4ELMF 2J7PA 1B41A 8ATCA 1H15B 1NBHA 3E4CA 2CVQA 3PA6A 3KCNA 5KOJA 4E5VA 1JR4A 2D4HA 4IXMA 4X00A 5DJYA 4DPMA 2QGBA 1REIA 3MRPA 4K71C 3RAJL 4QRAA 4JT8A 4JFSA 4DJJA 4WTZA 2XBDA 3FAXA 2P28B 3AJ9A 1AS2A 4JVOA 4LHZA 1SD2A 3SE4C 1JGDA 1JALA 1X13A 1Z36A 4GU5A 5I4BA 4OQXA 4OCRH 3M8KA 5JNUA 4PV8A 4B9KC 3QPQD 2O05A 4W7IA 5IB4A 4FQLL 3GRYA 3SIXA 2IWFA 4HAFA 3ETLA 3QLTA 4IJKA 4ALKA 3VCLB 4F57L 2A4EA 4DEYA 4ZYZA 4ZAXA 3LC0A 2JA1A 4EJ0A 4DSYA 3NESA 3L4KA 4JY4B 2HRLA 3I85A 3NGBB 3OE7D 4UOW1 2GWHA 4PJGF 1FFWA 2DLEA 2OMTA 2O20A 1U21A 2SEBA 3CC1A 3ETBJ 5D5MF 4CKCB 4OYYA 5IOPA 1FTSA 4ZRMA 2QN1A 4NE2A 3BA1A 3C5CA 3V4UL 4HAVA 5FV2A 1C8PA 2TSYB 3O0RL 2DL2A 4OFVA 3IO3A 3BKYH 1AHNA 4O4IF 1F4XL 3D7RA 1GKUB 4JZKA 1QRND 4RSGA 2ADFL 5IULC 3LEXB 1NW9B 2VLRD 3SDDC 5A0FA 2YAFA 3DVNB 3PHLA 3HYRA 3B20A 2RALA 4N24A 2V9CA 1WBBA 3L7BA 5C6WH 3IRCA 2P9JA 2CDGA 3RGWS 4YHYC 3AP1A 1CTNA 1J99A 2MCAA 1KLGB 3ABMB 3P4MB 3I0MA 1MV5A