3ILSA

The thioesterase domain from pksa
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
265
Chain Sequence
LKPYCRPSTSVVLQGLPMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCNEIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYEHCNSIGLFATQPGASPDGSTEPPSYLIPHFTAVVDVMLDYKLAPLHARRMPKVGIVWAADTVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSIISDLIDRVMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aflatoxin biosynthesis polyketide synthase
publication title Structure and function of an iterative polyketide synthase thioesterase domain catalyzing Claisen cyclization in aflatoxin biosynthesis.
pubmed doi rcsb
source organism Aspergillus parasiticus
molecule tags Hydrolase
total genus 84
structure length 265
sequence length 265
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilsA00
3QYJA 4KE6A 4RE5A 2H7XA 1ZD2P 3PF8A 1HDEA 2XT0A 5EI5A 1BS9A 5HQ3A 3HZOA 2HIHA 1MO2A 5C8VA 5FDFA 3UUEA 3KSRA 1ZD4A 1N5RA 1CQZA 5AKHA 1Z68A 1XZDA 4PQEA 5CH5A 3I2FA 3I2GA 3LCRA 1E8NA 3C5VA 3D7RA 1XRQA 1GKKA 4F60A 4WJLA 1YR2A 4JYMA 5K3FB 3R0VA 4OB8A 1CUCA 3V1NA 4M0MA 3H2IA 1IMJA 1XZEA 1CR6A 3PICA 2DFPA 2HA3A 4N8SA 1J2EA 3F96A 2PSEA 2WFLA 2OG1A 4BE9A 3DKRA 1WPXA 5ALEA 1RYYA 4WY8A 5H3HA 3ESDA 1IZ7A 3VDXA 5I8PA 5AH0A 1L7RA 1MAHA 4GBGA 5T4BA 4Y2QA 5J3JA 4PSCA 5CXUA 1TKRA 1LPMA 1E5TA 2ES4A 5JATA 1JU3A 3EF3A 1CVLA 4KE9A 5AO9A 5AKGA 5ALJA 3G02A 3ESCA 5AIAA 1WB6A 4JNCA 2UZ0A 3K9BA 1CUBA 1S8OA 5AOCA 2G4LA 1LPBB 2OPHA 4PV7A 2XQIA 1T4MA 4F21A 5K3AA 2WJ6A 5JARA 4HRYA 1XZKA 3V48A 1GPNA 1JU4A 1D07A 4MEBA 5JAOA 2XMCA 1AGYA 4Y2TA 1QTRA 3O4GA 3W06A 4HXGA 1GXSA 2PSDA 3KD2A 1CUZA 4ZGBA 2OCGA 2AJBA 5ALIA 4X92A 3GFFA 4U2BA 4MEAA 2HA5A 4X00A 4AN0A 3DOHA 2XLBA 1QJ4A 1CUJA 4BCBA 2VEOA 3I1IA 2ORYA 3O9VA 4CCWA 4IQ4A 3G9XA 5AI6A 3GZJA 3SC2A 5A7FA 5AM0A 3WZLA 5AICA 3ZLTA 4B9AA 1G5FA 5BOVA 1YS2X 3K2IA 4BYMA 2DR0A 4B82A 1UOQA 5HFAA 1QIJA 1XQYA 1ORVA 5AKZA 3ZLUA 1W52X 2C0QA 4BZZA 3ILSA 2HRQA 1UT6A 3AUKA 1J07A 4H35A 1WM1A 3STXA 4ZXFA 3LP5A 5E4YA 1DWQA 3LIIA 2WKWA 4TPKA 4C6HA 3C8DA 4DSZA 3VJMA 5HF8A 1WHSA 2JF0A 5JZSA 3BL8A 2QXTA 3H0CA 4HXEB 4KE7A 5AK5A 3AILA 5AI4A 4I4CA 2WIFA 4UHCA 4IH1A 4B0PA 4I3FA 3WJ1A 1EVQA 3B3QA 1UK6A 1CUAA 1CLEA 1R3DA 1PV1A 3I2KA 2PSFA 1CUXA 4G1FA 2QM0A 4W9RA 3DNMA 3DL7A 3LIPA 4AZ3A 4H18A 4IO0A 7YASA 2ZYRA 3WLAA 3DDUA 2GZRA 5LZ5A 5IVDA 4A5SA 1TQHA 3S8YA 1CUIA 3VISA 2PUHA 4BVKA 1UOPA 1E8MA 5LZ4A 4O08A 4Y9SA 2IITA 1YB6A 3HABA 3F97A 1ISPA 1YSCA 3WK4A 3I6YA 2GBIA 4OYYA 1SCQA 3U1TA 1ODCA 2H7YA 4GECA 4EY5A 4OSEA 5JANA 1PJAA 2YXPX 1KU6A 1EDDA 4PO3X 2QUAA 3WIOA 4G4JA 1TAHA 3WKCA 2CB9A 5AKYA 2QRUA 4LHEA 2XQJA 1CUUA 1CUVA 1HLGA 4UPDA 1QIHA 1G66A 1UKCA 4A23A 1OCEA 2AJCA 3M83A 4MQLA 4DNFA 5FPPA 4C4YA 4X94A 2C5GA 2BUAA 4FBLA 2B20A 5EHZA 4NZZA 5IVIA 3DQZA 5ALGA 3F8SA 1USWA 2XMRA 3H2KA 2J3DA 1DTEA 2XE4A 4RGYA 3FLEA 1UK8A 4GEGA 3WIBA 2OCKA 4J0HA 2CBGA 4MWTA 1R1DA 4FLFA 3L1HA 1GZ7A 2JGMA 2ZSHA 4OYLA 1CEXA 2I78A 1B41A 3BDVA 1ODTC 2WM2A 3CN9A 1FFCA 1MX9A 3WL6A 1EVEA 4BRZA 4CCYA 3E1GA 4AO7A 1CUSA 3JW8A 1AZWA 2H9YA 4HTAA 3W04A 3G9ZA 5ALNA 5EIHA 5AM4A 4DTCA 1QGED 1UK9A 3PI6A 2WIGA 3R41A 1CUYA 2JGEA 3D2AA 3PF9A 1ZGBA 3DEAA 4INZA 4GWLA 3BE8A 5LZ2A 1AURA 2WU3A 1XRPA 3RKSA 2XUIA 5CT6A 3Q8WA 1H2WA 4B6GA 6YASA 2EEPA 3H2GA 3O0DA 5CW2A 2VTVA 3G0CA 3QVMA 3NWOA 2PKYX 3BJRA 2HA4A 1JKMA 2E3JA 4QE3A 1WOMA 1T2NA 4QDXA 4XJVA 1NU6A 4H7JA 3STYA 1P0MA 5E4TA 1QLWA 2QJRA 1XZBA 3QMVA 5ALHA 1X2BA 3H2JA 3V9AA 4OB6A 2PL5A 4Q05A 1H23A 1MX1A 1QIGA 2WUDA 4BCDA 2FUKA 5EFZA 5JD5A 3L1IA 5DYTA 4PNZA 3DYVA 3M81A 4G9GA 1QONA 3QMWA 5YASA 5ALMA 1ZD5A 3FBWA 2Z8XA 2JEYA 3YASA 5HQ3B 1CIJA 1SC9A 4BVJA 2QJWA 5JAUA 2Z5GA 4OD0A 3R3ZA 4KAFA 4GW3A 5DWDA 3U0VA 5BWCA 3MVEA 2JBWA 5DYYA 3C6BA 2QZPA 2VJCA 1UKAA 3PUIA 2HU5A 2K2QB 2DQZA 3V1MA 1YB7A 4PF1A 3WKBA 1XKTA 4E11A 2GZSA 1QO9A 2WG1A 5K3DA 1AQLA 3D59A 2QS9A 3X3HA 1LZKA 4A16A 1N1MA 1DWPA 5LP1A 2OQVA 4N5HX 1XQXA 1ZD3A 1GQRA 1BROA 4GHWA 5CT5A 5AKLA 4E15A 5C8ZA 3EIOA 2CUTA 1R9MA 2XMQA 4CIAA 1P0PA 4DNQA 2ZYSA 1MNAA 1A8QA 3VVMA 2ECFA 4ZI5A 2O2GA 1H2YA 2QT9A 4G9EA 2AJDA 5SYMA 1ZIXA 1DQYA 1QFMA 4KRXA 3BIXA 2ONCA 3OG9A 2HA2A 2XMDA 4H7HA 5AK3A 3FNBA 1DINA 2I3ZA 2WIDA 1CUEA 1R88A 4XIIA 2PPLA 1Q84A 4NS4A 3FYUB 4LXHA 5ALTA 4L3WA 2VJDA 1AX9A 5DNUA 3F98A 5AI8A 1JMYA 3WL5A 2IX9A 3PDCA 3JYHA 3G0DA 5HKAA 1XROA 2BUBA 3GBSA 5ALZA 1GT6A 1O6FA 2BKLA 3H1AA 5ALLA 1U2EA 2WLSA 1UZAA 3QITA 3L1JA 1NX9A 2CKMA 2GBGA 4U2FA 4H7DA 1MJ5A 5ISMA 1CFJA 4FNMA 2JIDA 2O7RA 1E8DA 1UFOA 1A88A 2P8SA 5IH7A 3AZPA 4W1SA 1IUNA 4BZWA 2EDAA 4EY4A 3WK6A 1UKBA 4Y2RA 2JGJA 3CN7A 4Q1VA 3WYDA 4AQDA 4MJ3A 4ROTA 1AMNA 1ETHA 3FYUA 1VXRA 3G0BA 1UWCA 5DNWA 4DMHA 3STVA 1LBTA 3R3VA 4X90A 3OM8A 4DIUA 2O7VA 4AB1A 1CUHA 2D5LA 2ZJFA 1TCAA 3QPCA 4ETWA 3IUJA 4QWWA 3DKKA 2OCIA 4XVCA 3C45A 4HXFB 1XRLA 1DT3A 2ZJ7A 5CMLA 5FLKA 3D3NA 3H04A 3T52A 2PU7A 2Y1KA 5DTIA 3G0GA 1E66A 5EIAA 5HK8A 1EK2A 1RWQA 1CV2A 2Y6UA 1LZLA 4TGLA 4YPVA 1VLQA 2JGLA 3FLAA 4EUSA 4OPMA 4FLEA 3WMRA 1XRNA 5JASA 1BEZA 2BAGA 3I2IA 3ZPXA 5SYNA 4N8EA 2XUDA 3DYIA 1XQWA 4F0JA 4JEIA 3WWDA 3G9UA 3BDIA 2PVSA 3TJMA 4UHFA 2VJBA 2WIKA 5IKXA 4OUKX 4AZ0A 3HSSA 3WKEA 1YAHA 2AJLI 4Q82A 3ICVA 1MU0A 4KEAA 5IVKA 4EB0A 1E89A 1G4HA 5A7HA 3KWJA 4BVLA 3BF7A 2VT7A 3C6YA 4DNOA 3RK4A 1SCIA 4ZREA 2X8BA 4Y2UA 4EA6A 5LKRA 1VA4A 4AO6A 2VJAA 3ICWA 2C4HA 4CG3A 1F0PA 5AM5A 3JWEA 1XKLA 5LLSA 1VZ2A 2PBLA 1XRRA 3QH4A 4FLMA 1YASA 2I3DA 4MYDA 3M3DA 1EH5A 4P93A 2PM8A 2WJ3A 1QIFA 1FJ2A 3O4JA 3I2JA 1M33A 2GYWA 4AN1A 4L9AA 1XZGA 4BDSA 4OU5A 3IVMA 3IB3A 4QNNA 4EHBA 2OQIA 4C88A 3RM3A 3WA6A 1N5MA 5CTAA 4B81A 4K5QA 1MT3A 4DNPA 3IURA 2WIJA 5F4ZA 5A71A 4E46A 3C43A 4G8CA 2ZYIA 2B9VA 1F6WA 3QBJA 4AMYA 1UOOA 1DWOA 4MXDA 2ACEA 3SK0A 4Y2YA 4DMFA 5HZGA 2DCMA 2ZVDA 4BP8A 1K4YA 4W1RA 1P0QA 4E14A 2W6CX 1EDBA 1WB4A 2WHRA 4L72A 1THGA 4KAAA 1Q0RA 4G8BA 3BJMA 4MYSA 5JD4A 4KYVA 4ZV9A 3KWFA 5AKXA 1JT2A 2Z8ZA 4PW0A 5T4HA 1XRMA 4WFJA 4UBMA 1Q83A 2WHQA 4S0XA 4LIPD 3W05A 2WFZA 4HRXA 3ZV7A 2RI6A 3PFCA 5CT8A 2B4KA 3IUMA 1K63A 5A7GA 4DM7A 3QM1A 5FRDA 4CIBA 4HZGA 4XX1A 2OGTA 1NU8A 4QEKA 1KU0A 4PSUA 1F8UA 2ROQA 4JH0A 4UHEA 5HFNA 1XZMA 3B5EA 5FPQA 5KBYA 1QIEA 5DTJA 4X91A 4NMWA 4RE6A 1VE6A 3G9TA 4LYDA 4FMPA 3T4UA 5D7BA 3MUNA 1W4LA 2YYSA 2CJPA 1U4NA 5K5EA 3F9CA 5JIBA 4ARBA 4CFSA 1ZIYA 3HRHA 4GLBA 3QZUA 2YH2A 1GQSA 2BUCA 5AIBA 4F5ZA 2BGNA 5AKKA 4KJXA 3FYTA 2HADA 2HRRA 3MUOA 5JALA 4FKBA 1TRHA 2J3QA 2XQFA 3S2ZA 3D5EA 4FDMA 3CXUA 3DOIA 1TCCA 4X71A 1VXOA 1IUPA 1QIIA 4WDRA 4C89A 1QTIA 5LYYA 2GBCA 4LYEA 4W1QA 4JYPA 3C6ZA 3CCBA 4HS9A 1CUFA 4G5XA 1W1IA 2EDCA 4MWSA 3EQ8A 1XZFA 2ACKA 4FFWA 3WQHA 3FCYA 4CCYB 2JGFA 2C7BA 5EGNA 5CH8A 2CMFA 2WILA 2B61A 3EQ7A 2V96A 4Y2XA 4K6KA 5JYCA 2J4FA 2QOEA 3E4DA 5ALFA 2HU7A 3HLKA 4QDOA 4BTVA 2XUQA 1FFBA 1WPRA 2X76A 1TK3A 1Y7HA 4P08A 4M0FA 5HF5A 2WTNA 5D6OA 4J0IA 1L7QA 2HFKA 3DLTA 5E2IA 1BE0A 3DL4A 3TRDA 4BAUA 4B9EA 4U2CA 2GYUA 3UMJA 2QR5A 3WWCA 3GELA 2WG0A 2XLCA 4WY5A 3ZI7A 3IULA 1SCKA 2H1IA 1HQDA 3A6ZA 1CQWA 5CT9A 5DNVA 2QVBA 5ALRA 2V9ZA 4FWBA 2VSQA 1N8SA 2ZYHA 3A2NA 1R4ZA 1E3QA 4Y2VA 2WG2A 5T4FA 4X6YA 4BP9A 3LLCA 1QZ3A 1WCYA 4OU4A 3HXKA 2JEZA 2XQGA 5AKEA 3AZQA 3PFBA 4J0KA 4EBBA 4G4IA 2XDWA 4QLAA 4OB7A 1EHYA 2JGKA 3RLIA 4ZRDA 3D2CA 1EB8A 3OOSA 3I1YA 1SFRA 1GGVA 3WL7A 1MAAA 4H0CA 4ARAA 1JJBA 1ZICA 2RHTA 1AC5A 4K6GA 3QPAA 1MTZA 4IHAA 2RIPA 4N8DA 5BWBA 4C01A 3WKAA 5HK9A 4QDZA 3QPDA 3AZOA 3D0KA 1DU4A 5C8XA 2XUHA 5AOAA 2H7CA 2O2IA 1HKHA 4Q3OA 3BF8A 3HACA 2FX5A 4KR0A 3AJAA 2RGUA 3DJYA 1U8EA 2CEKA 2G5TA 5FOQA 1FFAA 2BFNA 5KWJA 1ZOIA 1O6GA 3Q0TA 1XZLA 4EZIA 3ANTA 5A62A 1W75A 1ZJ5A 3DS8A 5CH3A 1HPLA 2WQZA 4UBJA 5DLPA 1MX5A 1VZ3A 1QFSA 3M82A 2QTBA 4EY6A 4WFKA 4UBKA 2PU5A 1U65A 1H2ZA 4DYHA 5LZ9A 1LPAB 3EQ9A 2HU8A 3VKFA 3O4IA 4BATA 5I9IA 1ORWA 1IUOA 3C70A 4KE8A 1JJIA 5JAHA 2V97A 3V1KA 1XLVA 5AJHA 4LXIA 4ZV7A 3WZMA 4FHZA 5K3EA 4UFOA 2VQ6A 3K6KA 4QZVA 5FKJA 3WK5A 1LPSA 2XUJA 3W9UA 5C7YA 3NGMA 1QO7A 4FFVA 2OCLA 3OTQA 5DJ5A 3R3UA 2RAUA 1EXWA 1IVYA 1C7IA 3WKDA 4J0CA 4U2GA 3O95A 1JJFA 5CRIA 3EBLA 3FYUC 3KDAA 4QWMA 3A2LA 4WFIA 2WU4A 4UFNA 2C5FA 1HL7A 5AK4A 1MPXA 1XZIA 1I6WA 1CUDA 2I03A 2Y2UA 3PUHA 2OLEA 4TVKA 4U2DA 2GBFA 3DD5A 2XMGA 1G42A 4BE4A 5E4JA 2JGIA 4Q3KA 3QMMA 1B6GA 4G4GA 4H7KA 2QXUA 5DYWA 1ACLA 1Y37A 3WWOA 1P0IA 5ALPA 1LPNA 1CPYA 2HHAA 3STWA 4DGQA 1TIBA 3GROA 4OCZA 4UBNA 1YA4A 4D9JA 3R3XA 4YK7A 2WFLB 1CUWA 3ESAA 1EDEA 1EINA 2O2HA 1LLFA 3GUUA 4CG1A 2RHWA 4UFPA 1J1IA 1XZJA 3O9MA 3IUQA 3I2HA 4UHBA 3VVLA 2XMBA 1RP1A 1ODSA 1BN7A 3HJUA 1GKLA 1QOZA 1R9NA 4RPCA 4B7ZA 4GXNA 3AIMA 1VJ5A 5K3FA 2ZJ6A 5IVHA 3RARA 3H19A 4ZWNA 1BEEA 2VAVA 5JD6A 4UBLA 4CI9A 4FNGA 1ZI8A 1XQVA 3WWPA 3AIKA 3VJKA 4WDQA 1LGYA 3IUNA 4J7AA 2PX6A 5KREA 2XQKA 5K3CA 3F67A 5LZ8A 5EIEA 2HA0A 2FJPA 2XUAA 1UXOA 2C0PA 1K6EA 1EK1A 3FVRA 1H22A 3I28A 3HI4A 5T4EA 1W6RA 3C5WP 4M0EA 4QA9A 3ESBA 1THTA 2VAXA 2G63A 2Z3WA 2D0DA 1EI9A 3MGAA 3A70A 2J4CA 3C87A 2BJHA 2DHEA 3STTA 2OGSA 2XUOA 2WTMA 4IH9A 2ZSIA 3SX4A 5EHXA 4J0JA 1VE7A 5FV4A 3SWWA 5CXXA 4BC0A 3HEAA 1R50A 1ZJ4A 3ZWQA 3E0XA 2V98A 1BCSA 1FSSA 1WB5A 4Y2SA 3R40A 4BAGA 5ALOA 5AM1A 4X95A 1KEZA 1WHTA 4C4XA 3WA7A 4B83A 1A8UA 1BRTA 2BGRA 4Q3LA 3H18A 1LPOA 1ZI6A 4Y7DA 3FSGD 4X3CA 1MN6A 2XUFA 3OC0A 1LPPA 2DHDA 4J3JA 4LKOA 4AO8A 4QDTA 2CZQA 2GYVA 3FAKA 4MQMA 5AHXA 1C4XA 2QKYA 1EX9A 3V1LA 1XFDA 5ALXA 4DSAA 1QIMA 5AKIA 5AM3A 5C81A 4UBIA 3ED1A 4UBOA 4HAIA 5AP9A 2R11A 1A7UA 4FTWA 3GA7A 4BCCA 5BV7A 2HDWA 2C58A 1TCBA 3G0IA 4BTLA 5ALUA 3R3YA 2HL6A 5JZBA 5ALDA 3WK8A 1YAJA 3B12A 4UHDA 2VATA 2HFJA 1XZCA 1FFDA 3AIOA 2WHPB 1CRLA 2WUGA 3KOOA 3IA2A 2VA9A 1YS1X 4EY8A 4WCVA 2VT6A 3IIIA 3FCXA 5JADA 1ZI9A 3O4HA 4W1PA 4YX9A 2WFMA 5HCUA 1QIDA 4QDUA 1GPKA 4BC1A 1YCDA 3WWEA 3BXPA 1EB9A 5FUMA 2FJ0A 5AI5A 3LS2A 2QUBA 1VOTA 1VKHA 4X93A 3H1BA 2HM7A 3AFIA 2XMZA 4XWGA 5ALSA 3IDAA 4BRSA 3FWHA 3FLBA 1EA5A 2WUFA 1QE3A 4AXBA 4AMZA 4Q34A 5D3ZA 2WUEA 1DQZA 2XMSA 4H77A 1JMKC 1A8SA 1XZAA 1J06A 5EHQA 2Y6VA 1AUOA 5EHNA 1SOMA 3BIWA 1VA5A 2AXEA 5D3KA 4HVTA 3H17A 4C87A 4P92A 3IBTA 1XZHA 3G8YA 4W63A 3WK7A 4CG2A 4B85A 2R8BA 3CCCA 5AKJA 5AM2A 1JI3A 1AKNA 5AI0A 3TGLA 1LBSA 5CBKA 5LIPA 4UHHA 1OILA 2PSJA 3AINA 4LXGA 4NVRA 2G5PA 1K5PA 1XLUA 4KRYA 1HBJA 3D4LA 3HC7A 5LZ7A 1YA8A 1CUGA 4JUIA 4B0OA 1H2XA 2Q0XA 2PSHA 4ITVA 2BCEA 4AX4A 3W9BA 5AK6A 4J0DA 1DT5A 3BWXA 1XLWA 3OURA 4J0GA 4K6HA 4EY7A 1DX4A 3ZLVA 5ALYA 1MNQA 5FXMA 5HF9A 4Y2JA 1JFRA 1IZ8A 4BAZA 4BB0A 4N5IX 2VF2A 5ALWA 2XUKA 2XUGA 2AJ8A 4BBZA 1PFQA 3WYNA 5A6VA 4GI1A 2WHPA 4QLOA 4DMCA 3P2MA 4U2EA 2OXEA 2DQYA 1Q0ZA 1GPLA 4H7IA 4L0CA 4X6XA 4X85A 5CT4A 5HKBA 2YASA 4V2IA 2XB6A 2X5XA 4H7EA 5ALKA 4DMKA 4RNCA 2RONA 4B84A 4J03A 1ACJA 3WI7A 1Y7IA 3FSGA 2Y2VA 5AOBA 4I19A 4GDMA 1X70A 4DLNA 4BDTA 3WJ2A 5AI9A 5ESRA 3FVTA 3C6XA 2NW6A 3HYSA 4Y2PA 4UUQA 4G8DA 5HF6A 2W22A 4IH4A 1LNSA 3PE6A 3DCNA 3N0TA 2HA7A 2XUPA 1BU8A 3G7NA 1QIKA 2LIPA 3N2ZB 2OAGA 3D2BA 1BN6A 2DSNA 2XI4A 4B80A 3STUA 5A2GA 1K8QA 3I6ZA 4X6UA 4P9NA 4KAJA 3NUZA 3ANSA 3WK9A 1ZGCA 3TEJA 5ALQA 4H7FA 2HA6A 3KXPA 4K2AA 2DHCA 4KACA 3C8HA 1BCRA 5JAPA 2WSLA 3A2MA 2OAEA 2OGZA 3FOBA 4YASA 1UK7A 3VJLA 1L7AA 2QMQA 3I6MA 5FP0A 3VXKA 2IIVA 3WL8A 4PSDA 1FFEA 3W2TA 2PUJA 5I7UA 3E3AA 5K3BA 5JZ9A 1OXMA 1X2EA 4X7BA 2WJ4A 5ALVA 1F0NA 5KWIA 4C4ZA 3NOXA 1W76A 1C7JA 4FBMA 2Z3ZA 3R3WA 3UUFA 3OPMA 4FOLA 4Z49A 5CURA 4X97A 5LKAA 1DX6A 3H2HA
chains in the Genus database with same CATH superfamily
4JUCA 4OA8A 3AG6A 4F3CA 2H7XA 1S9HA 4AY6A 2PQ6A 1MAVA 2Z9BA 5AMXA 1SXJB 1HDEA 3VPAA 3JD0A 3VHXB 1J09A 2WP0A 4U7TB 4RHEA 3HVUA 1D6NA 1RCTE 1RBZA 1T6XA 2WMNB 1T9CA 3E9MA 4K81B 4MW1A 5LFAA 1WL8A 2HIHA 4XQCA 2IY7A 4JVLA 1GZHB 2GEJA 5MDHA 5HIIA 3A3PA 2WPNA 1PJZA 4MULA 3CUVA 2FP4A 4XPZA 4ZT6A 4CL3A 1BWQA 2I7TA 3HM2A 1X7DA 1HLFA 2V6BA 3CZRA 2AE2A 2BHNA 3A6HA 3JVEA 3Q7IA 3E8XA 3EHEA 2HPHA 3R8XA 2XA1A 1I0ZA 3KZVA 3IMGA 2VA8A 3PYLA 4HDSA 1C3EA 4LPKA 4PQEA 4EJ2A 1LTKA 3DZFA 1UWLA 3F49S 3RBAA 3U4AA 4NX2A 2JASA 5D1NA 1L9KA 2VK8A 2ZUUA 1X38A 1ZIPA 3AONB 4JEHA 3Q3CA 5F78A 2BGUA 3D7RA 1NMEA 4XIYA 1NI3A 1LSSA 2AFHA 2GKOA 1L5YA 3BT7A 4KK4A 1GKKA 1IFXA 1NBMA 2Q3CA 4JQOA 4RAOA 2EHJA 1KYQA 1NDQA 1Z6QA 2I2BA 3RVKA 3VC3A 4ARZA 4KQEA 1TQ2A 2DBRA 4HNTA 3G2QA 1LH0A 4JR2A 5EZQA 1BCRB 2Z2YA 4GP6A 1COZA 1VPEA 2YYAA 4KGVA 1CUCA 4Q7EA 3NIGB 4D4KA 5LIRA 3V1NA 4W9NA 1T9KA 2Y67A 4JX9A 3VJRA 1VBFA 3H2IA 1AKUA 4KGDA 1IMJA 1K97A 1VLMA 1CR6A 3PICA 3BMXA 2LKDA 2ISSD 4M89A 4KLCA 4NK5A 3QEBZ 1KHTA 3TH5A 2VH1A 2JKYA 4N8SA 3ST7A 4UTRA 3PFFA 3FBGA 2GAJA 3QXSA 2J6IA 2PH5A 5IAGA 4IGAA 3ZN2A 5SY6A 2IIPA 1CWUA 3DVAB 4P2GA 3NCHA 2F7SA 4GI7A 4EY3A 2ECKA 5IFKA 3DKRA 1OU0A 1WPXA 2P1RA 1Z15A 2PFGA 3KZ1E 4NCKA 1RYYA 1LNZA 1E0JA 1E5VA 5TY0A 4D3ZA 4QM6A 1DFGA 1PIWA 1G5HA 1QBGA 1TM5E 3CUTA 3GGCA 4JX8A 3DOFA 5CTJA 3IB6A 5JSZB 1MVNA 3OHSX 3MWFA 4G0OA 5LP6A 3I8XA 4PPQA 5CJJA 4OM8A 2Z09A 4AJ9A 1UMKA 4BQEA 2VNSA 3E9ZA 2VCYA 4CUJA 3BZUA 3HFRA 4GBGA 821PA 1Q22A 4S1WA 5SZIA 3N7TA 3O2JA 1K3FA 2YICA 4ZQHA 2IYFA 3H9UA 3UICA 5BRAA 3T94A 3I05A 1RQ7A 3LECA 2HYDA 1B76A 4CMJA 5JYEA 2ZTUA 4XEUA 1Y34E 3ODPA 1B43A 3ZDRA 5LPNA 3D2LA 1E5TA 4ZXPA 4OIMA 4ZCRA 3I39X 4WIAA 3ANNA 4EI2A 3SMVA 2HJGA 4QOFA 3EF3A 3NP9A 1WB6A 3UMSA 3K9BA 2C96A 4QXQA 1CUBA 1HE5A 1DEKA 1ZWLA 1F2UB 3QVKA 3QRWA 4LE0A 3RJ9A 2AR7A 3R9XB 3I5AA 1SD1A 4I8XA 1LPBB 1ENOA 1YOVA 3MWJA 2FG7C 3OOJA 4LG1A 1ZOPA 5TGDA 3X2SA 3PD0A 4PONA 4L75A 3VR5D 1XYVA 3Q9NA 2VSOA 3P9SA 4XJXA 3K1JA 1U0EA 1EFLA 2Q0QA 3T41A 3TZQA 4F21A 3OTOB 2PDAA 2WJ6A 2OXIA 2VTKA 1L5KA 2DUWA 4I55B 3T5CA 1MX3A 5A03A 1GYRA 2FLWA 5H59A 4COOA 2RMKA 3FWKA 4HQOA 3WGTA 2BJVA 4NCHA 3KQSA 1ZVVA 3KAPA 3RUAA 1BG6A 3TLBA 2GXUA 1U7HA 4DMLA 3LCJA 4JFAA 5FTJA 5CA0B 2V5VA 1Z17A 3TEMA 2NXCA 4WNYA 1LWNA 4Q7LA 3ZXXA 1ODLA 1ZC3A 1EWRA 4JL5A 3W06A 2WEKA 4CEJA 1QHHA 1W19A 2EP7A 2NSJA 2XNCA 2PSDA 2C7GA 1Z45A 5LQSA 3NTXA 1KJQA 2QM7A 3SHWA 1RHQA 3LQ2A 1SG0A 4X92A 3IBSA 4IX9A 2C78A 3A9RA 3GFFA 1IN5A 1COWA 4OFBA 6AT1A 1O95C 1EBFA 3N6VA 4HRAA 3DOHA 2IXAA 3UKJA 2ZSEA 2WJZB 4FMBB 1CUJA 4G37A 2L17A 2P2DA 5C18A 4NFLA 4F85A 5DXJA 1E2GA 1XF9A 2V65A 3K31A 3ZWYA 2QRLA 4NDZA 2JD0A 2ORED 3U39A 1T6NA 3VGJA 4IQ4A 1SWWA 3JSAA 2QZSA 3G9XA 5AI6A 4ZYVA 1G2PA 4FI3F 4MROA 3GZJA 4Y1RB 5FAXA 3THRA 5AM0A 4EY7A 1HFJA 2O54A 1RRKA 3GT3A 1GNTA 1U04A 3S6JA 4LZLA 3GEEA 2ZPAA 2QD1A 1XTTA 5D85A 2BBOA 4NXNB 1EUDB 4UM8B 1ML4A 2C1EA 5FBHA 3RSQA 3ZLTA 2ZKLA 3O73A 5IUKC 4B9AA 1G5FA 3BK1A 3NTQA 5BOVA 3LRPA 2AF3C 4UNRA 4B3IA 2IEIA 3BD8A 2QA5A 3F9RA 3JQ9C 4LGMA 2R8XA 4LXUA 4BYMA 4B82A 1UOQA 5HFAA 1Z73A 2JGAA 3H87A 9LDTA 1XQYA 2NUAA 5AVWA 2XKKA 3JQAD 1QP0A 3KB2A 1QZXA 3GN1A 1XTKA 2C0QA 3JV7A 1HZJA 1VECA 5J47A 2O1SA 2P1DA 3E9CA 4Q4JB 2ZAOA 5TX7A 2XPCA 2GEFA 4IFBA 5DM60 1ZRSA 1GPDG 2VJLA 3SFZA 4HWSA 4B4UA 2AUNA 4AAYA 1L6RA 3NHMA 2EARA 3NWBA 3Q2KA 1E0SA 4IMRA 3TI7A 1BJKA 3LP5A 1EFPA 1JG3A 4Q9NA 2O3JA 1UKZA 3M33A 3IUYA 3SJ7A 4E2XA 2LV8A 2E18A 4EPTA 3P94A 1SKUA 3MRTA 1DWQA 5ILGA 3DOCA 4JOQA 1I4EB 4FDUA 1EXDA 4TPKA 1XMOB 1PK8A 4EABA 2IUSA 3HLTA 3KOUA 1IN7A 3FKSA 3LC7O 4CMIA 2UUBB 4NBRA 1KJIA 5F5XA 4CTOA 4XD7D 3LFTA 1CY8A 1L5NA 3O8CA 1OIXA 1SOAA 5AVYA 5HBGA 1M54A 4YIKA 3ZKWB 5EIWA 1TTTA 4NBKA 1X9GA 2W37A 1JHYA 2I1WA 2UYQA 1SN7A 4KPGA 1GQQA 4H3SA 3DEYX 1E1KA 3Q0EA 5JV5A 4YP6A 4NNJA 2AI1A 3AMVA 4Y2HA 2MYUA 4R8MA 1G5TA 4EOGA 1BDBA 1DZIA 2CXTA 1BVRA 1CQJA 4EARA 1TVKB 1NHWA 3DFMA 4HOYA 3VV2A 4US2R 3VPFA 1HT3A 1KR2A 2VJQA 1WCV1 3EPPA 3SYMA 3ZHUA 1UK6A 2GPJA 2VDNB 4EKIA 3CU5A 5EIBD 3HBJA 2JCXA 4JLVA 5JEDA 1JBKA 3KOWA 3WX0A 3I2KA 1GEGA 2QGFA 5DK6A 1GT91 2J9XB 2DBZA 4JOBA 2B6NA 3MRVA 5FPYA 1VJTA 4IO0A 2PIAA 4XUDA 1KO1A 2ZYRA 3WLAA 3KYJB 7YASA 4Q9KA 1EWVA 2Q9BA 4P4TA 1TQHA 1GL3A 4G97A 221PA 3PXGA 5HYVA 3HXOA 4FU0A 2H1FA 3S8YA 1YE5A 1Z74A 1DC3A 4F45A 4RTMA 1DMSA 3WB1A 2GDJA 2ZZKA 3QHAA 4UNQA 3GZTB 2YWEA 2B3DA 3EXHA 3NDRA 2DFLA 3UOWA 1YZTA 4CMEC 1QNLA 4ZCIA 1X1CA 3TTUA 1V5WA 1WMBA 3Q6NA 2TSYB 3IXQA 4Y9SA 1M2OA 4I50F 4FGSA 2QP9X 2JZCA 3JQRA 3SNHA 1G1AA 2FX2A 3VPDA 1OVGA 1NQTA 2P91A 4FX2A 4QRIA 4EQZA 1EE1A 3ID6C 2MYTA 1ISPA 4EGCB 1YSCA 1CZKA 1SM4A 5DHUA 3DMDA 4K9LA 4RYLA 5BR7A 1BVUA 2GBIA 3M7IA 1P9NA 1LXCA 3W3AD 4WN9A 2JIPA 1SCQA 2WSYB 2QDXA 1ODCA 3RRFA 4CKCB 3P27A 4EY5A 1ONBA 1WZ2A 1K0FA 3KTOA 4LA4A 4O63O 4C3VA 2YXPX 3V8BA 2QSJA 3K9WA 3WIOA 4M60A 4QVKA 1Z26A 2FDXA 4G4JA 1QTNA 1YDHA 5GWXA 4YR9A 1J70A 2O1EA 4YJ2F 3NBQA 2QRUA 5AKYA 1OAOC 3A3KA 4LHEA 1ENYA 1W5FA 3SE0A 1ISRA 3P0IA 1Y9ZA 2ZBRA 1ISSA 1DKPA 1LBHA 3NI2A 4H0NA 1XD2B 5BVGB 1U63A 4DN6A 1TU0A 2PVCA 1E6WA 1QIHA 4KLAA 2XGMA 4CQJA 1N32B 1S1CA 4G0XA 1UKCA 4ADSG 5J59A 3UAYA 4BKPA 2AJCA 1U2SA 3CRQA 2G70A 1R15A 1N1EA 2CNOA 1U7UA 3OQIB 3Q98A 3HKBB 3EEBA 3TSZA 4UAJA 4FMCB 2X5KO 1G2OA 4FBLA 3P4UA 4OI1A 1O95A 2ZYGA 4U6NA 1A9ZA 1ZD8A 4HG2A 3UGTA 1RC8A 3LYAA 4HJXA 4JUFA 3EXFA 5JE8A 2G83A 5REQA 4EA7A 3HRKA 4JT4A 3F8SA 3H2KA 3RK0A 3BXXA 1QKKA 3B1KA 3R24A 4QYIB 1DTEA 3MWGA 3RFCA 3N76A 4ENTA 5HILA 3HUDA 3WIBA 1NJ8A 4YS6A 4E08A 4O8CA 2FV8A 2AHOA 1JXOA 4Q3BA 4X3OA 3O82A 1SCUB 2FQWA 2IYYA 3PP8A 3C1OA 2CBGA 5DW3A 5F3RA 2XDYA 5I7HA 3AFGA 2AWOA 1YRAA 4M9UA 2VHTA 1KAQA 1OH5A 1IYZA 1T8YA 2I3BA 3V3KA 3VH4A 4AWAA 1ZCZA 5DFAA 5JZMA 5AVQA 5L4SA 3HVKA 4UM9D 4D42A 3ENZA 4KB5A 1ABFA 1J25A 3N0VA 3VH3A 1PQYA 4FYWA 5SZJA 4QM7A 2C95A 5ECGC 4QOJA 4PICA 1TIKA 3CN9A 2P9BA 3WL6A 1J8QA 5ITVA 1PS0A 2JANA 3OETA 3C7TA 2J85A 2EZ8A 1L7MA 2YS7A 3BGWA 2Q99A 4AO7A 1JSCA 2X0IA 5FEUA 3E3MA 1KTIA 2BFFB 4ITUA 4NECA 5COQA 3L0SA 2J9YB 3SCZA 4Y1FA 3GGOA 4HTAA 3SDBA 3SR4A 4KPEC 2V1XA 4RHUA 1QFZA 5JFOA 4U6SA 3S40A 3PRKE 1T1SA 3N2NA 4HFNA 4C4OA 5CFLA 2Y92A 2DY0A 2NACA 3AKEA 3HBFA 3OFJA 5AM4A 1QGED 1N25A 5EIHA 4RTNA 1E32A 1KIAA 5FL7D 1P6UA 2R85A 3HXMA 2KS6A 5DN6A 2BHRA 3E82A 1U6IA 4I8IA 1IJFA 2REQA 2Q6LA 2UUPA 3LX5A 4FGJA 2FZCA 3D2AA 2XWQA 1V0JA 3NYQA 4YCBA 3DEAA 4GF5A 5CNIA 4J7CA 4J2TA 3B51X 2YJZA 2XYPA 4NCNA 3OY7A 1O94A 2CVFA 1N9ZA 3COPA 5LZ2A 1XO1A 1STOA 4D02A 1T8PA 1W5AA 2HMSA 2V7EA 3K7EA 3UWDA 3J80A 3QVGB 2PRZA 3GXBA 3HRIA 1PFKA 3LA6A 3WB9A 4MGZR 3WIEA 3WLOA 4BNVA 1A7AA 1DG1G 1B0PA 1V1MA 2IYLD 4HGYA 5B1DA 4ZI7F 2AN9A 1HLDA 4I5IA 4M0LA 3PYXA 2KPOA 4LXXA 5M7EA 1EUQA 3ZE9A 4E22A 4U0JA 3HA5A 1Z8NA 1GQFA 3PUZA 1YS4A 4Q24A 2QNRA 2C88A 3DE7X 3KEMA 3ELDA 3O1LA 5I7FA 4WXHA 3L4EA 1U8XX 3TZEA 4BVEA 2V7GA 2VTVA 3W1WA 3EH2A 3CZMA 1JZQA 2BRUA 2GHRA 3QPVA 4LK2A 2WIBA 4UOQA 4EAQA 4HAWA 4DV0B 3O3MB 2BFAA 1YDMA 3NWPA 3VHLB 1SA0A 1A27A 2E3JA 5SZKB 4R01A 4RK0A 1KGSA 3OVMA 4A8JA 1PGOA 2HO4A 5IUJC 6LDHA 1TA0A 1JA9A 3GUCA 1SC4A 4C4TA 2YTZA 3BH0A 3MEQA 4TRNA 2ZE7A 1C50A 4AURA 4OFXA 4B2IA 5JDIC 1P7YA 2VS1A 4JT2A 5TDHA 1DKOA 2A9QA 3O7MA 3KJIA 1GZSA 3C3PA 4I5FA 3STYA 2FF5A 4TTTS 5E4TA 1QLWA 4MIYA 3DAPA 2WU0A 1CRPA 3L6EA 2Q0HA 1KOJA 3QMVA 1X2BA 2AOXA 2VYVA 4LJSA 3LT5A 3RVNA 5KQPA 1J5PA 3L0IB 4QUAA 3C7KA 4RFSB 3DV9A 4DJ5X 3THSA 4RPKA 1FPMA 1GVHA 1NOKA 2PL5A 3OQPA 1E94E 3BG5A 2DBYA 2SCUB 4V0KA 4F7DA 4X8HA 1H23A 3G2NA 1OX4A 5JMWA 1JKJB 3FPGA 3KKMA 3WYGA 3GH3A 3IHTA 4IKOA 2DFKB 3B7WA 4I66A 4UARA 2UXDB 4L6CA 4ZARA 5TXGA 1ZP6A 2GCEA 4PNZA 5DYTA 3DYVA 4BO0A 2WJAA 2IQ5A 3I09A 1IPHA 2CB0A 3HA3A 1VKOA 2JG3A 1DTSA 3KHUA 2YXDA 3H11B 1SPBS 1MVOA 1T1EA 3IQWA 5EMJA 1E1NA 121PA 1K6MA 4JL8A 3CLHA 4H1UA 5KVAA 4CFZA 1RYZA 3FBWA 3QUSA 3I01A 4BBPA 4CMAA 2Z8XA 2JEYA 3KQVA 5HQ3B 1Y6QA 1EWTA 2QRVB 3NNDA 2GA8A 2OP0A 1ZQ1A 3OWHA 1J7KA 1H5NA 3CLKA 4OP1A 4WNIA 1SC9A 1ZOOA 4OD0A 5KNBD 4Q48A 3GBPA 4JMPA 3BHJA 2C4WA 1RRCA 5K6RA 4TKUA 1ZK4A 4G63A 3R3ZA 1TZCA 1H1LA 1L4UA 4GW3A 3WS7A 3O4RA 5BWCA 1O96A 1KXZA 2V0GA 3LVQE 3P0RA 1XK7A 1NASA 1DI0A 5GJWC 2JBWA 3A3OA 3C6BA 3PHBE 5B57C 1T2CA 2ZVQX 4L8FA 4PZPA 5DULA 1EQAA 1U94A 1UKAA 1K8ZB 4K2HA 1CRWG 4AIIA 4AUNA 1E18A 2NO1A 4ZMRA 5JNWA 2DTEA 3BXGA 4Z0PA 2PZBA 3WKBA 2FPSA 1DIHA 3BGDA 4KH0A 3O9ZA 1VJCA 3QLTA 3WRVA 3GNLA 3ZNPA 2OL4A 4ETMA 5CB4A 2GZSA 2QVGA 5IWCA 4CNQA 3L8GA 4R8KA 2QLFA 1DRWA 3O8DA 3WDMA 2Y4OA 1G98A 3D59A 3X3HA 3WV5A 5B4TA 2L69A 1PLKA 2GN1A 3ZJ5A 5D7NA 1NMQA 2NZYA 5K0CA 4CG0A 1A5TA 4G86A 3RVOA 3X2EA 2YIJA 3PUKA 3OZ7A 4Z4FA 4QHSA 3MGCA 1F6DA 5AR1A 4HNQA 1BX0A 3ME5A 1BROA 2A9RA 5BMVF 5IMSA 4M53A 1R0RE 3I9MA 1KFBB 4YI3A 4E15A 3CR3C 3M4XA 2HXGA 2ZYUX 1VE5A 2G9QA 3G1WA 4ZVPA 2Q3MA 3FAZA 3JZFA 3PSAA 4TQ9A 1Y8CA 2CUTA 1M6EX 5HPYB 2XMQA 4IJKA 1P0PA 2JLCA 4KO8A 2HIAA 4NV3A 5EJMA 4RHYA 4RJIA 3HM9A 5EC8A 3FYHA 1A8QA 4HX2A 4TKLA 3W5HA 1SQSA 2JFWA 4DR5B 1IAQA 2BSXA 4ZVQA 3TBFA 5BRJA 1T35A 3QEKA 2PA0A 3D8TA 3VMMA 4IQ8A 1LSOA 5KAPA 5AW4A 3TGPA 3LVRE 1JWAB 2QT9A 2ADOA 3NONA 1D2AA 1JJVA 2OILA 5CFRA 4JBNA 4WKNA 1HOTA 3A06A 1N9KA 4RKRA 5JH7B 5KJ1A 4Y98A 1T2FA 2IZ1A 2ZB4A 1SOWA 1BMDA 1ZIXA 2DWPA 4I1YA 1Z6ZA 3R3SA 1UUFA 3BIXA 2WWIA 1MQAA 4LWZA 1FC0A 2OZPA 4H60A 4H7PA 4YRPA 3TOSA 4H7HA 4EP1A 3BMOB 3T06B 3JS5A 3RHTA 3TCXB 1LDBA 3TNLA 3B7PA 3AL3A 1O9GA 2WIDA 2Y4NA 3EUEA 4NFHA 3LBNA 1V3TA 3LUFA 2WJPA 1T3SA 2YXNA 4FD2A 4WXEA 4EG0A 5BN1A 4RACA 5FR2A 3T9BA 1GDTA 1G8MA 3BWMA 5KHLB 3FSEA 4KXXA 3FTPA 1KKUA 3D7MA 4MWBA 1W30A 4Q4HB 5IF9A 1IZ0A 1K6IA 2G08A 2GETA 2FFAA 2R4UA 3IQFA 3PGLA 2W8BB 2XZDA 2ZRDA 4M9SA 5FOSA 4FZVA 4HYTA 5J5AA 2WWFA 2QN9A 8ATCA 4U7HA 3TLYA 5C1OA 2F90A 4JJ8A 1R6BX 2HMYB 2F17A 1OFTA 1KQOA 5ALTA 1E1QD 1E1LA 3QLEA 4L3WA 2DH5A 4JC8A 3HCDA 4O5AA 1F2TA 2F3TA 1LFDB 3MT7A 1HY3A 4QQKA 1L4EA 3RS8A 4JP5A 3X44A 3W5AA 2FUNB 2FR0A 1RRGA 3A4YA 2W2XA 4KN6A 3DHWC 1MA3A 2Q2QA 1WHSB 3V7FA 3MCWA 2AFIE 4GMXA 3W4JA 4RU1A 3ZZNA 1FB5A 4A73A 4DV6B 3PDCA 1NC3A 3JYHA 1QHYA 1ZUNA 2E5LB 3A7EA 1PSWA 5FNVF 1XROA 2BUBA 2B2XA 3QX7A 1SQFA 3U09A 1DQNA 3QF4B 1LS6A 1YS7A 3A37A 4NYIR 1FMJA 2GFHA 2OAQ1 3PNYA 2XHEA 3PIRA 4H6VA 1E2EA 3JYOA 2GPBA 3BSFA 4MR9B 5EE3A 4QTUB 5HIAA 1CNMA 3H84A 3Q12A 4HDCA 1N2CB 3AERB 4FYVA 1CF9A 1XCLA 3TSWA 3BERA 2NSLA 3AP1A 3IHWA 3DO8A 2D7JA 2R1VB 2VDQB 3JD1A 3CBGA 2ESRA 2C2MA 1U0SY 1N8KA 3LBYA 3OE7A 4GICA 1WOYA 4YRFA 5KOHB 3OEEA 5K0BA 1XHFA 3QITA 1E6KA 6REQB 3QYFA 4KQ2A 1XUOA 3CRW1 1TM2A 3OPYA 2Y0BA 2X0KA 4EENA 4RY8A 3RG2A 1MJ5A 4EJ0A 4LMBA 5ISMA 1MRSA 4HH4A 3F7OA 4FNMA 5AXDA 1RM0A 3MOSA 3ZIDA 2JIDA 3IEPA 1U9IC 4QJIA 1ZMRA 1EG2A 2AD1A 1E8DA 3TLMA 1WDWB 3E15A 5E9AA 2K2WA 4U7DA 1C5KA 4JXXA 2GCOB 1GO2A 2QDKA 5PNTA 3UJDA 2FWBA 2WJGA 4W1SA 2W2KA 1UC4B 2OZEA 4W5WA 4BZWA 1RWKA 1KYYA 4C1BA 1DMRA 2X5NA 2ZUBA 4M8SA 5GVRA 3TZKA 1YBHA 1PT6A 2FCRA 1WXXA 2LBPA 3C48A 1NJ5A 3R7WA 4IO1A 4N6NA 4A82A 4R71A 3OI7A 4UREA 2ACWA 1Z6GA 3IPCA 3W5UA 1RSZA 1EDOA 4PC1A 4Q1VA 4ENWA 3WGGA 1L7NA 2H3EA 4NIMA 5F64A 3ESQA 5FQOA 3G1TA 5KYWB 5M5BA 4R9UC 1V96A 4CM9A 2PKRA 2PYZA 3DO5A 4LJ6A 4CKBA 3U5TA 1X8KA 4ACAA 3QY0A 5AQEA 1W44A 1T8TA 2VQDA 2TS1A 4Q3NA 2EV9A 1PTKA 1ETHA 3G17A 5BWOA 1FX1A 1S02A 3IQEA 1M73E 4D46A 3AEXA 3QVOA 1P3Y1 5BQOA 4C0QC 1UWCA 3EC1A 4JOCA 3V9PA 2VDWA 2XJ4A 2ZT6A 4OQXA 4BFUA 1OXTA 4RIGA 3STVA 1LBTA 3BX1A 1E9FA 4WCFC 2BGKA 4X90A 3N39C 5THKA 3CVUA 3QBEA 4LXTA 1U7WA 1WY5A 3MINB 4WPGA 5TLSA 4GOMD 1E3WA 2H65A 5BV2P 1GAJA 3KFXA 1CUHA 2BMAA 2C84A 3HWX1 4KRGA 3HCOA 3VOAA 2ZJFA 2VP2A 1MOSA 3GK3A 2KLBA 3H65A 3QPCA 3M5PA 5BMVB 4GUAA 4AVYA 5HS6A 4CV0A 1XNRB 1EYZA 4IJ5A 3A04A 1KH3A 1U8CB 2RHGB 1CSEE 1KAHA 2WKSA 1M6VA 4LDAA 2CVOA 2DBVO 3W6UA 4E5NA 1RWBA 3C45A 4HDAA 5KOJA 5E6SA 2F1OA 1IPEA 2XTAA 4HAXA 3KUKA 3MGBA 2I2FA 5CMLA 4XE5A 1EWQA 3MXTA 4Q9DA 3ZDXB 2FMXA 3CW8X 5LOVA 4LF9B 2AZTA 3D3NA 3H04A 4JNKA 5AD1A 1GL7A 4MRSA 1J2TA 4ZKDA 3V4VB 1T8WA 5ICMA 1NRXA 4MV5A 4P3OA 1P1JA 1V2GA 2O1XA 2W70A 4Q6BA 4BV9A 5HUQA 4E5VA 3DBLB 1FYVA 3O4FA 1GFIA 5CYFA 1E66A 3ANYB 3OPQA 3PUYA 3WXBA 1D5CA 5HZHA 4KUGA 3U17A 2UZ3A 3A9WA 1A98A 2Y6UA 5CIYA 5IC6A 3CLTC 3H4VA 4TGLA 4S2UA 2H17A 4YPVA 3GCXA 4CKZA 5F2EA 1V11B 2AD5A 3KHSA 4BOYA 4CNBA 1D6MA 2AG0A 2BFOA 1NUTA 1ONPA 2OHGA 2IXDA 2DQSA 2AA3A 4GRDA 1O6CA 4AJ4A 3B2QA 1KP3A 4OPMA 4OQMA 2IP2A 1R6VA 4P86A 2FZEA 3WV4A 4RDXA 5K8CA 3ZXSA 4XQ9A 1NZJA 1HG0A 2BDEA 1AN0A 1ODKA 4YWHA 3RYFA 4F8EA 4MGYR 1QFYA 4C7XA 4YQEA 2VH2A 1DBQA 2HY7A 5KX5A 1PLJA 5KWEA 3DF7A 5M29A 3EB9A 1FTQA 2QPTA 1QORA 1CXZA 3I04A 1YE3A 4FWTA 5JQGA 1K4KA 2BAGA 4KDRA 4QNRA 4TWJA 3I2IA 5ILQA 1C0LA 1VB3A 5SYNA 3BHNA 4CLHA 3DYIA 5H70A 1XQWA 1LDYA 2YDXA 3EZNA 3AEQB 4MMZB 1E6EA 2ANBA 3SLKA 2RGGA 1JIXA 2QL7A 2XGSA 3KE8A 3UJAA 4K9RA 4XVHA 1RR6A 1SQ5A 3H97A 2F8SA 1UP7A 1UBEA 1XRJA 1KK0A 3CO0S 1D2NA 1XR3A 3OLXA 2A35A 4FP9A 4ZEWA 2ZZNA 2FUG6 2IYAA 4P4SA 5FD8A 2JFGA 5KJEA 5C4IA 4AJHA 3ZX5A 1FNDA 4JXJA 4F9GA 5JJCA 3ICVA 2CE7A 3PE4A 3BIJA 1QVRA 3RKRA 3OT4A 1RJGA 3A6DA 3L7IA 4R8LA 5TQ2B 1MU0A 1XEAA 4KEAA 2B8JA 5IVKA 1X7YA 4Q03A 3G8BA 3V1YA 3DT8A 3RC2A 4AKTA 1F3LA 1E89A 5HRAA 3ZBPA 4DMRA 3C98A 5IT9A 2AFHB 2OWDA 4BVLA 1R2QA 3BF7A 3TLGB 3EGDB 1OLSB 4JQCA 1A71A 3G6WA 1J97A 4F4FA 2NUBA 4FYMA 3B6JA 1J33A 3N2LA 5LQUA 2CFTA 1NL3A 3MGKA 5DGCA 1DQPA 1WVIA 2BTQA 4Y2UA 3GQBB 3ONNA 3Q6IA 4E03A 3FTFA 2GF9A 3LV8A 4X1KB 2I1QA 3MT0A 4DAEA 3K1ZA 2W42A 4TSRA 4ZAVA 5NLLA 4W5HA 1L5ZA 4Q4HA 3C5EA 1OD6A 1F0PA 5G53C 4WCFB 3SPXA 3AUJB 4LDPA 5ICFA 1A9SA 2V8OA 4LPSA 3NETA 4N5NA 2KE5A 1XEFA 1QMGA 4F5DA 1YASA 2I3DA 4W8GA 1XTBA 2LPMA 4Y6OA 2V4ZA 1QF6A 4ND6A 3CEMA 5KO2A 1Y3FE 2NU7A 8MHTA 4QPNA 2ODEA 4IHKA 1DXYA 3CG0A 4FILA 4LNUA 2PHZA 1Z4JA 2O5VA 2VP5A 3JVDA 4PFJA 5I4CA 1FRFS 1JFVA 2NVWA 4Z9YA 4BWVA 3IEMA 3MB8A 4F4HA 2W98A 2KBFA 3LBHA 1PYOA 2BP7B 2PM8A 2WJ3A 3L6DA 1QIFA 2I76A 3AHIA 2OGUA 4FE7A 4G3XA 1JG4A 3DAOA 4HFRA 4RF2A 5JWRA 1KVSA 2CJWB 3PC4A 4GPIB 1EBBA 1M33A 2IV3A 4BQRA 4PYKA 4CJXA 3ZR4B 2HSGA 2ALJA 1UJMA 2EFJA 3F6PA 4L9AA 2WF7A 3K2QA 3K5IA 1H6CA 4QX6A 4QNNA 5ELMA 3L7LA 3KU1A 3UGQA 3V1TC 4ZZ1A 1ZK2A 4CIYA 2AZXA 3EVNA 2JH8A 4BO9A 1X94A 1NUQA 4UCQA 4C88A 1VP3A 5A5DA 3VBEA 1N6IA 2OBFA 1DBIA 4JJKA 1RAGA 4B81A 1IY9A 3AY7A 4MWDA 3WMEA 3RVQA 3WDKA 3OQNA 3ZXYA 1MT3A 3ZZTA 1F8YA 4TLCA 1F9AA 3BFKA 4A03A 1JVSA 4DNPA 4I9FA 4J07A 1JEYB 4XIFA 1NI4A 3BM5A 5DHRA 4FM9A 2JKZA 4TTVA 1GSHA 1CIVA 4B3BA 3DXYA 1E79A 1VYVA 2AG5A 3DE1X 3ZHRA 1RWVA 1F6WA 5CDFE 4WK4B 2ZE6A 1UOOA 2CFSA 2NLOA 4MXDA 4ZGGA 5D87A 1HNWB 4V2UA 4NPHA 3SK0A 1Z2EA 3ELWA 2GMWA 1TEZA 1QO0A 1WW3A 4HQLA 5EIOA 2PLRA 2GLUA 1AJEA 2AQ8A 3S2YA 4CQNA 4MINA 3O8RA 2JLUA 2PS0A 1S3IA 2A7QA 4L4YA 3OTGA 2B0JA 1K4YA 4WNCA 4FD3A 4YJGA 1P0QA 1IJBA 1T2UA 2W6CX 2Z6QA 1EDBA 3M6IA 4P4GA 4RL6A 4M2LA 3ORSA 4L72A 5EN4A 2W2PA 5DCYA 1MOPA 3RBVA 1U3FA 1YDWA 3P0EA 4MKHA 4DUYB 4ZHSA 2CDCA 4FNAA 4KXLA 2IZZA 3BJMA 4YUXA 3GC6A 2V7VA 4E94A 2OCBA 3AH8A 5LOVF 2B82A 3A3YA 3D8NA 4AYXA 4EHFA 3UPDA 2D74A 2BELA 2Z8ZA 3QFSA 2Q7DA 2PL3A 5A6SA 1K88A 4CEJB 1T0JB 1Q83A 2F9MA 1U8TA 2G1AA 5IAOA 2VDLB 3AGQA 1NT2A 1TRKA 3DE5X 1QO0D 4PLFA 4DRXA 3PVZA 1CF4A 2HU2A 2VF5X 3R23A 4DR1B 3PC2A 1GCUA 2C42A 3VHXA 2PX8A 4HN2A 2RI6A 4BGUA 3QWIA 2DVMA 3JTEA 1EGQA 5ELLA 4KL8S 5FBVB 2EX0A 4QYXA 1IVNA 2UYHA 1ZL0A 4QAJA 2FK8A 4ZJZA 3UAOA 4PAOA 4MVJP 4DR2B 3N8DA 3V8QA 4CIDA 3SG0A 4DM7A 1Q92A 2VWPA 4MHOA 4HVCA 1MV8A 1YRBA 5CDTA 4Q93A 1RI2A 2SECE 5EMMA 3ON5A 3QM1A 3PXAA 4Z9FA 1VI2A 4PXAA 4ARVA 5EJIA 4CIBA 1ZNQO 4ZEVA 3USZA 3ASVA 4PTYA 4YRMA 1M1YA 1NW8A 1Z0SA 3PGA1 4PLCA 1PUIA 1VPVA 4KMSA 1VJGA 1U2RA 4BQNA 2JLWA 5E6RA 1GITA 3WGMA 1YJ8A 2WHYA 4BIIA 1SU7A 1KU0A 1N5IA 4LK3A 1JTEA 3D6VA 5FLYA 3IO5A 2AQIA 1RHUA 2RGCA 2LD4A 4M6WB 4MIOA 2QAIA 4PSUA 4YP9A 1KVQA 1AHIA 4YP5A 1S9DA 3Q7RA 5ULLA 1K98A 4MNTA 4ZOLB 2ROQA 2NU9A 3T0IA 7AT1A 2AMVA 5A02A 4HDKB 3LQRA 1VGVA 4UHEA 2EP5A 3B5EA 4EYEA 3PJRA 4NV1A 3W7AA 1RKBA 1KKMA 5IZ4A 4B3XA 3N3AC 4IUYA 1TW2A 2D2EA 3FMIA 2FCAA 2ZIEA 4RS3A 5D3MB 3ZIAD 4EECA 1BFDA 3EZ2A 3Q5EA 1IRIA 1G3MA 1UWKA 2C9YA 3WSTA 2REOA 3B20A 1HRDA 2BTQB 3CEPB 4LYDA 1OX4B 2HNKA 3H6GA 4M37A 3RT9A 4GXTA 3K0HA 4LCEA 2ID9A 2VJMA 3SJUA 3T4UA 3ZZ0A 3JQ9A 5K5EA 3DWIA 2E85A 3F5QA 4TRJA 5JRZA 2XBLA 1L5SA 3FPSA 1ZIYA 3JWPA 5BN5B 1TC1A 4GLBA 4LVNA 1PNVA 2PS9A 2IDJA 4KI0A 1AK2A 3VHRA 1SWVA 2CLEB 4NBNA 3HU2A 2QLNA 5T3YA 2W6ID 5AIBA 4EITA 2RFLA 5AKKA 3WDLA 1Y81A 1SA0B 4KJXA 4W99A 3UK1A 1W581 4YT4A 4P7KA 3HO8A 4NATA 4DE5A 1T9DA 2HADA 4RVFA 1OB5A 2YCLA 4EKGA 3QU4A 4MKFA 2QMUA 5IKMA 3KT3A 3D7KA 4BO7A 2YS6A 1SXQA 3U62A 2C9BA 3COVA 1GAXA 3NKFA 4FT4A 3AHGA 4V3BA 2R1VA 4R69A 4RZ3A 2XD9A 3RIYA 3WIDA 1VPTA 4A0QA 2IHNA 2CV0A 3OJFA 3R74A 3ASYA 1W5EA 4G0PA 2CNKA 3D5EA 1N2CA 1KJNA 1UKEA 3AERA 3GMIA 3W79A 5MN4A 1ICEA 4BWGA 5F2KA 2QD4A 4BNJA 1GD1O 4NU8X 5F1PA 3TFOA 3OOWA 5JPIA 1XJQA 3OIFA 4DA9A 4ODIA 1PJ2A 4L5JA 1VP9A 1RIIA 3VUFA 3DE0X 1VXOA 1IUPA 1N6OA 2QTLA 4EWLA 4FB5A 5JC8A 2JH9A 4WDRA 5EJ8A 4AI6A 1ZSNA 4HDNA 1H8HA 1HWYA 3FDFA 3PC3A 4EUNA 3KLMX 1J23A 2WF9A 1FYWA 1Z7WA 5FL3A 4GOKA 4FQ8A 4TTAA 4XLTA 5IBPA 2W2MA 4BLRA 5JFGA 5JCPA 1BJRE 3CCBA 4HS9A 1UJCA 2J7PD 4G5XA 3HCFA 2EDCA 4N6GA 3TL6A 1QRUA 3EXHC 3EQ8A 1XZFA 3FJYA 3QUAA 3PQ6A 4PGHA 1YQGA 2UAGA 1VJ1A 4FZ5A 2YWGA 5E8JA 4IV5A 3CTPA 3M9LA 4IMPA 4PLWA 3R6GA 1FOEB 3I4LA 1MRNA 4JU9A 1ZMTA 4EUEA 1SHJA 2PGDA 2REBA 1Z4QA 1GM5A 3LT2A 3ND9A 2GPTA 3MLAA 4N7RA 2BR4A 3V2HA 2CMFA 4RCYA 4B7AA 1RJDA 3BFPA 3OO0A 2QF7A 4WUTA 4CUKA 4GI3A 2DH6A 3RSGA 1NE2A 5KYUA 1F60A 3RPEA 3DSRA 2QOEA 3E4DA 1SXJC 1QDLB 1XE3A 2ZB8A 4NY1A 5EP3A 5AJWA 1W8DA 3CUWA 3WB0A 3HLKA 3S70A 1QM5A 1KDRA 3WVNA 4QDOA 1WF6A 2XUQA 5HJ5A 4LHZA 4ESVA 5F98A 3AFMA 4F4CA 3I76A 2PS1A 3REFA 4ALIA 4GDFA 3FPBA 1AUXA 1Q7CA 1T8UA 2JFFA 4PGFA 4X84A 2VUIB 4P08A 1ZVKA 1YA6A 4CYMA 3EBOA 4QVGA 5EJ7A 3CB4A 3LK6A 4AC9A 5D6OA 3GLFA 1F20A 2DLNA 2D7CA 2QTWB 2VNAA 1CZOA 3LKDA 1LVHA 4ZJUA 4KC0A 4CDRA 3NPAA 4IF4A 1IEQA 3DLTA 4HATA 4K9QA 4MJ7A 2AK3A 4L5AA 1IZYA 1F0KA 1BE0A 1QV9A 1WSAA 3DL4A 3KALA 4ML3A 3RABA 4C7BA 2B69A 2ACVA 3PNSA 4BAUA 5IXYA 4A0RA 1H0RA 1RLOA 3UOAB 4WW0A 2CFOA 2YFKA 3ICPA 2C2XA 3SHTA 2AOTA 5B1EA 2QTVB 1DC4A 3W5VA 1CF2O 1KEVA 2MHCA 2ZDGA 1EUCB 4BEVA 4L4RA 3DZDA 3E61A 3PD7A 4IGEA 5DI9A 5LSAA 3ZI7A 3LZ6A 5EJFA 1XT6A 4Q47A 1SRQA 3UCFA 4AMGA 3PEYA 3CRNA 1NN3A 4D8TA 5EWJA 1UINA 5BY2A 2P2NA 1T0BA 2OZLA 3WRYC 4KN5A 5E38A 3NAZA 1HQDA 2Z2IA 1HZZC 4LJ7A 4EMUA 4GVLA 3U9TA 5CT9A 1I94B 1B14A 4FWBA 2PCLA 2VSQA 3TW8A 2PGIA 3V3TA 2C94A 5EEHA 2ZSJA 2QAGC 3QV1A 1SG9A 4OKSA 4TT3D 4ZMSA 3MJDA 5J40A 4OXXA 4EMSA 4CL8A 2A0YA 3JAKA 2V7UA 4NDAA 1M66A 1Y3CE 1YI1A 1WAMA 3G89A 3LWBA 4YJKA 5CA0F 1PWHA 2AOTB 2H1VA 2BEVB 3VM6A 4UMVA 5L3QA 1E3QA 3OJOA 1XZPA 3EPJA 3K15A 1RQPA 3LLCA 2VUUA 5B6PA 3MJTA 1QZ3A 4LZJA 2CLDX 1WCYA 2YHAA 4FGWA 2HHHB 4M1SA 1FK8A 4CKYA 1E92A 1E2NA 3EG9A 1WXIA 3SBDA 4WKCA 3D81A 4RBNA 2IOHA 1ORHA 4YV0A 3ADBA 4LECA 4WAUA 4FX5A 5AKEA 1SVOA 3IO3A 1ML3A 3ZLBA 3TD9A 4C6TB 1YCHA 4J29A 3ELUA 5IKEA 1MQSA 2FPMA 3AV0B 3H0EA 2NG1A 5E4FA 1C9EA 3HO1A 4WH0A 4QLAA 4HEHA 2ZRFA 2A9VA 4KO1S 2BFWA 3IP3A 3THWB 4OB7A 4ALNA 3PRHA 1JHRA 2G40A 3M6FA 1S01A 4EYGA 4ZVOA 2QX8A 2LTAA 2Z6VA 4QG3A 3OOSA 1PL7A 3LZDA 1SFRA 1T3TA 3O38A 4CPDA 4GMDA 1YBVA 4ARAA 1ZN2A 2ZR0A 2CLIB 1N8NA 1YO6A 4QIHA 3R76A 2V3CC 3FOWA 1CZRA 3W9SA 2TECE 3QPAA 4GKKB 2EKPA 2RIPA 3ACDA 4IV8A 1DELA 4ZEOA 3T7JA 3Q4GA 5DF1A 4BE7B 4N3BA 1ZRNA 5K20A 1LKZA 1Y0BA 3LM8A 4QDZA 3VDQA 1PG5A 4BNUA 1E2QA 1UJ4A 1W1WA 2I6SA 2GAFA 3AZOA 3LF1A 4RMNA 1DU4A 3U3XA 1ZJZA 2WD8A 4LHVA 4OBWA 4NJOA 2IRWA 2QVYX 1Z7GA 3DFIA 2Q2OA 2R6ZA 4I2VA 2V5UA 5EXEA 2WF5A 2X86A 3H3FA 3ZXIA 4CM8B 2WWGA 2YHIB 3AESA 2HKIA 4IBOA 4RABA 4XARA 2IQIA 3HACA 4O33A 1TEXA 2FMKA 3DZCA 2CYCA 3B36A 4FJ1A 1LW6E 2IXTA 2HLDD 3G3EA 3NBKA 5FOQA 2I1LA 3HZRA 3H1TA 1USGA 4RGQA 2BFNA 1ZOIA 4MO2A 1N78A 4XRGA 4HSGA 1FYXA 3DNPA 4JHXA 4EYQA 3I73A 2O8EA 3V55A 1SU6A 4M22A 3FROA 1EZ1A 2FRVA 3K20A 4IJVA 4B3TB 2W6NA 3FW1A 2VYCA 3V2UA 4RPGA 2ZJAA 4Z0HO 1K8RA 1GNRA 1S89A 6ADHA 1OZHA 5CH3A 1U2TA 2G1UA 3ZHBA 3BMOA 3RRXA 4IIJF 4QULA 4JGBA 5IS2A 4YCMA 2JFXA 3UMYA 2H2IA 4RCVA 3EFHA 1KBZA 3QVVA 4WGFA 5DN6D 1PZFA 4EY6A 1HKUA 2Z9DA 2Z5VA 2JAHA 3MT9A 1N2XA 3UXYA 4JMLA 2ASVA 3B5IA 1AHNA 3BHMA 2BL4A 3GLUA 4R1OA 1P9RA 1P1HA 1PLLA 2BIFA 2Q5QA 2Y0CA 3G5AA 2E6KA 2BFEA 5HOEA 3CX6A 4I9NA 4YBRA 1LLCA 4IPTA 2XCIA 4R1LA 1CJUC 3PLNA 4GPTA 4EGSA 4WKOA 4EJFA 4J7UA 2JAXA 3JZMA 4G09A 4HYEA 3VSCA 2AQKA 1UMCA 2O1WA 4DYHA 2FPGB 1EK0A 1LPAB 3KIPA 3EQ9A 3Q1LA 2FG6C 2DGDA 4JBIA 3ZV5A 1NV8A 2YHSA 3O4IA 4YAWA 1BMTA 1G19A 4RKWA 3CPEA 5I9IA 1HF3A 4D8YA 4QQ8A 1IUOA 3C70A 3E2IA 4K26A 4Q19A 4DLXA 2KWIA 1UMDB 1ZU5A 4M7RA 5FOTA 4NMMA 2IOFA 2V97A 1PKXA 3OQMA 3H8SA 1JEDA 5KSWB 2XZOA 3DBLA 4OHFA 2QXYA 3RUPA 3A14A 3S2EA 2W6IA 3MTQA 4NICA 4D4LA 4LXIA 2XE7A 4LEIA 1DQSA 3BGOS 1V4VA 1AQJA 1QYWA 4FHZA 2BMDA 4RELA 3LQKA 3EOAI 2LXNA 3HDVA 1YRQA 3CE9A 2HGSA 1D0VA 1QZUA 1WPGA 2WWRA 4PPGA 3SS9X 2IYVA 2KW5A 2FG5A 2QD3A 2ZI3A 3KQWA 5WRFA 1OLOA 2IS2A 4ZQBA 2WNIA 4X62B 1N0WA 1ZM4A 2ZEJA 1Y4AE 3PA6A 3TMAA 2HV9A 4PG6A 5B53A 4AJNA 2CVHA 4P4NA 3CW2A 2OBBA 3CSUA 1SHUX 2XUJA 1GUBA 3A0RB 1YR7A 3G2MA 1OYOA 3LLMA 1W36D 1FQJA 3KJHA 4B3SB 1GARA 1PO7A 2QD2A 4FFVA 4HGNA 4BPRA 1ESMA 3KOXA 1EE2A 2CE2X 1ZHOA 5BNTA 4H16A 3RYIB 5GONB 1DP4A 1IWBB 1RHKA 1UZMA 2NT3A 3I9OA 3R3UA 3RYHA 3WLHA 2A0WA 3TR0A 2UYCA 1GAQA 2AL7A 3LC2O 1BH2A 3H1GA 1ZK0A 3TPZA 5I47A 4ZO8A 3EX7C 1Z8HA 2ZTHA 4DZZA 1T5LA 2V0CA 2KYRA 1AF4A 4LVUA 3N5KA 5FAKA 1C7IA 4ZTUB 3A1NA 1MKYA 4BKMA 4DW8A 1M6VB 3T5MA 5KUTA 3WKDA 3KSBC 1KDTA 3U4QA 1R6AA 4IIEA 4FFNA 1N34B 3NVDA 4JLPA 1QAMA 2NVBA 1BDHA 5F3DA 3QX8A 4BQPA 3PKIA 4WLNA 4DRXB 3AU8A 3EE6A 4UVHA 3KEQA 4U2GA 5EQDA 3HTXA 3P26A 5U4QA 4AMBA 5EJ2A 3L49A 2WINI 2EBWA 2BCJQ 3JR3A 3BAZA 4K05A 4CMCA 3AY3A 1UADA 2NSYA 3EBLA 3N05A 4QWMA 3GNSA 1D6JA 2V3WA 3ISVA 1MCZA 3K0AA 1H4SA 2GLTA 4FHFA 3ZHXA 4U7JA 2C5FA 3B82A 4FC7A 4GLLA 2ZRBA 4Q18A 1UT5A 3CYFA 3RHFA 3UHOA 2VYFA 3VR5H 3U19A 1HYEA 3AVVA 1IATA 4E0BA 1HA3A 1DO0A 4Q7KA 4F4UA 2Z43A 3E8SA 1JXAA 4TLBA 4FFBB 3O8OA 4DIMA 1JNXX 1FTSA 1QHFA 1T9HA 2YIMA 3MBIA 4FR0A 4GC9A 1SBCA 2OLEA 4OAOA 4PO9A 4TVKA 4U2DA 1NWCA 1G291 2XMGA 3QOYA 5G1OA 4N40A 2IYZA 3SKVA 4DZRA 4E2YA 1XCJA 1P44A 4LQ4A 2F6RA 3PHJA 1VFNA 4EI7A 1R5BA 1B6GA 2CXOA 1PJRA 4DV2B 3VOBA 4G4GA 3BXZA 2W6ZA 5DYWA 1ACLA 3LL7A 5M3BA 5JBIA 1VMKA 5ALPA 3QMPA 5TV2A 2FQQA 1TKCA 4R1PA 4HFMA 3STWA 3H83A 3K72B 4IDBA 4PZ9A 4N0PA 4RH0A 4XWYA 1PP4A 4URHA 4BFXA 2BMVA 3H0KA 1OI2A 2G7MC 5LM3A 2WA2A 3EWIA 1RS0A 4JI3B 5H9WA 4NCAA 3R5FA 2HF8A 1X3LA 1YONA 3IAS6 3KVRA 4UBNA 4IJMA 4D9JA 2CLHB 3NCTA 1JTFA 3AF4A 1J0XO 4RMHA 3W5BA 1V4NA 4YK7A 3U80A 1HDOA 3ZQKA 4S1NA 3KL4A 5B55A 2CJXA 2Q1XA 4YJHA 3S8MA 4GSKA 3UJPA 2O2HA 5DWVA 5K0FA 4YDSA 1FW8A 4IEIA 4AROA 1I24A 3OCUA 1R0LA 3TWOA 2RHWA 4XIGS 1YMVA 3DXXA 3GG9A 4OXKA 4NU6A 2PL9A 5FNVA 3JQ6A 3WLLA 4YR7A 1V6AA 1XZJA 4DIDA 3IUQA 3GFBA 2OZKA 3DF9A 3LH5A 3TQCA 1DAMA 3PQEA 2GI4A 2ZSAA 1PR4A 1ZMBA 4RSHA 3P97A 5K03A 2VOJA 1ZCJA 3L79A 3JQPA 4R8SA 3B1ZA 1QC5B 1GKLA 2W6JD 1GP2A 5CX1B 2O3QA 2NO4A 2VBGA 1QFJA 2A4KA 2C5LA 5G3YA 1OLXB 4OATA 5B58T 3OZSA 1JSRA 2ZJ6A 2QM8A 1WP4A 2F3UA 2FP4B 4A9AA 2JAPA 3HN2A 4KXYA 4A8HA 4BKQA 3HPQA 3GR6A 2ORVA 2VN8A 3DBOB 1Q0HA 2AIRA 2VAVA 1IHDA 4V0LA 3SR0A 4O3MA 3CEAA 4I81A 4OI4A 4RS4A 1KSJA 3TFWA 5I7VA 2OK7A 1G9TA 4FNGA 3BKXA 2D0OB 4DJAA 3ZGNA 1PYDA 1D7AA 5CLJA 9ATCA 3V4RA 2QK4A 1MEJA 1N7HA 3JALA 2P2LA 1P9LA 4HK4A 4Q7QA 2Y76A 3N7UA 3T4EA 3F4LA 1J1ZA 1N75A 4WDQA 4HLUA 1MC8A 2DU8A 5BUQA 3R75A 2CNLA 1SPXA 1TLLA 2HPZA 2V7BA 1QS0A 4PAQA 2TMKA 4BGDA 1ARZA 4QEDA 4BBJA 4KWCA 1WTAA 2GGSA 5FI0B 3MBKA 3P9KA 4FS3A 2QB5A 3BB1A 5EIEA 1PV4A 3KQTA 5HZMA 3QHQA 3DT9A 2HA0A 1ZCBA 2FJPA 3H2YA 5DX8A 3SN6A 1O94C 2X7HA 4EHAA 1R6UA 4ZHQB 1UXOA 4ETNA 3V8PA 3ZCTA 1K6EA 1E3SA 5KC8A 1ITZA 2FEKA 3EXG2 3IQXA 1Y1KE 5HE8A 2Z6UA 5LXTF 3RSHA 4I1UA 2R2GA 3OQVA 5G1PA 3PPXA 3THXA 3D54D 4HYQA 4CLDA 4FOTA 1HRKA 4WK2B 4YAFA 3WGZA 3BBPA 4A7PA 1W6RA 5H0IA 1QHSA 2NV6A 1DIBA 1RRPA 4M0EA 3BULA 2HB6A 1SG6A 2I6GA 3AJDA 4QA9A 4YCJA 3U7JA 3WBFA 2FW7A 4BWYA 1A4RA 1T4CB 2VAXA 1I0LA 1AN9A 2OM2A 3BB3A 2BOVA 2G63A 2R2AA 5DSXA 3S3TA 3TXYA 4H1WA 2GSDA 1WJGA 2B83A 2UYGA 3T7IA 2J4CA 4HQ0A 4WESA 2PXCA 3TAHA 2H51A 1T91A 3BJIC 2Y27A 3EZ9A 3HJGA 2Q8NA 2I7CA 3C87A 2J5QA 3ETHA 4HAZA 4OJYA 4RD2A 4NBSA 1QX3A 2ZBPA 4HN9A 4RW0A 2ODNA 3DZKA 4RHCA 5CM9C 5BSVA 3R5HA 2MCFA 2XUOA 3U7QA 1Z7BA 2ZSIA 5EIFA 1TZMA 5K6AC 1O87A 2B1JA 1U0BB 4EAAA 3KKPA 3L6CA 1UKVY 4ARCA 1VE7A 3SC6A 4RA9B 2DR3A 2FXIA 5B37A 2PT5A 4MUEA 5EE9A 2FF7A 5CXXA 4UM9B 1PJ4A 5DEOA 4BC0A 4Z7QB 3HEAA 1MHTA 1R50A 3IS3A 4WLVA 3ZWQA 3T7AA 4YRJA 3T61A 3C3MA 3VTFA 2GZ1A 1XCBA 2A58A 4CM7A 4JI7B 1BCSA 4C6RA 1DJMA 4FQ7A 4UXJA 3NHJA 3L7CA 2R5NA 2BEUA 4YLGA 1GPYA 1Z0JA 3VR5A 4PG5A 4BAGA 4LYYA 1I3CA 1NQ5A 1Z88A 1YBFA 3L7BA 1LI7A 1LTHR 5ALOA 5JSHA 4RY0A 4MSUA 2ZRKA 3PD1A 4RLSA 1JNYA 1HTBA 1SXGA 1NBMD 3INGA 1UWVA 2C8JA 2JW5A 4XFJA 1A8UA 3DHVA 4AECA 3E9EA 4BNHA 2F1RA 4Q3LA 4BB9A 1XCGB 3HNOA 1JAZA 3T5TA 3H18A 4EG5A 1M1XB 2ZRHA 1JB9A 1M0SA 1M72A 3H3JA 3RSSA 3H5TA 1SUDA 3KPJA 1WBJB 1XMJA 4LX8A 3H5AA 2XUFA 3OT1A 3T5BA 3TSYA 4KWHA 5C34B 3EXIB 4N0MA 2BHSA 3HDHA 3OC0A 1VRWA 2E4YA 4DBVO 5L3VA 4LKOA 1A1VA 3EUWA 3R9KA 4QDTA 1M8KA 1U81A 4F1KA 4MYCA 2HTFA 4TUYB 3LXUX 1YFZA 3THYB 2FE1A 1F7UA 3ECAA 4NFSA 4MQMA 5DU2A 3A6GA 3HDGA 3B6MA 2XYVA 4BGVA 1W4BA 1G3QA 3AI1A 5JU6A 4N76A 1GJRA 2YMLA 4M1TA 2QKYA 4ARSA 2JFHA 4PAGA 2FDRA 1EJ6A 3UK7A 1XFDA 2NZVG 3C7CB 4MDHA 5ERXA 4QYMA 3QXXA 1KEPA 2XGOA 3I9JA 5IZCC 3P7MA 4UBIA 3ED1A 4ZQIA 1U3GA 3HVJA 5KOYA 3E48A 1J5XA 4R51A 1XHLA 3LGAA 2FYTA 2BGTA 3NWEA 4AF8A 4BVFA 4KSBA 1OZ0A 1Q3TA 3G2JA 3IE1A 4HAIA 3VKVA 3PHHA 4F97A 1GPJA 5BV7A 2UVDA 1HE3A 3WNZA 4Q9JA 4TUYA 4F4JA 2ZS9A 5ALUA 1XP8A 1U5BB 3NTRA 2E4AA 1V37A 1Q77A 5L3SB 2C20A 3BEDA 3B12A 4YAOA 3ROZA 5IDWA 3E9NA 2GWHA 3SU8A 4NV0A 2GN8A 3DEFA 3GRCA 4OYHA 2ZXFA 4PFKA 3GPBA 1XL1A 3N2KA 1SXJD 1Q12A 1FJGB 1B3RA 3DFFA 1OWLA 2Z1DA 2G9NA 5KVVA 3PNOA 4KI7A 2NQ2C 1ZJYA 3RS3A 5K8IA 3WMWA 2DBQA 4DVGA 1AGNA 3FPKA 1NVFA 1PW7A 1RJEA 3LXRA 5BXQC 3QX3A 1QVVA 3OZGA 4OEHA 2X1HA 1KMCA 3WGOA 1ATZA 3GT7A 1TMOA 3G88A 5JADA 1ZI9A 2FRXA 3O4HA 4JB0A 1BYUA 4XWOA 1P7ZA 5HCUA 4OQZA 3FNRA 4DA6A 3RADC 3KV1A 4QDUA 1OVMA 3MW8A 3ASZA 3EYWA 1OXUA 3C5HA 3AXSA 1VLLA 2WYVA 3PSHA 3SQWA 1JUDA 1JR2A 1MIHA 3FTDA 4NENB 4RLQA 5AI5A 5ITWA 1U11A 3IE2A 4K0RA 3TINA 3WGVA 2L0XA 1PJQA 4PEVA 2C92A 3W8FA 3FFWA 4IMIB 4M8IA 3WSWA 1NT4A 2RK6A 4RMGA 4AJ1A 3E2MA 4D3YA 5L95A 2Q07A 2X2EA 4TVOA 1L7XA 4OQQA 4C08A 1CD5A 3AFIA 1VSQA 1QQBA 1M2NA 1QF9A 2IYOA 4XWGA 4GE3A 4MVXA 3F4BA 3FLBA 1N7IA 3I5XA 2J9GA 4MEJA 2I87A 1CEYA 1M9NA 4N18A 5FWYA 2H1RA 4AP9A 1ESEA 1URPA 1LRKA 4BLUA 2XMSA 3RRYA 4U8HA 5EE0A 1Q19A 1Z08A 1KBOA 2R79A 1LQ2A 2V7QD 2RG1A 2I6FA 4HO1X 2XITA 1GG8A 4IHQA 4XTCS 4DYDA 2F8TA 2O59A 1J06A 5EHQA 2Y6VA 3CGWA 4BMOB 4FMCF 1CBUA 2N0SA 2AN1A 4ZZ3A 2VXBA 1XYYA 3KZOA 3BIWA 1RACA 2AXEA 2AX3A 3AR5A 2J1LA 2FAXA 2H4YA 4HVTA 5D3KA 5BNIA 1KRHA 4C87A 1E5QA 1JU9A 1MENA 3CA8A 1JH9A 4N5MA 3QNMA 3QVJA 4I99A 5J2TF 3WK7A 4CG2A 4DGSA 1XPJA 2R8BA 1B93A 4FONA 3CCCA 4PE5B 4KOEC 3RVRA 1LK5A 4EGJA 3K6SA 1I3OA 3UWSA 3CLRD 5AM2A 2C4KA 3CINA 1JI3A 1AKNA 3V4OA 1E1DA 3MELA 3NHZA 4B73A 1LBSA 3ZHVA 1GRVA 5CBKA 2J48A 4TV8F 4N47A 1MRZA 3EXFB 5HWSA 5LIPA 2ZETA 1UBNA 2O14A 1P0FA 4KQXA 1EXNA 4P3PA 1JBEA 4CLEA 1OILA 2GX6A 2WSIA 1IXRC 3CNEA 4MVJA 3LTNC 3KQUA 3G0HA 2A88A 2PSJA 3AINA 3B1YA 4UQLA 4B44A 3URMA 1IXSB 5CU7A 1E9CA 4Y6LA 5HIJA 3GLGA 3ZVKA 1PNOA 1QRDA 1FDUA 3EGWA 3RUFA 4C6TA 1B3BA 4B2YA 4K6OA 1A4UA 1DBWA 2IZ6A 3IOMA 3T38A 1JJAA 4DDWA 4KREA 1RYFA 1K5PA 2YZ7A 4KRYA 4O4HA 3HKEB 2JFPA 2GAOA 3ZJUA 4GOOD 1MH1A 5LZ7A 5IHPA 1TO6A 3DTTA 4DCSA 2AQHA 3SJZA 3D3EA 1D2GA 4EVRA 3TBKA 1UEIA 1BDMA 4XQEA 3BFVA 3PFWO 3U3JA 1BQ4A 4PX9A 2BKAA 3P0JA 1T6ZA 3G2PA 5UKDA 3T7DA 3KSAC 3KQLA 4NI5A 3F2VA 1WLSA 3UB2A 4UTPA 4OFWA 4B0OA 4B47A 5I6DA 1TAGA 2PSHA 1P2UA 4ITVA 3SF8B 2PUFA 4GQIA 1TGVA 4OHBA 1KK2A 4ZVKA 1RVV1 3RTCA 2D5IA 2BC9A 1X86B 3CUEF 1C1DB 1WULS 2E82A 3INRA 4W9NC 3BGIA 5B7PA 1GLVA 1BX3A 2VG8A 3JWHA 4IXTA 2IU4A 4YRAA 2J30A 4LF8B 5FXMA 5HF9A 3RIXA 2C54A 1H69A 2XSZD 4Y2JA 5CLHA 3UKOA 3LP8A 1JFRA 4PLZA 3U7RA 1M0WA 1DHRA 4AS3A 2DAPA 1ESZA 4I1OA 3NTVA 5ENZA 3E3NA 1G6OA 3KK0A 1N3IA 3OO1A 1M34A 2A0XA 4NMLA 3ZE0B 4AG5A 4DLWA 3FRHA 3QXHA 3T3IA 1T5HX 3MQ2A 3SZOA 3ZQUA 5BWLA 4ISBA 2VH5R 3ZWMA 3PR2B 5L3ZA 1D03A 1DUSA 1KVUA 1TD1A 4WWHA 4BBZA 1QH8A 1PWEA 3MCUA 3P4YA 2F9FA 1L4YA 2Q50A 2EBUA 4QLOA 4JYZA 3QE9Y 1HG1A 1ORIA 2A67A 3P2MA 4YYEA 1J6UA 2JCSA 2FSUA 4X1IA 1XPOA 1I3MA 4N7JA 4AJ2A 3C4JA 3TIXB 2AN3A 2HBYA 5TPZA 1NP7A 1R8SA 2RGNA 4RQTA 5E7MA 1HSZA 3URKA 4H7IA 1D8TA 3E5MA 1FMTA 4JU8A 4L0CA 1F4PA 3CZQA 3JPYA 1NNI1 1ULSA 4TS4A 4X6XA 5LCXA 4B40A 2VYQA 2VC2B 3ANLA 1L5VA 5BT8A 2YJ3A 4L76A 5KB3A 1ZJWA 1TL7C 2ICAA 3NRJA 1H2AS 2RCNA 2OEPA 3R5TA 5LB2A 2XB6A 4NH4A 3GWZA 4WXPA 4G2NA 3D6FA 3PFKA 5ALKA 4J0FA 2DTDA 3D3WB 5LMUB 2BGGA 4J1TC 2IGTA 1HTTA 4AZ3B 1CJKC 2CJFA 5NULA 5TT0A 2WICA 1Q91A 3B9QA 4RNCA 2JH3A 3C3CA 2GFIA 1JZSA 1YJ5A 1EA7A 2RONA 4D26A 4B84A 1ACJA 2ZKIA 4WASA 2O3RA 4C5CA 1D0IA 1HFKA 2FEXA 4V39A 5ANRB 5ADHA 2O8BA 1Y7IA 1GV1A 1LVGA 2XCSB 5LU9A 1N3YA 3GLHB 3N70A 2QIPA 4I19A 2CXPA 3FFAA 1ZX1A 3NEPX 4R9VA 3ZKWA 4BRWA 3OPVA 2N47A 3KS9A 3WZ2A 1NQXA 1CQJB 5E95A 2KQUA 1MG0A 1NFQA 2OCPA 1JRLA 1KZGB 1BHJA 3EN0A 4Y0VA 1I1HA 4DLPA 3OY2A 3B38A 5ESRA 3FVTA 1IK6A 3C6XA 1SCAA 4L0MA 1O08A 4NJMA 1NLUA 3RW9A 3HYSA 4DEYA 5ICGA 3VNSA 1D1SA 3C8MA 3IAHA 4KGZA 1Q95A 2VDOB 2RHJA 1XTQA 3AVQA 4UUQA 3FYSA 4A0GA 5GVSA 2OUIA 1W73A 3DCNA 3N0TA 2HA7A 2I22A 1F4VA 2ZBEA 4I1IA 5E1BA 3PC8A 1A9YA 1UXJA 1KO8A 5TQ0A 3FUUA 2P2GA 1NLZA 4OQDA 1FP6A