3ILYA

Apo crystal structure of protein tyrosine phosphatase from entamoeba histolytica featuring a disordered active site
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
142
Chain Sequence
SMKLLFVRSPAAEAVMKKVIQNHHLTEKYICDSAGQADSRMRKVGKSRGYQVDSISRPVVSSDFKNFDYIFAMDNDNYYELLDRCPEQYKQKIFKMVDFCTTIKTTEVPDPYGEKGFHRVIDILEDACENLIIKLEEGKLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tyrosine phosphatase, putative
publication title Crystal structure and putative substrate identification for the Entamoeba histolytica low molecular weight tyrosine phosphatase.
pubmed doi rcsb
source organism Entamoeba histolytica hm-1:imss
molecule tags Hydrolase
total genus 51
structure length 142
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ilyA00
2LPMA 2P9HA 5FWXA 5BRAA 4FE4A 2CWDA 2FLKA 3ILHA 3KHTA 2CHEA 3LTEA 4NCBA 3HS3A 5CNMA 1EWTA 2P4UA 1QNLA 2JBAA 3Q41A 3GRCA 3LKVA 3MF4A 3VNAA 1TVMA 1NXSA 5JS1A 4WXEA 1LBIA 2MYNA 4YV7A 2ID7A 4MS1A 4IGAA 1MAVA 4FB4A 4G0YA 2FEWB 4MPTA 4NCAA 1YIOA 1W9HA 1KGSA 3QELB 1LJLA 4JOQA 1BDJA 1BDHA 1EWKA 1PNRA 3HDGA 5DKFA 3BRSA 3SQNA 5JNUA 3C6QA 3QX8A 2V0NA 5PNTA 3GWGA 2MYUA 3JPYA 2JBAB 2R47A 1GLGA 5JNSA 1KMIY 4PZ0A 1TLFA 5CNKA 1YS7A 3H6GA 2RGYA 4L4UA 3IP7A 1NY5A 1PHRA 2MYPA 3RVMA 3K9CA 1APBA 1H9CA 3I45A 2MSWA 2WWVD 3H1FA 4H60A 5HKOA 5IUJC 2FSPA 4KRFA 5KQLA 4P98A 5IEJA 3QEKA 2FQWA 3DZDA 3MM4A 3N75A 3KKEA 1LK0A 1YVUA 2JCGA 2ZWMA 3A3KA 4RKQA 2A9RA 3KLOA 4MGEA 4QPJC 2IKSA 4MQFA 4RU1A 5FBKA 5FWYA 2NT3A 1P2FA 4TMYA 4L85A 1EFAA 1QP7A 3RVPA 4OATA 1ISRA 4HYEA 4ZMSA 3ROFA 3FFWA 5EWMA 2WMYA 5I4CA 1DC7A 3CNBA 2QVCA 4RY0A 2NT4A 4TLLB 1Y1LA 5TQ0A 4WXMA 5JNWA 4Z4EA 3SG0A 4EYQA 2PE5A 1CEYA 3CKMA 4LE1A 3OQOA 4GPAA 4MRMB 1DZ3A 3KLNA 1RZRD 3CLKA 3FMVA 1C0EA 3RVNA 3RVKA 2MSLA 3DLHA 2WB4A 4GNRA 4Z9BA 1FQWA 4W5OA 1U0SY 2DRIA 3H5LA 4XLTA 8ABPA 1MB3A 4F8JA 1BAPA 4IILA 3KCNA 1OXBB 3JTEA 3JVDA 1D2AA 3GA5A 1JDPA 1T34A 1XWWA 1EAYA 3HXMA 3RVLA 1YK1A 1R8JA 4MLDA 1USIA 3KYJB 1QMPA 4WT7A 1JL3A 2PUGA 3EJWA 5TQ2B 2Q5CA 5IUKC 3M9WA 1P6UA 2GWRA 1Z12A 2PUBA 4EUKA 2ID9A 4PYRA 1DC8A 4RY8A 3OQMA 2VYCA 2HQRA 4YP9A 1ZDMA 4JB2A 3FDFA 1YTUA 4O1IA 2RDMA 3E3MA 3NNNA 2FN8A 3SNKA 2PAFA 1U2QA 3MQ4A 5JNRA 2IPNA 4G0PA 4IMJB 4XAQA 5KWSA 2A9OA 3OMXA 2VK2A 4XARA 3O21A 3OM1A 3A0RB 3LUGA 4N0QA 3C97A 3QLVC 3LKBA 4FE7A 4RK6A 2PUDA 3LUFA 4MAAA 4KVFA 1VKRA 3RVOA 4CBVA 1L5ZA 2IPLA 5KQMA 5HSGA 3GBVA 2OENG 1B00A 1E6MA 2KYRA 1DCKA 3OLWA 1YMVA 1QP4A 1ZN2A 2MYTA 6ABPA 4KREA 3OLVA 1BA2A 3HUUA 4DADA 5T3YA 4F3TA 4HNRA 5JS2A 3SM9A 1ISSA 1Z16A 2IYNA 2PUAA 1FSPA 3N8IA 4KK4A 4NQRA 4RXTA 3UK0A 2M98A 4F12A 5DCLA 2PLNA 4O1HA 1QP0A 3HVRA 4G97A 1GUBA 4RDCA 5DLEA 3TD9A 5BR1A 1PEYA 5ABPA 3LMKA 3UKJA 4LDAA 2JB9A 3H5WA 3IP5A 3R0JA 4RK5A 1MVOA 1QO0D 2A9QA 2L18A 4W5QA 2RJOA 4RXUA 1JX6A 1URPA 5TPZA 2WY2D 3Q7TA 3W9SA 2OQRA 2QW1A 2GI4A 4ZYLA 3QLUA 2GKGA 3C3KA 5IC5A 1M5UA 1SRRA 1J56A 3OLZA 1DJMA 1DCFA 1L5YA 2PKXA 5ED4A 4S05A 5C5EA 2WJWA 4EVRA 3DGFC 3O1HB 3G1WA 2E4YA 3O75A 3CFYA 4G0OA 2E4XA 3IPAA 3N0WA 3N0XA 4NICA 5TE9A 4MR8A 2PUCA 1SXGA 3MIZA 3NNSA 2GBPA 4TN5A 1ZVVA 1Z17A 1P6QA 1A04A 1JHZA 1A2OA 2JK1A 4M88A 2X7XA 2PL9A 2YHAA 1A0OA 2QV0A 1PEAA 4WZZA 3IP9A 3T6KA 1QQBA 2FVYA 3OO0A 3QK7A 5TQ2A 2AYZA 1DP4A 2GX6A 3DBIA 2R25B 3BBLA 3H5OA 5FBHA 4MYRA 2IDMA 4EYGA 4F11A 1DBPA 1DCMA 4UHKA 3IP6A 3H5IA 3N6VA 5BQ3A 1JFSA 1E6LA 5CHYA 2NUBA 4RXMA 3I42A 1YS6A 3KG2A 3Q9SA 3S99A 1JF8A 3KJXA 4Z4IA 2J48A 3LOPA 3BREA 5F64A 3QELA 3QLVA 5JNVA 3O2QB 3NHMA 1FFWA 3EQ2A 4MQFB 4RV5A 4RS3A 4YR7A 3FFTA 1BDIA 4ZPJA 1ZGZA 4EYKA 1MB0A 4E7PA 3TB6A 3F6CA 1ZH4A 5EWMB 3EAFA 4KQCA 3Q7RA 5IULC 5HQJA 1DRKA 4HNSA 1E2BA 1XHEA 2B4AA 2PUEA 2FMHA 1QKKA 4YS6A 5DTEA 4MR7B 3HUTA 4RSMA 3URMA 2YHBA 4N76A 1K66A 4ML3A 2LIVA 4LX8A 1GUDA 2HJ9A 2PJUA 4EYOA 1FFGA 2PL1A 5JNTA 2CD7A 3H6HA 2QXYA 2I6FA 3TX6A 2F8TA 4ETIA 3RH0A 2NZUG 5GQSA 2LBPA 4MQEB 1XHFA 3OM0A 4MR7A 3VNBA 3FGZA 1E6KA 1VLZA 3MA0A 1DRJA 3QX9A 5TPWA 3HSYA 1DBWA 2FMIA 1JLKA 3BRQA 4Z4CA 2E4WA 3H1GA 3QLUC 5IBQA 1P8AA 5D2CA 3O2SB 2FQYA 3HDVA 2FEPA 4H3HB 1LBHA 4O5AA 5CNIA 5TQ0B 4N41A 4IMIB 1Z26A 4N47A 4Q6BA 4HNQA 4MQEA 2FMFA 3CG0A 4JB0A 2O20A 5TPZD 1ZY2A 2H3HA 3OQNA 2FN9A 3GT7A 3C3MA 4YRZA 4G0MA 1NXTA 1NXXA 3LFTA 3LUCA 2PUFA 2PMCA 3HK2A 4N03A 5IUNC 2IPAB 4WUTA 4Z4HA 5BRJA 1TJYA 4MR8B 3HEBA 5IX8A 4LDZA 4KK3A 1F4VA 3OMWA 4S04A 2XDYA 3EODA 2RJNA 3NBMA 1TM2A 1YMUA 4KMRA 1EHCA 3CZCA 3F6PA 4G86A 4Z0NA 4DN6A 1BVHA 4KQ9A 1ABEA 2R4QA 3O1IC 4F06A 3KS9A 2QZJA 3LUJA 3QLTA 2ZAYA 3CU5A 2HPHA 5CNJA 4OLBA 4EGSA 2E4VA 3CHYA 4E7OA 3N0RA 3OO1A 3P9YA 3QEMB 1U8TA 2B1JA 4PE5B 1FFSA 1GCAA 3GL9A 3HJFA 5GOTA 3DLBA 5E3JA 3M9XA 2VUIB 2WRZA 1ZITA 4Q6WA 1PNTA 5KC9A 3HCWA 1D5WA 3A10A 1VPWA 1Z2EA 4RWEA 2JVJA 1KRXA 2FLWA 4N0PA 3M6MD 1K68A 3D02A 4XXHA 2JVIA 4W5RA 3I5AA 1Z15A 3LUHA 2HQBA 1S8NA 4DQDA 3SAJA 1RZRA 1RPJA 1QQAA 4ZMRA 5T7BA 2F8SA 2QVGA 2JRLA 1W25A 3GV0A 4LE0A 3HO1A 1SD5A 1D1PA 3D8UA 1EWVA 3GYBA 3K4HA 3IPCA 4G0QA 4MR9B 1M5TA 2FQXA 4IF4A 1JDNA 1JYFA 2E4UA 5KQGA 2FMKA 3OLXA 3RVRA 4MS4A 3RVQA 1RXEA 3IDOA 3LUAA 4D6XA 4H3KB 4OTZA 1Z13A 3L6UA 4OBBA 2L19A 3JPWA 1C4WA 4YO7A 1HEYA 3N53A 3H1EA 4YWHA 3JVIA 4MLCA 2A9PA 5TPWB 4Z4FA 4MR9A 4P1ZA 3HM9A 5EWJB 4PEVA 4G0XA 6CHYA 4KFCA 3O74A 4KNYA 1ZH2A 5EWLA 5KQPA 1RNLA 1SXHA 1JYEA 3KTOA 1JH9A 3H5TA 2CHFA 3O2JA 1USKA 3HV2A 4JAVC 4MS3A 4MS4B 2HSGA 4RKRA 3T38A 5B3JA 1LJUA 4JA2A 2FW0A 3LUDA 1NTRA 9ABPA 1IIBA 1PUXA 4LRQA 4B09A 1Z25A 5B3JC 4YGXB 3ILYA 3CRNA 4LZLA 4LE2A 4KPYA 2FTKE 1NXVA 5TQJA 4Q7EA 3H75A 3RQIA 3HZHA 1Z2DA 3CS3A 3B2NA 5EWLB 2W42A 4Z4GA 4KZKA 2QR3A 1UDRA 2IPMA 4MS3B 3MMNA 4OG2A 3GBPA 2BGGA 4RZSA 4TLMB 2MSKA 1ZESA 4G0ZA 3C3WA 2WJAA 3L49A 4RK1A 1M2EA 2IOYA 4EVQA 4YLEA 1D4ZA 3JY6A 3CZ5A 3EULA 3Q7SA 3ROTA 1JWLA 4Y9TA 5C5CA 3LUKA 1OXKB 2FEKA 1F51E 1CHNA 3DGEC 5KI6A 3QEMA 1Z18A 4IRXA 1QPZA 3OLYA 3TMYA 4D74A 4JP1A 1DBQA 2LUOA 3MYYA 4EVSA 1NXWA 1NXOA 2E4ZA 3RVSA 4QYWA 3RVJA 5KC8A 1JFTA 1JBEA 1MIHA 3G85A 3T95A 1GCGA 2L17A 2QU7A 1QO0A 3A0UA 1JFVA 5IEBA 3EGCA 3CG4A 3TO5A 2AYXA 3I09A 3H5VA 7ABPA 1RXIA 4NV3A 1KRWA 2R48A 3O1JC 1YK0A 4ZJPA 3KSMA 3EQZA 4UHJA 4W5TA 2N9UA 5FWYB 1CYEA 1TMYA 4XASA 1ZAYA 1ABFA 4RK4A 4XFKA 4Z99A 4RY9A 1AB5A 4QICA 4YCSA 3Q15C 1NATA 4RK7A 3SY8A 2NZVG 1U04A 2VUHB 4QYMA 3F73A 3T8YA 1ZGGA 2FKAA 2HQOA 4ETNA 3F7NA 3NNDA 3KYIB 1D1QA 4ETMA 1U2PA 2M1ZA 3E61A 4D6YA 2QSJA 4MRMA 4Z9AA 5HM6A 4W5NA 5DGCA 3JS5A 1WETA 5FWXB 2TMYA 1VRVA 1I3CA 5EWJA 3NHZA 3EDCA 1AB6A 2LP4Y 2L2QA 4OLAA 3FFXA 3BILA 3UUGA 4KV7A 1M2FA 1ZHHA 1USGA 2JVKA 4JASB 3CTPA 2FXIA 2H0AA 1SXIA 4RK0A 1DG9A 4MS1B 4PICA 4EY3A 1NXPA 4WWHA
chains in the Genus database with same CATH superfamily
2XCTB 2GS9A 5IVIA 5ICSA 4J29A 3AF3A 4FE4A 5DW0A 3RUAA 4B43A 1KMHB 3A4YA 3JQCA 3K1YA 3KHTA 4OXYA 1I4LD 3TLGB 3U40A 3VNSA 4GX0A 2VK8A 2ZYDA 1XTQA 3ZLVA 4H08A 1QFXA 1ZBDA 1C9YA 4RFSA 1MB2A 1QNLA 4HWTA 2JBAA 3TMKA 4PO3X 3GRCA 3L41A 1SOMA 4UVEA 1TVMA 2C82A 3QNUA 4KPFC 3L5OA 5T4BA 3D6MA 3NANA 5CH3A 3IAUA 3QELB 4JOQA 4RZQA 3NOXA 5ALNA 3R3YA 2FEXA 4MWTA 2JGLA 3I01A 2GNOA 3SD7A 4K6CA 3TQHA 1Y4ZA 2NZXA 2QDXA 1AKEA 3HXLA 1LFDB 5B4UA 1OLSA 5B2FA 2JBAB 2I4TA 3HCNA 1SQFA 1FSGA 2ETXA 3KAKA 5TXGA 1DEKA 2GHQA 2O5VA 1XN1A 2OXEA 1W88B 2ZTHA 1N8TA 2F64A 3CLUD 1EXDA 3GBSA 1YS7A 3MTEA 5ARDA 1IUNA 1GL6A 4TLAA 1NY5A 2N1BA 4FTWA 3FPCA 1E7QA 1PHRA 1PJTA 5DBFA 2C7BA 5IAGA 1GILA 4FIDA 2NZYA 4X20B 1MX9A 3NXKA 2IFTA 3I37X 2V58A 3L6DA 1KYXA 2OGTA 1CB7A 3DTYA 3JQFC 2I66A 2XMSA 2YMLA 4G5XA 4QPPA 1JG6A 4CLRA 5HKOA 4S1VA 2K5UA 4MCJA 4GQIA 1H2RS 1XZNA 4N49A 1QGUA 2ST1A 3RAJA 3E6AA 4E07A 2GAOA 3EEOA 1Y6JA 3N75A 1L4MA 4PZYA 1GG2A 2J6HA 5EUQB 4I4NA 1OFUA 3W6ZA 1IK6A 5C81A 4AQYB 3HTXA 3A3KA 1KZ1A 5C4MA 3F6SA 2IKSA 4UW9A 5BMVA 3R3ZA 3H9UA 1P2FA 5E4YA 4GXQA 2H2HA 2IOHA 3HACA 5EJIA 2AHOA 5ALZA 2M32A 4LVOA 3THSA 4C0HA 4YPVA 3KQMA 1YR8A 5NLLA 3ADOA 2Z2IA 3DVAA 5EWMA 5TF4A 3ROFA 1W0JA 4QDUA 2HFKA 4Q37A 1M0EA 1Z75A 2E55A 2GO1A 1QO9A 1F6DA 2H8KA 2HMUA 2Z1MA 3TMAA 1I01A 4DLVA 2O19A 1D6MA 4JJZA 3CEAA 1JQ5A 5ITZB 3AFIA 5I8PA 1P4JA 3V8RA 3R7FA 4AUEA 1G3UA 1P2GA 2CLSA 2Q50A 4ZI7F 5BMVB 3FMVA 3ROZA 1PZEA 2C2GA 3C3PA 3GT4A 4HDKA 4KACA 5L3ZA 4B6PA 4B81A 4BFCA 1MMFB 1J42A 3KKOA 3UGKA 2DE0X 1XC7A 4KVZA 1GRCA 4HXYA 4JUDX 3S3TA 3SQOA 1TK9A 3QBTA 1YV9A 4H15A 4JGBA 1IQ0A 1OTHA 2JATA 4QT0A 4EQZA 1EAYA 3LZ6A 2JZCA 3KJQA 4FFBB 2B2NA 1M6YA 1QMPA 2YWHA 3O95A 5C31A 5INTA 4W5JA 3GPIA 1P6UA 1UKBA 2A33A 4N0EA 4W7SA 4EUKA 4BFVA 3WHKA 1SUAA 4YT8A 3KLBA 3OQMA 3KTFA 5FAXA 3KOXA 4N8DA 3ZOZA 3GK3A 2XCQA 4Z7QB 2FYTA 4I3HA 3EDRA 4HV4A 2IXBA 3A32A 2NUPB 1LLQA 1V41E 3MQ4A 3BM5A 5JMTA 5KNBD 1X7ZB 2QTFA 3AB7A 3PE3A 2FA9A 2CCKA 2R8OA 4A2CA 4HFRA 4QXPA 4HEA1 3RU9A 3ND9A 2ETVA 1CE8B 2OV1A 2OXTA 1OQAA 5KOJA 2WHEA 2PUTA 2XMDA 4CLEA 2DB3A 3WJ1A 3OPQA 3KKLA 3LUGA 1MOQA 1QDUA 4LIPD 3A05A 4PGFA 4WNCA 2X1MA 4XIIA 5EKUA 1DQSA 1UPTA 2PVSA 3I6QA 3O8QA 4OGLA 4TKVA 5JBNA 5A3RA 3B3QA 5AVKA 1F2VA 2DX7A 3G9ZA 3L46A 2I4IA 1DXHA 1MQAA 2GBGA 2QV7A 5FFMA 4B3BA 1J0EA 4B9EA 3F67A 2WQZA 3ASYA 4AP6A 1DDOA 2TECE 2PG3A 4TYPA 3TLJA 3SQXA 4Q01A 4P36A 4W6ZA 4RTJA 1U0OC 1OZHA 2B92A 5KOJB 1W2WB 1DAFA 3V1NA 3W5JA 4M3NA 3GOHA 1BE8A 3GD5A 4BC1A 5JH7F 1KEWA 2X3YA 3GMDA 1KI4A 1LDYA 3OWXA 2EP5A 4FCCA 4R2IA 2H4YA 4K87A 4UUBA 4WASA 4U7DA 2BUBA 3FMGA 3W04A 5A2GA 5CAEA 1L4GA 3R5SA 2XWPA 2FAXA 5BVGA 1QP0A 2VBCA 4Z2YA 2Z5FA 4XYGA 3WAJA 5IJXA 1AF4A 4FMCF 4G97A 4DGQA 1KWKA 3K7EA 4CL0A 2I29A 4RETA 4W5HA 3NT2A 1K86A 4FFPA 3T3GA 4C2AA 1IVYA 7MDHA 1KKLA 3ITEA 4BMOB 1SC1A 3NDIA 3RM3A 1TAUA 2GB4A 3GGOA 1MO6A 1IEWA 1KI9A 2JB9A 2FSSA 3IIKA 3PQEA 2PMBA 4FGJA 1CY6A 1YJXA 4JCOA 3U3KA 3GJSA 5TJ9A 2RKBA 3ER6A 2RJOA 3TI7A 1QJ4A 1JX6A 2EKQA 2FUG6 5TPZA 4R3WA 3DTTA 2WY2D 4J1SA 1TKRA 1EVEA 3W9SA 2XECA 1DBVO 1UJMA 2JBWA 5L4LA 2VDPB 2H16A 3O4JA 2QE7A 4BY9E 4H7PA 4X1KA 3OLCX 4LHEA 1IPEA 2G1PA 2BH2A 2FV8A 1DJMA 2EKBA 2BM8A 2DUMA 3GRFA 4EG7A 4WZBE 4BDTA 3HA3A 5AT1A 2FPMA 3HUDA 1HC7A 4EVRA 2I6UA 1JIIA 2EFEB 5HUJA 3FZEA 821PA 1SVNA 2J7PA 2QKYA 4F3NA 1VFNA 1UC4B 5FULA 3KD3A 4LDNA 2Q7OE 4Z49A 3NNSA 4D80A 1ZHOA 4IXNA 3LLCA 4GF5A 3ZGNA 3TNDA 2ROQA 2H2WA 5I9MA 4J0DA 2QV0A 3U09A 2GTHA 1CF2O 2ODAA 5I3CA 2OORA 1SELA 2NUTA 1BVUA 1L3IA 4DRXB 4JSTA 3WX0A 3CNOA 4XJTA 5BYJA 5KKCA 1G21B 1ESNA 3BMOB 1E7YA 3EVAA 2A6PA 1BXKA 2QHXA 1VE9A 2QT0A 4NIMA 3KBOA 2Q5LA 1PG2A 1ZGHA 2BDTA 1WXXA 5JCPA 1NM5C 2ZIXB 2PMEA 2X19A 4HVAA 3AVUA 2WUVA 1IN1A 4UDYX 1EEHA 3I5UA 1XZEA 1THGA 3MMPA 4NHEA 2JGAA 4L73A 3ZI4A 1H2XA 3UG7A 5FNVF 4X6XA 1N7IA 4HDNA 1A8SA 3BMCA 1OKKD 3EQ2A 1G21A 4FJ2A 5E0KB 2VPYA 4U4AA 1ZD8A 4PZAA 3ZV5A 1UP6A 5KVSA 5DIFA 3SE7A 3KZNA 4QL3A 4L4RA 5K0GA 3U7JA 2PJZA 1TVCA 1U7PA 1NMXA 2JJ2D 3MJRA 3SSMA 3P45A 4ZPXA 3V97A 4BLPA 1E2BA 2H8GA 4A6EA 2V7BA 1I80A 1RKXA 1R27A 3BMCB 4KWIA 3D81A 3FNRA 1OWOA 1SVIA 3URMA 3FPBA 1I51A 3ESXA 4FBGA 4L1KA 1UIRA 2RHJA 4EUSA 2ZS7A 4G1EB 4L2IB 3JQGA 1NAHA 1H0HA 4U2FA 1DUIA 2E89A 1OF1A 1RBMA 3VSCA 1H69A 5EFZA 3VKGA 4HFJA 5H4GA 4BTLA 3CUTA 3JR7A 1NN1A 3D64A 1C14A 3EEBA 4CG2A 4EY8A 3WG9A 4Y6LA 1Y3DE 4JC0A 4TL8A 1E6KA 3P9PA 2BGWA 3SVLA 1JDBB 1KO7A 1BW9A 2WI8A 2C83A 4BP1A 1PFVA 1O6FA 4RZ3A 3VJMA 3WDLA 1ZD9A 4B8WA 3W5IA 4GGOA 4ZANA 1U5BA 4C6TB 3V1KA 1EHIA 2XV1A 3PF9A 1JWBB 1NIPA 2GEUA 2YIDA 1V47A 4M9ZA 5K51A 3FPLA 4Q6BA 4CKYA 4HNQA 3NOQA 2AUNA 3CUWA 3H83A 4JB0A 4BX2A 3F5FA 3ADPA 1NAIA 2DHDA 3RYTC 3FIUA 4KC0A 1J5EB 2ZJ1A 2JI7A 1M0SA 3E82A 1NXTA 5CX4A 3O47A 3EPLA 1X15A 3IPYA 7YASA 4A27A 2GO7A 3T3EA 4CKCB 1U5BB 2ADOA 3M81A 5IUNC 1Z47A 1XP8A 4WUTA 3KPJA 2ZFUA 5AMXA 3GZNB 1R3UA 2XITA 2ZT6A 2H31A 1NW4A 4MVJM 5FA6A 2A14A 3JALA 3VOBA 3ZXIA 1Y6QA 2I3ZA 5EZYF 3RYIB 1M74A 3PHIA 4K9PA 1HTTA 4FYJA 3TPZA 1KJQA 1YMUA 5FT9A 1SHJA 3UVEA 3TTYA 1EFHA 2OFWA 4GVXA 4X97A 1XAJA 3W5UA 5G41A 4HQ0A 4IL5A 3JQAB 1MF7A 1OXUA 4UUOA 1OX4A 3M6XA 1SUWA 2AOTA 4MLZA 1UOQA 3PX7A 3C15C 2CLDX 1WXEA 3FM9A 2A57A 3N0RA 4KGDA 4DLTA 3JQ7A 4U00A 1U8TA 3EGIA 3MYRA 5JD3A 4YMUA 1ZVMA 2IZ0A 4UAJA 3ZU3A 3HJFA 1VHQA 5I9TA 3R23A 2GFHA 3VH1A 1RAFA 5CBPB 5CCBA 1O8CA 4ANFA 3NIBA 4YIKA 3N8GA 2PSEA 2P6OA 5J2UB 4ZVRA 1OX4B 2VN8A 4QIHA 1FU4A 1UKZA 4DYDA 2OQ2A 4FU0A 4UHCA 3RF6A 2H57A 1QVRA 2X5NA 3I5AA 4IIXA 4LV8B 4EFDA 1FIUA 4CMCA 2X22A 3RTEA 3WGLA 2X8JB 3VSBA 4B7CA 1X9GA 2ZCJA 4K9RA 4A16A 3T3PB 3NJRA 3GV0A 4NYJQ 1JI0A 2ONCA 3KXLA 1A71A 3HJRA 1U2EA 4B17A 5CA0B 4YCLA 3OG9A 4YUZA 3WJ2A 1NQWA 3RFCA 1LVHA 1WZEA 1IHDA 2B94A 3JAKB 3LE8A 1AUQA 1ZI9A 4NBSA 3IPCA 4E5VA 5BSVA 4IDDA 2HU5A 3OOWA 3AVVA 1PNOA 3JW8A 3G0CA 3TDNA 2SICE 1MJGM 4C29A 1U1EA 1C1DA 2AEFA 1NF8A 2FMKA 2JH8A 1WV0A 2FGKA 2NVUA 2P4SA 2V65A 2ZAOA 3DE3X 4HWOA 1RXEA 4B7XA 3DYBA 1YAJA 2JHCA 3LKDA 1WCXA 4KAJA 1RBZA 5CT6A 5AIAA 1Z0FA 3SIPA 1XIVA 4QQKA 1XAIA 5EHGA 5KHOC 2A1TR 3QM1A 2A9PA 3HM9A 1Y4SA 4KO4S 1UOOA 3RRXA 4ESOA 4IZHA 4KMSA 1N2CB 4Z86A 5DOZA 4GZ3A 5KQPA 3VR5H 3TLMA 1UINA 1XQ6A 2DTXA 2HM7A 4DIFA 1D4AA 1AKRA 4ZCRA 5CM2Z 4KFUA 1DO2A 5C1OA 1W2HA 4BP3A 5KYXB 5KNDD 1IY1A 1I3LA 2ZGVA 3FR8A 3G2PA 2VZLA 4EY5A 4BXOB 1EX7A 1AUPA 3KTAB 4RL6A 3V55A 1V3UA 4Y6OA 1NXVA 1DUSA 2WWHA 4P4LA 4UMEA 3T0FA 4WCFC 1AO0A 1H66A 4DQ0A 1N0WA 1TUBB 2QL7A 3D8BA 2OVBA 5HIKA 5LWHA 1G5PA 1SK9A 6GPBA 1ZI6A 3GLFB 2NZWA 4UCXA 3VYWA 4NPHA 4XX0B 3IT1A 3TIGA 4TWBA 5G4LA 1VKHA 3BEDA 4KO3S 2PBLA 3K1TA 3NBKA 2J9RA 3ZJ4A 4LTNA 1A5SB 1CJBA 4RVCA 3ZV6A 2ADMA 4EVQA 2EWMA 2IELA 3HNOA 4M1OA 3U37A 3KIPA 4YBRA 4ZEMA 1P80A 1JWLA 1FDSA 4J9UE 3FCCA 3DWEX 1OXKB 3R0QA 3W1EA 1TEVA 1VG1A 1JQ3A 3FLEA 4KXQA 3IEKA 4EG3A 1NTOA 1Z5NA 2F3UA 2DQ4A 3G0DA 3QP9A 1HZZA 3PE6A 3SC4A 4YMIA 4TXJA 3LBNA 4D4JA 1H6CA 1XLUA 3AFOA 3GO4A 3M2TA 3ORHA 3QLEA 5K4GA 1JFTA 2X8BA 3HDQA 4JI3B 2QP3A 5FTLA 1X8JA 1MIHA 4QHYA 4EM6A 3PQ8A 3WKEA 1I33A 3EH2A 4X91A 3EZ6A 3LDUA 2GZAA 3ICPA 3HP7A 4OKIA 3HBLA 1QR2A 1D7AA 1XMQB 5FFFA 2ZQZA 4BNWA 3OTGA 4IQ4A 3U7HB 1U4NA 3GPCA 4ZKEA 1GGJA 5JBIA 3ZBPA 2Z6AA 4FHCA 1SKAA 1F2UB 5CT4A 1NOIA 4LQCA 4XASA 4YALA 4N7RA 5TGTA 4JXXA 1XVTA 3CPSA 721PA 3GP5A 4WK6A 4OA5A 5FO1A 1ZUHA 1TO1E 5EKDA 2HRCA 2QM3A 3DFFA 4FI3F 1IEXA 4DG5A 1I2CA 4Y2JA 4LF7B 3WSWA 1DPFA 3S44A 4A73A 1Z6TA 2V03A 3G8BA 3HN2A 5DHUA 1NJ6A 2V4UA 5IYZB 3W5CA 1K98A 1U2PA 2YXNA 1ZUIA 2QSJA 5AWFC 3AV0B 3QUCA 4R54A 4Z53A 2CK3D 1WETA 3LCJA 1MJHA 3IT0A 2PO7A 3FOEC 1MDFA 4LVNA 4UXHA 3SR0A 3JATB 1EUCB 3B60A 2I8AA 4LZNA 4NBLA 4C04A 1P0PA 2FSFA 3REOA 2QVXX 5C32A 3F98A 3OTOB 1P75A 3HMQA 1M2HA 1NQVA 1T8RA 1XB2A 3FFXA 3HSSA 4CRWB 1FYVA 3AM3A 1GNVA 3ROKA 5FOQA 1COZA 2R4TA 5FOXA 3ZCSA 1TRKA 3HC7A 3N07A 4L0DA 1CUIA 3OJXA 1HKUA 1HE2A 2B1GA 2FPSA 2KWIA 3O03A 3ZVMA 4LF6B 2QVBA 4XJXA 1XTKA 2Q49A 2G9VA 1GYQA 2HRDA 2CW5A 1U9IC 1WS6A 2ODWA 3KKPA 2E6KA 1TYCA 2J9FB 3LO8A 5GGXA 1Y3AA 2QG9A 1IY2A 3HCAA 3IUYA 4V03A 3LTEA 3ZHUA 3IQXA 3S8EA 1F5NA 1DJQA 4I1VA 4E2WA 2OVFA 3OKFA 4IDHA 1CRWG 2CDNA 4Q7LA 2XE8A 1NKVA 4TXHA 4MX8A 4A2WA 2XPCA 1R9MA 2C1XA 2DSNA 3IB6A 3AINA 1PGOA 1QO7A 2YWRA 4OGGA 4YCBA 1ZN8A 3SYKA 5F21A 4RF2A 2HD4A 1CQZA 4Z1MA 3FZNA 3F78A 4CU2A 4UJ3A 3U6BA 2ERYA 4Z7NB 1LNZA 1CU1A 3GIWA 3E1GA 3QX8A 3C8DA 1NX6A 4FNOA 2BELA 5IMSA 2QLTA 4HY3A 2GK4A 4WCFA 3EHDA 4DVJA 2OQVA 3UWMA 2EP8A 1Q22A 3DHVA 1VCIA 4EGJA 2HF9A 3RC7A 5D8DA 1M3SA 3AG6A 3OFJA 2QUHA 4QREA 4BMNA 1T5LA 1BO6A 2JI8A 4CXMA 1BSVA 3PNLA 3R4VA 2GGSA 3I6MA 5FCDA 5HKBA 1I94B 2DCMA 1P1FA 2ZBUA 4JYPA 5CB0A 2C3OA 2DPYA 1P81A 4R1LA 1QQ5A 2HDWA 4OKSA 4WJZA 2GM9A 1F6WA 1E9SA 2WAOA 2X1VA 1N2EA 2N0SA 8OHMA 5ESWA 1B1CA 1U8EA 1QCCA 5BWBA 3QEKA 4W8GA 3NH6A 1N3BA 2VFAA 4CIXA 4DGSA 1W49A 2CVHA 5JSUA 3G6KA 3IE1A 1DMSA 3IHTA 4ZAXA 3S5JA 1QTIA 1DU4A 1G3IA 5FBKA 3TAUA 2M2IA 4P7FA 1CUVA 1SFRA 4OMCA 3L1KA 2YW9A 4GLBA 1J9ZA 2A5FA 5JQGF 3TGLA 2R8RA 1QIDA 3ANTA 5HP4A 4YP5A 4N5IX 4FGUA 4FZRA 1D8TA 3OJ0A 1XX6A 4RAOA 4EH1A 5BVHA 4ZALA 5JXJA 3OIYA 1ENOA 5EJFA 1I7NA 3BHIA 4EYQA 2WWXA 1S02A 5CBKA 3G0OA 4PZLA 4V38A 3KLNA 4IHAA 1W73A 2ZYHA 4MCIA 3N6RA 4JHLA 5TV2A 2X9GA 5DHRA 4PZZA 3NQ41 1JRLA 5EE9A 1QIIA 4UZFA 2EP7A 2OOSA 1MB3A 2I99A 2GFIA 3B78A 3GT0A 4IILA 4KO2S 1PO7A 4LZZA 4PLPA 4BFXA 1ECCA 1NW7A 3C45A 1ES9A 2GCGA 1KJYA 4L9AA 3FTPA 4EG4A 2OV2A 1T34A 1ZK3A 2JGFA 4DJTA 3LP6A 4DRZA 2C0QA 1FP2A 2ESRA 1EHYA 3IBFA 3LA8A 1NZJA 4BPBA 1SBYA 2FEOA 1P72A 3R20A 1Q7GA 4LYFA 3KCQA 4O63O 4HAIA 2Q5CA 4TVOA 1H2FA 3L8GA 4CF7A 3MAAC 2CMDA 3JTMA 3Q9NA 1I14A 1EE1A 3EF0A 4HEJA 4K6FA 2BKAA 3ZLJA 3SXJA 1A9RA 4O8ZA 4AY6A 2XVAA 2ZJBA 5F5XA 1O96A 1P1RA 3GGSA 3TLGA 3UA3A 4AZSA 5M7EA 3V8QA 1XYYA 2J5XA 5K7SA 2FN8A 2R68A 2WR8A 3EZ2A 4QAJA 2AR7A 2O2DA 5G02A 1D8AA 4NULA 2Y1FA 1NBMD 2OCDA 3B3GA 2AMJA 4HEA6 1BQEA 2RONA 2IPNA 3LDHA 4P83A 3COVA 4PG5A 4ZVVA 2H1CA 5KWSA 1G8JA 2J5QA 1KY4A 1X13A 2EBHX 2ZROA 4LN1A 2XNCA 3M6WA 3DBVO 1O96B 3WQHA 4Y0VA 4BO8A 4RJKA 3DZGA 3PUVA 4O2BB 4BTEA 1W5FA 5TY0A 4MAAA 5KNBH 3M8KA 2ZKLA 1PX2A 1SN7A 1WB5A 1WMBA 1GGFA 5LLTA 2AI1A 3O8DA 1BYIA 3G9QA 2OENG 5HRUA 3DBRB 4D8VA 1GQQA 3HRHA 4RWZA 3N8KA 3T12A 5AW0A 3LCVB 2P6UA 3DZIA 4LRYA 3AEUB 1LK5A 4JZYA 1E59A 3ASUA 3KOUA 4MHOA 1LC3A 4PFKA 4U9HS 4F3KA 5LXTA 1VL0A 1B8UA 5D7NA 1J2TA 4JP3A 4M55A 4FMDF 4OYHA 4C88A 1ENZA 5A6VA 1Q6ZA 1LPSA 2WWTA 3DXXA 3DO6A 3GFOA 3QXCA 4BVGA 5JZBA 2QD5A 4ALKA 1B0PA 4ZT6A 4IXDA 5CLFA 2AE1A 3CNQS 2J0UA 5BR1A 1QDLB 3O31A 2VP2A 3DB1A 4I5IA 3ZCPA 3SWWA 1KC3A 3DCJA 4DLNA 3GLGB 3GIDA 4PO1A 1AQ6A 5I7VA 1GGKA 4RK5A 1RAGA 3K4QA 2A9QA 1XQXA 4BV2A 4HNAA 1ORHA 2O7SA 3KQVA 3Q3HA 2IOFK 4BFLA 4RTLA 4MVXA 1VJ1A 3AP2A 3ETNA 4AZ3B 1TEZA 4DMRA 2FETA 1LEHA 3F90A 4LJ7A 1M5UA 4PRZA 2H2GA 4BNKA 1E7MA 3DQQA 4FIZA 1D03A 3BQ9A 5BRNA 4BRWA 3Q72A 3N5KA 16PKA 1DINA 1TJ3A 3OP1A 4MW1A 4ZIRA 5B1HA 3UUWA 1GPDG 3G1WA 2FZCA 1G1AA 1HFJA 1REQA 1AN0A 1OTYA 2WSYB 1UBMS 2HJSA 1Q21A 2FQ1A 1YDFA 2WT8A 3VDRA 4B35A 5B1DA 1P6QA 1TNDA 4YR9A 2WFAA 2C20A 1N6OA 1SGWA 1MHPA 2RH4A 4H6WA 3R74A 4WA7A 2PZAA 3T5CA 3T6KA 4AZWA 4F4UA 2VF2A 3QK7A 1NG1A 2WF7A 2OYSA 1RWNA 2AYZA 2GN1A 4R8RA 1YA8A 1WM1A 2HA0A 1ZVKA 3OIVA 4GM0A 2WYOA 2I87A 2QIPA 3ZGOA 3PIIA 4AYTA 3QKWA 1RRMA 4ZAZA 1XYVA 1J0AA 3EIEA 3PR2B 3LK6A 4CIVA 3IEVA 2B7LA 2NSHA 1II8B 4N39A 3CVXA 1TAQA 4TMXA 1DTEA 3IDAA 5KYWB 1E1DA 3TQQA 1ZCJA 1QOQB 1Z73A 2ZI6A 3CIFA 4JI6B 1VL8A 4K7JA 5BYKA 2QAGB 3PXDA 5CB6A 4QUIA 3HR7A 4XR9A 5KVQA 1VGRA 1KMQA 4DMLA 1GFWA 1JILA 4YP0A 8ADHA 5JZOA 2J3HA 4QEZA 5AJWA 2PKYX 3L02A 1JR4A 4ER5A 2FN7A 4LWOA 1JXAA 3CLTD 3HY4A 5HIJA 2J9YB 2HIGA 4BVHA 2LD4A 3D6VA 3OFSA 5B3KA 2B4AA 4CZ2A 2OT3B 1SM4A 2DQYA 4YS6A 3EW9A 1UBGA 3TH5A 4X8OA 3TRFA 3UMCA 1JPNA 4HFMA 1XRPA 3VZSA 2XUGA 3ZU2A 4AMYA 1PKXA 1J2EA 3UGTA 4CLDA 4X94A 1SJ9A 2AF3C 1BKYA 4K3VA 5AK3A 1B0AA 2JGJA 2OBFA 3GLIE 3IDZA 3F7MA 5KMGB 1EJBA 1YDWA 2RB5A 2V5VA 4I55B 4PPGA 3LT1A 4AX4A 1AK9A 1TCBA 2NZUG 3VDMA 1EJ2A 3IUMA 2WSBA 2V8BA 4YJHA 3T7SA 4KGZA 2SNIE 2D5IA 3L0IB 4EA6A 2GVDC 2C58A 1HOTA 3BN3A 1KY3A 3HSYA 1EFDN 5IPFA 3L5KA 1KI1A 2QLFA 4R3NA 4TRJA 1Y7LA 4BNGA 2PTHA 2WSIA 1AD2A 3H1GA 3O94A 4FCWA 1EFRA 3FF4A 4XSHA 1BS1A 2JLWA 1WLYA 2DPLA 3BCSA 1NP6A 3GMIA 2FQYA 3JWHA 4ZV7A 4EX7A 1T1RA 1GITA 4DNPA 3ZD6A 3BGVA 4IDAA 3RCBA 2PS9A 4ZYWA 4MW7A 4PNEA 3TE6A 4UASA 3TIFA 1NC1A 3E9YA 2CMHA 2W2QA 3LLVA 4MKXA 5JECA 1KTVA 2POQX 3BS4A 3Q1KA 4MHSA 4LNUA 4IHJB 2POCA 1U0HC 3NWEA 2F1HA 1SMKA 1D2EA 4U5QA 3GLTA 1JKFA 3HYTA 3NHLA 1WMEA 3SF8A 1N2ZA 4HK4A 3TQTA 4UUPA 4DLWA 3RYCB 3O93A 1H3FA 2QT9A 4CT4B 2J3EA 2RJNA 5L7YA 1Y5MA 2QA5A 2VCYA 1JKJB 3DDHA 4DCMA 4RTNA 4DV3B 1KHHA 4KMRA 3ZU4A 1P4HA 3GY0A 3O1LA 1R0BA 1J49A 2ZAYA 1O6BA 3BMOA 3CU5A 3GUYA 1KORA 1WZ2A 2CBXA 2GBLA 3I5MA 3CZMA 1E9EA 4M0DA 5KYUA 3UCFA 3P9YA 4EGSA 5JASA 2EGGA 5CFQA 1F8FA 3GNTA 1N4DA 4D4IA 3AETB 4A26A 5LP1A 4JVNA 4PQRA 5BR7A 4QT4A 3AHEA 4KGXA 2YV4A 2ZTLA 1RAIA 3LWZA 4FFLA 3TJRA 2RD2A 4KRYA 3QY9A 3ICEA 4OLJA 4EZBA 3ETCA 4HDNB 4OHUA 1HZZC 2P69A 2UKDA 2OCKA 1AM4D 3IMKA 2UZ1B 3KDPA 5AFSA 2JVJA 4DF3A 3EVGA 3RSOA 1CKEA 2WP0A 3WGIA 4UZEA 1K06A 4R8SA 4E51A 5BSTA 1OKKA 2Y9MB 3WYBA 3NJ8A 3H4IA 4E14A 1BMFA 2BM9A 1S8NA 3AHJA 3RARA 4E22A 2FW1A 3CF4G 5H70A 1ODSA 4YRFA 4R1PA 2PGIA 1O94D 1S2NA 4LE0A 1XKLA 2YRFA 5C3MA 2OGZA 1CVRA 1SG0A 3DZ8A 3E9QA 3MGGA 4I9FA 3QF7A 4JDUA 1U6JA 4W9RA 3GYBA 1OU0A 4QXMA 2QBYB 1MV8A 4WADA 3IAS1 1Y3CE 3L1VA 4RQTA 2V59A 2K7FA 1Y9AA 4EMTA 1QQ6A 1JSCA 1G63A 4RVUA 2Q6IA 1JW9B 3MERA 3ZCQA 3E9MA 4MV1A 5ALYA 1L4LA 3ETGA 3KJNA 2O2EA 3MTBA 3S7TA 2GZ1A 3PNMA 3SX0A 4ZHSA 1TJ5A 1HEUA 2EW2A 2GPSA 2RHWA 4R8VA 2YZNA 3RJ9A 4XD7A 5T6MA 2IUEA 2REQB 4PIVA 1OWNA 4CV3A 2VHXA 5FWNA 1G0NA 1S5PA 2O0KA 1MOZA 2QTVB 3PGA1 1ZJZA 1SBZA 2NPFA 3X2FA 3R40A 4L5JA 3KOZA 3UM9A 3ESDA 1E1QD 3DMTC 4G01B 2F1OA 1U0RA 1JKIA 4WNIA 1KSGA 4RGBA 1DO0A 2O0MA 5CJPA 1E3TA 4CQNA 4IIJB 4OSEA 1G21E 1QE3A 5CB4A 2QYSA 5HFNA 3KQWA 1SXJD 1GFZA 4M98A 1QANA 2VHVA 3NJ4A 4KPYA 2XQVA 5EP1A 3NYIA 4PX3A 2V9CA 4DJ5X 2EKZA 3LQYA 1ZAKA 2ZANA 3UATA 1EFVA 2IPXA 2IUSA 4BQNA 2EKDA 4JYMA 5IM4F 1AK1A 3VZQA 4MMYB 5KU7A 3LT5A 3ZZNA 3Q85A 1CJVC 3OQJA 1JG7A 2YS6A 3TGWA 4ZVTA 1OA0A 3MAJA 3QVXA 3B1FA 2PGNA 1CY1A 3ZV3A 1QU3A 2QUBA 1RQPA 1W4RA 2ZPTX 3PSHA 4LYEA 1UZNA 4Q9JA 3Q9LA 5A0TA 1Y8RA 3CZ5A 4J2TA 1RHMA 5JQGB 3VVMA 5CVCA 1XF1A 3VC2A 3V4RA 5DN9A 3H0EA 3M1AA 5GJWC 3WGTA 1H8HA 4CQJA 3QJYA 4EKEA 1EDDA 5AI8A 3HXKA 2XCUA 1HT3A 1V4NA 1Z8FA 3IUQA 4JP1A 4PHFA 4X54A 3TMYA 4P32A 2C7QA 1HK7A 4CMIB 2JCXA 4DUYB 3NYRA 4I0WB 4P4NA 5DHFA 2RCNA 2R8EA 3OA2A 1FLAA 3QMWA 1TIKA 1C8LA 2GD6A 3REFA 4HQNA 5JWOA 5J2UA 2DT8A 1FBNA 2EFYA 2XI4A 2FMUA 3A28A 3AKZA 1RI3A 2FR1A 1MO3A 2FW6A 4QDTA 1QAQA 4PYNA 3N6XA 3ZK7A 1H5UA 5AVJA 1FTSA 2WVGA 1RPAA 1Z2CA 3D7SA 3EGCA 3TO5A 4C0AC 4EK9A 4BNZA 1MA3A 2R48A 5CX1B 2LCQA 1YK0A 4BBZA 2LGJA 3EFBA 4D8TA 5IAOA 5ARCA 2O8VA 2NSJA 1NL3A 2FCRA 4B40A 5LR6A 1XZIA 2PGJA 3O4FA 2P77A 4RLFA 1IZYA 1Q83A 3OEYA 3PA8A 3GFFA 5PGMA 3FWZA 1MH9A 4JEHA 4BLUA 1GFIA 3DC7A 3QG5A 5H4HA 2ZYWX 3AUUA 2AKEA 4DBLE 4TWRA 3CCFA 2Z2KA 1VYTA 5D87A 3RTDA 2C7VA 4MO9A 5DNVA 4DBVO 1U99A 4HPXB 2IWHA 2DKNA 2F1JA 4BGEA 2WAMA 1H3NA 2BZSA 1E9BA 2C2OA 1AQYA 1NVGA 4L8WB 4QELA 5LQSA 3OIGA 4AY3A 1U9YA 5T8KC 1I6LA 2ERCA 1KTIA 1QIMA 4O4LB 1VPLA 4RF4A 4Z51A 1IM2A 1YDHA 3HCRA 1D9ZA 3KT8A 3NI2A 1XPUA 2MR6A 3HR4A 3AF2A 2NQ2C 1XTIA 4GI3A 5ERGB 4ZHQF 1T3SA 2VF5X 2WTNA 1JAYA 2FR8C 5JG7A 2X2OA 5A4AA 5HZKA 5JSFA 4EW3A 2H0AA 4G8JA 2YHSA 4R98A 1TX4B 2P91A 2ZJ6A 4WWHA 3SBXA 1J0DA 3THRA 4O4LA 5DEIA 4R0MA 2LPMA 1W46A 2IC5A 1NOJA 2XAUA 2CWDA 1UMBA 1VSQA 3JVVA 4R0VA 1DC4A 4MEBA 1E1CB 2H3EA 4ZTBA 1MD9A 4NCBA 4ENTA 3CJTA 4S1OA 2B5WA 2P4UA 4RKWA 1F38A 3Q41A 1W1UA 4HDOB 1Z38A 2KSQA 2DKFA 1I8TA 2A78A 4B6JA 1NX9A 3MNFA 3Q98A 1VMKA 3SHTA 4RMIA 5ECGC 1EVIA 4OQDA 1ZPDA 2BCEA 2C4MA 5HEKA 2XWJI 2NX2A 1MCZA 4XDHA 2N75A 5TGZA 2HBYA 1OI2A 4NFYA 3WJAA 2DH5A 1QV6A 3NEJA 1TPYA 2JZNA 5KSOA 3H3XA 3NDJA 3T5GA 1WUYA 3TL6A 4PNHA 2YZMA 3JQBA 2WQ7A 4MRSA 4PZCA 2ZUCA 4DWVA 3U39A 5L3SA 2IDKA 3KYDB 3DF9A 2AA3A 2GNAA 4ZVKA 1U8AA 3H84A 1VL6A 3ICWA 1PFYA 5T3UA 2IUTA 2FHSA 3SQDA 2PRYA 3RBXA 1X38A 5CP8A 4J16A 1P1HA 3FYDA 3PCXA 2H07A 4XCXA 3OCUA 3TSCA 3WQQA 5IF9A 3ER9A 2M6KA 1SXPA 3ETDA 3H1FA 1WD7A 2B36A 2Y76A 3D6FA 3KZCA 4G5YA 2FSPA 4P4GA 3VAAA 4EI7A 1J8FA 2YOHA 4MYSA 5KNLA 2Z2YA 4F2DA 5HUQA 1TM1E 3DE4X 4E12A 3ZY3A 2XB4A 5BPFA 1VJCA 1UH5A 2AJCA 2A9RA 2JFVA 4QPJC 4J4BA 5EZ6B 4PLZA 3PX2A 3K8YA 4L85A 2RGEA 3RVPA 4E30A 1E8NA 5A5VA 1LWNA 1F4LA 3M83A 4LC1A 3I9JA 4ZEXA 2WLSA 3FWNA 1SBCA 4AYXA 5B7QA 4LRUA 3ZW7A 3E4DA 4KCGA 4WXMA 3DHWC 1S89A 5TARA 1EGMB 1Y48E 1Z5ZA 4FB5A 2YV5A 4PSDA 4EWLA 1T6YA 3RR2A 4GPAA 1V16A 1RP1A 3DMNA 4H1VA 5DBIA 5EESA 4AC9A 3BHJA 1TTQB 4Z9BA 5E95A 5CFNA 4B1FA 4FFNA 5DXFA 3OIDA 3GJ4A 1WULS 2H7CA 3F7TA 3GRPA 4LGVA 4RGVA 5GZ1A 1QFJA 5LDDC 1N5KA 4U2CA 3MWKA 1WCV1 4KR7A 3IAEA 3M6FA 3A4MA 1I9CA 5FF9A 1LZKA 3U3XA 3RC3A 1BROA 1K4YA 4TM8A 4Y2UA 2VJCA 2GCEA 2W37A 3GMSA 3HADA 4MEAA 4S0XA 2PM8A 2N47A 1PL0A 2H54A 4L08A 5AOVA 3Q8KA 1VJ0A 3GN1A 1XEWX 1UEIA 4ALIA 2O2ZA 3BE8A 1JH8A 1RR6A 1EVKA 3GZ4A 1N36B 1Z0ZA 2O8NA 4TMTA 2HIMA 1KAOA 1VI6A 3KKNA 2VK1A 1D7OA 3I3SR 1EXNA 3L93A 4I55F 4D8YA 4KXNA 3BIJA 5B30A 1ZU5A 1NXQA 3RJTA 5JNRA 1EIZA 1QFZA 2IQ5A 3IBSA 4XAQA 3HXQA 3CZPA 3HDTA 3HG7A 3ND5A 3QU9A 5TMEA 1RWWA 2IF2A 2RHDA 3WFJA 3FVRA 1CIVA 5DE3A 3ZXXA 5B12A 1O4WA 4ESEA 1PK7A 2WD8A 2XWSA 3MCUA 1FLNA 3A0RB 3WYNA 3PXAA 2QRMA 4DIOA 1I7QB 4CEHB 2O8EB 1I5EA 4NU8X 2XMQA 1EK5A 2W0MA 3EG9B 4Y1EA 3T4PA 1O2DA 5DTIA 2PS1A 2B9VA 2A4MA 1L5MA 1X74A 4KVFA 1IQUA 1AGPA 2C2WA 4WKNA 4K9LA 3U31A 5J23A 4GHWA 3ISJA 1ZMRA 3OE5A 4TLDA 2GLTA 2RBEA 2YZGA 3H17A 3MMSA 1ZN2A 4EVIA 2O54A 1YKFA 4HH4A 6ABPA 2GFQA 2VNIA 5CCEA 5HQ3A 3LQQA 5FI1B 3GNLA 4YAFA 4Q7QA 1IRXA 4A4DA 3GU3A 2WHRA 2R62A 5ECYA 1XZPA 2Y68A 3GXOA 1R50A 2EHJA 2RAFA 2G9NA 2A35A 1HMPA 1U11A 3AEZA 5DI3A 4LJLA 2OA0A 2M1XA 5IC6A 1NI4A 1AMNA 1ZD3A 2YQ5A 3MEQA 4U1RA 1GSHA 4X65B 1VZ3A 2QN9A 2XMBA 2PXAA 3Q2OA 5A1JA 1RQLA 2E18A 1ECFA 3EPJA 1BKDR 1U9ZA 3W4KA 2R2AA 2C95A 2FRVA 4ZVSA 3UIEA 2NU7B 2QRZA 1JAXA 1SOUA 1BE1A 3AEYA 2P9JA 3OU2A 2CFIA 2E37A 3MVEA 1E0DA 3OP4A 5EOVA 4YRPA 1OB5A 3P0EA 1J21A 4L6IA 1RJ9A 2J9ZB 4P4UA 4R2JA 1WCIB 3C3KA 4QC2A 2GPNA 3ZYCA 3P0RA 3UMBA 1RQ7A 2I1QA 3FSGA 5ICGA 1OYYA 2R86A 2Y6UA 3H99A 4QQFA 3VM6A 2CK3A 1IYZA 1LKZA 1YZUA 2QF7A 3I2FA 2WJIA 4PLTA 3LFHA 3QA9A 4EHNA 3DE0X 5KPDA 3OWHA 4BKRA 4QE3A 2JPDA 2P8SA 1S8AA 2E4XA 1RE0A 3ICOA 2PH1A 2PUCA 3A27A 3EFHA 2Q0QA 3GCDA 3VYUB 1MZVA 4BEBA 5A7FA 1IM5A 1KVUA 2QQFA 2GOYA 4CLXA 4PO9A 4DILA 2DETA 5SY6A 4JJ7A 1VBMA 5TQ2A 4JP2A 4MGKR 4TL9A 4JUBA 4ZOLF 3RSLA 3UH1A 3UJDA 1SKMA 3VOTA 5JE8A 1CTQA 5HE8A 2H00A 1RD4A 4GM1A 3RANA 2UVPB 2QY9A 4FMDB 1PU2A 1DC6A 2IDMA 3BB1A 1TZ2A 3E03A 1V96A 2BRUC 2G9ZA 3I0MA 4JNCA 1K8YB 4IG9A 4HLQB 3PXCX 1VYHA 5K05A 2NUBA 3PFGA 4RXMA 2EJWA 3K1AB 1T36B 2WU1A 3FAZA 3FSRA 3ZE8A 3QNMA 1UBTS 1XMXA 3PFCA 4L8FA 1DOAA 2W2LD 5H5JA 1FS4A 3FHCB 4X44A 1DFIA 1LW7A 2BR3A 4RV5A 1KPIA 1TRHA 4MQFB 1RXYA 3H8WA 4DZTA 1ORWA 1ZN9A 3NGMA 5EMHA 4ZOQI 1GYPA 3AI2A 3O4VA 5AH0A 1XJQA 3VC3A 4E7PA 4JJ6A 3ZOKA 2DR2A 1Z6QA 3TB6A 3ADDA 3LIIA 1J5PA 4RHTA 3KDAA 4QU8A 4KQCA 2P41A 4Y6SA 1VGQA 1T36A 3GJ7A 2C04A 3NHWA 3TWOA 4C4ZA 5I9IA 5LWQA 1JUDA 3FB1A 2K7ZA 2H48A 2BFEA 2EQ5A 3DDOA 5HPYB 4ZV4A 3QRWA 3C7TA 3C98A 1NJ2A 2VZ0A 5DTEA 5IW8A 4B3CA 5BN1A 2Q3JA 3MS7A 5ENDA 5B3AA 3VGJA 4A0SA 3ETJA 1ARZA 1XZLA 4C4YA 2VTEA 4M1EA 4OA8A 5EHNA 1T9GS 4ARBA 4EA7A 1OCEA 2I4RA 1SA0B 3BUSA 3JAWB 5K8VA 4ISCA 1Q3HA 3HWRA 4R41A 4YN3A 2CXTA 4KQ6A 4A03A 4E03A 2I6FA 3BICA 4IDBA 4MVJI 1O0BA 1P44A 3LGXA 4ZCMA 4OI0A 1JDZA 2VPZA 5C9ZA 2R6HA 5DHAA 2AG1A 3UAWA 4TRMA 1XHFA 4IV8A 5FOTA 1ZIXA 4Y0AA 1Q91A 2LVBA 3I2HA 3WV4A 1CX9B 1JE0A 3V1LA 3ZN2A 2HHAA 4ARSA 1O95C 1JHOA 1DAEA 4KV9A 3EBLA 2R5WA 4UTZA 2AMFA 1QHEA 2JGEA 3F74A 1N7HA 2CCGA 4C0WA 5JXGA 4IQ0A 2ATCA 4INAA 3DEJA 1ZOOA 5WRFA 1IG0A 5KNCD 4NMLA 4PYLA 1ZM9A 1QV9A 1Z26A 1JDSA 1FS5A 2PZLA 3FG9A 4JROA 3VV3A 3DBOB 4AZ3A 4B3IA 4ZI2A 2I03A 2NADA 2R1VB 1SZJG 2C8KA 5FTMA 1NPTO 1BJRE 1BRTA 1NE7A 1TECE 4H18A 3U13A 1N78A 1FXWF 2C4KA 2H3HA 2Y6VA 3EGXA 1EDEA 4LJ9A 4MQBA 3IR7A 3K0FA 4CCSA 3IERA 4JVMA 4KXLA 1E4YA 3PT9A 4RF5A 1QX4A 2A7QA 4UHFA 3LSYA 3ZWWA 3WMFA 3EXFA 1I3OA 3BH7A 1KSJA 1X7HA 1QZXA 4LYDA 3NM4A 3VR6H 3TN7A 1TJYA 2Q8NA 3HEBA 3WKDA 4C4XA 4C4PA 4NXNB 2OORC 2V7VA 3JYNA 3OMWA 2WIBA 3EODA 5DP1A 2NACA 4GPTA 1CR2A 2ZU6A 3C43A 3EWNA 4RIEA 1P0IA 5AM2A 2ACVA 1QTNA 2Q1XA 4HQRA 4OHVA 3SYTA 4DN6A 4RKYA 1SHZA 4LMPA 3RHSA 3RG8A 4D79A 1MQ8B 2FMTA 1J22A 3CB2A 5H8WA 1EFPA 4YUWA 3H65A 1PQUA 4E6PA 2PTGA 4CR8A 2RARA 4LRXA 1HH4A 4JLUA 4CQMA 1AKTA 5AIBA 5F4ZA 3GL9A 1Y9ZA 3EXHA 3ANMA 1NUHA 3KB8A 2QX6A 1M8GA 4G1VA 3M9XA 5BSHA 2H59A 3R44A 4AX8A 4P0PB 2ACEA 4OBWA 4DXDA 1IOVA 3HCWA 2PL5A 4RLQA 1ATZA 1Z2EA 2AW3A 3PICA 2JIQA 2FPPB 5I9LA 5JVDB 1U2SA 2XNKA 5CW1A 5JJLA 1N92A 2XA2A 1K2WA 1O9GA 3D02A 2X2PA 3FETA 3PU6A 4N0PA 4ROTA 1RM5A 3UBMA 4CQMB 4L5BA 5JI2E 3N76A 5REQB 3OZTA 4FR5A 5JOQA 3VHRA 1TVEA 2HQBA 3MK31 4F5ZA 4R2XA 5E1MA 5AM4A 1ECPA 1GHTA 2NU6B 1KZ9A 4R71A 5KOHB 5MDHA 1D1PA 4UREA 1H2YA 5EXSA 4H59A 4Z6KA 3RSZA 2G6BA 3I1JA 2NO9A 4X60A 3BWCA 2VEOA 3PC7A 2R87A 1MQ9A 3HZRA 4H27A 2WIAA 4MJLA 3VI3B 3SZGA 4EMBA 4QOSA 4Q1VA 2X9QA 4IOJA 3OI7A 5KQRA 3KUUA 5DSZA 4IEEA 2HA4A 4YRBA 1CY7A 1CW2B 5BV1A 4JZKA 2Q6OA 3PFWO 5ELLA 3JPWA 5HGXA 1C80A 4R01A 3PC8A 3D59A 5HILA 2IBMA 1NVEA 2OESA 5EIBC 5G0TA 2VJNA 3OM8A 2I6TA 5I4IA 2X0RA 3E9CA 5AOBA 5JADA 2O3JA 2VATA 1R8SA 2JAHA 4BUJA 2PO5A 1UC8A 4CFZA 1UBHS 3DUFA 4JYAB 1IDN1 4Y9DA 1NSFA 5BNTA 4OUKX 3G23A 4AF8A 3LF1A 1O94A 4LF9B 1ODCA 4D3DA 2BKLA 4XGRA 4L3WA 3VR0A 5B3JC 1JV2B 4XVRA 2QP9X 5ES4B 4N8SA 2PZ8A 2V5AA 2Z98A 2BHNA 3LCCA 5KREA 3ACBA 1L5VA 4EKYA 3BTOA 4CEIB 2EIXA 2QXUA 2WSMA 1P1CA 1XTBA 3S29A 1QCYA 5BQFA 5KTOA 3QYFA 4LOHA 5KAPA 2WPNA 4FC6A 3Q1LA 4FOOA 4MRPA 4UXIA 4DMCA 3MMNA 4KHPB 1TU0A 1GCIA 3GBPA 3GI1A 5KYYA 4GEGA 1MAUA 1RXSA 2PT5A 1MZPA 1N33B 1KE1A 3KPWA 3WRYA 2VJBA 5CK5A 3JY6A 4EHDA 1JYSA 3B1XA 4G0WA 3F49S 3GVIA 2HHJA 3IBGA 1OAOC 5F76A 1J8YF 2FEKA 4RBNA 3WOHA 3DGEC 4Y67A 4GI2A 2XH8A 3ST7A 2CJYA 3SMVA 1KI6B 4CTOA 1CUEA 1P2DA 1NXOA 2F43B 3UJNA 4HDAA 4QYWA 5ALMA 1ZW6A 5HMLA 1FRFS 5KC8A 2C92A 3ED1A 4IX1A 4LRSB 5J58A 5K4HA 5AQ1A 1RXWA 5AVUA 3K73O 2D06A 4PR3A 3PUIA 4MWOA 1LQ2A 2PN1A 4XI9A 5DB4A 1IVNA 2FSHA 1UFRA 4QRIA 1WAMA 4B6FA 1R12A 3DYIA 1XT6A 2AYXA 2ON6A 1JSXA 1SCQA 1WVIA 1CY0A 2Q99A 2RH9B 2XNJA 1OHHD 2ZATA 3FUTA 5H7XA 3V2HA 2AZXA 1E2GA 3EXHC 4XJVA 5FBWB 3RK0A 3DDWA 3UAVA 4EG8A 1V4BA 3LPAA 1AQIA 3RKUA 2VQDA 3MMZA 3ABRB 2HJRA 5BQOA 4YPOA 4QD3A 3KT0A 1HYBA 2DLNA 3EW7A 2XB9A 5AJZA 5ALWA 4GOND 1X70A 1ML4A 3ES9A 4KIJA 4P4SA 2ZXUA 1G8GA 1QDEA 1F8GA 3T8YA 4CR6A 2QNBA 1NNEA 4V0NA 3NWPA 3PQ4A 4W9NC 4I46A 3UBTA 4KAAA 3F7NA 2RSLA 2KBEA 5EHZA 5B1IA 3BWEA 3C1UA 5KTMA 4PXSA 1V1RB 3EH1A 4FR2A 2YR0A 2AFVA 1F12A 1I2DA 4MRMA 3RVDA 4MSUA 1BW9B 1YL7A 2KX7A 3E8XA 5DGCA 3RABA 4ZQBA 1GUAA 1W59A 3ESCA 1V48A 2I1LA 4EJ0A 3GGGA 1I3CA 2P5YA 3NHZA 3U4GA 2GJ4A 1Z08A 4PHTA 1G8KA 3MTGA 2IUUA 4IY1A 2L2QA 4P7KA 5BO5A 3STWA 2A0KA 3TS1A 4KV7A 4OJYA 3D5TA 1BE6A 4L8YA 2I67A 5CDGA 2WD9A 2O06A 5F7JA 5DHSA 4L75A 4EG6A 5LD2B 3DTVA 2XGOA 1SXIA 3QU4A 2GUWA 3T54A 2XBLA 3VKHA 2PFGA 3U1VA 2ORYA 5FHRA 1XA0A 3G6WA 4BATA 1E32A 3OH8A 2YWJA 3I30X 5BRAA 3ZE1B 2VNKA 1BCSA 1QVZA 2R6FA 3UANA 3QXXA 4B75A 3UXHA 1ACLA 4BNUA 3QTTA 4AKTA 1O0CA 1C81A 1EWTA 1RIIA 2ZDHA 2XBUA 3JQ8A 4PBSA 2VAVA 4ZTUB 3Q10A 2GXAA 4DLYA 1W2GA 2FRDA 3W4JA 2VDWA 4WXEA 3ZIAA 2IBTA 5BW6B 5L4SA 4RANA 1WUIS 4WA8A 3IIMA 3D8RA 4MJ7A 2BF7A 4NCAA 4ND2A 2FMXA 1OILA 4N3NA 1LJLA 4P6VF 1R4NA 1CD5A 1Y8RB 4IQ8A 3VU0A 4HMQA 1ZR2A 2YV1A 2I7XA 1HM5A 4GZ5A 2G04A 3C6QA 2EZUA 1M1YE 1O97D 1RM0A 2KLHA 2MYUA 2HSEA 3MINA 1RXCA 3T94A 1NBME 2W6ZA 1TLFA 2VDWB 1OJ7A 1RLTA 2RAVA 4DMFA 2Y4OA 2AN4A 2FFAA 1ZJ4A 2Z95A 2C4HA 1MRNA 3H5NA 4UNSA 1HYHA 4L8LA 1XP5A 2XD4A 2XDQB 3NV7A 4O2LA 1OZFA 4YA6A 5HMMA 3ZHBA 2H0RA 2O23A 4P58A 1KBOA 2FSIA 2IPOA 4R1OA 4MKHA 1KEEA 2AN5A 1X7WB 2IY9A 2QENA 3MINB 1WVGA 5T5QA 1OFTA 2VEDA 3GG9A 2I4OA 1GM5A 4RIFA 4U7FA 5TIIA 1AGRA 1RXVA 5K6TA 3EDOA 3PHLA 2FQWA 1UJ2A 3BHNA 1VJDA 1HXHA 2XB6A 3L82B 3FCAA 4FINA 1Q19A 2JCGA 4D42A 4PSUA 3WSVA 2LRHA 1P60A 2WW8A 3DAOA 1UMDB 4YMVA 1G3MA 3PUXA 1V39A 3Q3JB 4QFCA 1EFAA 4RZHA 4QOIA 1QRRA 1NQUA 4D3ZA 1KJJA 3UTDA 1VECA 4DKJA 5J4LA 2XQJA 4FQ8A 2JAQA 3QTBA 7MHTA 4QLAA 5IZCA 4URHA 1SPBS 2OHGA 3RS9A 3SKVA 1YGPA 1GZ6A 2QXTA 3P9QA 4JR1A 4NL4H 4OH7A 4ZU3A 5LMUB 3KJHA 3NTXA 3UHPA 1YI8A 1OI3A 2GAJA 3IQFA 1EM6A 1IBRA 2VYND 4LE1A 2ZUVA 4P35A 5CT5A 3R7WB 4AT1A 1C3OA 4WZ6A 3NU1A 4CM7A 4P2GA 1K6IA 2O1WA 1N5IA 2IODA 4U2KA 4W7IA 2AC2A 4PS1A 3WIBA 4EB6B 1JU9A 4J0IA 2H17A 4W7HA 1P2BA 4II3A 1H4TA 3USES 2ZQYA 4Q1CA 3NPAA 1JDPA 3M6UA 3OT4A 5IT9A 1YD7A 3AR6A 3K9WA 3PD1A 4G81A 1U9IA 1VG9B 5J1TB 1WQ3A 3MWEA 3RSHA 4DT1B 4UUQA 4DNQA 3B6IA 3OF3A 2H1IA 2YIJA 3FYTA 1MABB 4WBXC 4PTLA 3W6OA 5A02A 2WKRA 2ORIA 3HRKA 4X3CA 3G8AA 3W5VA 3IUSA 3PWTA 2BV3A 2G70A 3V4FA 3PC3A 3HCBA 4O1IA 1LBQA 4FYMA 4G9BA 4CV0A 4DIMA 5KO2A 1EB8A 4WRRA 5HW0A 5HKLA 1AU9A 2NVBA 1J2RA 5DYTA 2QRGA 2YCLA 5DX0A 1XMOB 4NJEB 2RHGB 5CIQA 3QVLA 4TYWA 3ABZA 4E4TA 1VJGA 3PC6A 1UFOA 3L92A 3BQMB 3R75A 3FCXA 3OM1A 4J03A 4CLHA 2HRQA 2FUEA 4IWNA 1BXGB 3G2MA 1FBTA 1E5LA 5FP0A 5T41A 3RSQA 2R1TA 3T7IA 7AT1A 3G8CA 2ECPA 4OJQA 4QJ4A 3DPSA 2YJNA 2EZTA 3JD4A 1JEDA 4R84A 4WZAE 4MW9A 1XPJA 1AE1A 2GHTA 3MTDA 4QU0A 4U7JA 3LX8A 4IMPA 1R0SA 1CZNA 1PSWA 2NO7A 2O0LA 4WKGA 4GOLD 2D5BA 2G09A 2OSVA 1QP4A 1JHXA 1R0YA 3K0CC 2AV6A 1DT5A 1P45A 2UUPA 2HQ1A 1QONA 2H65A 3LPNA 4P3PA 3AF0A 3LHDA 4L7QA 1E1KA 4QZVA 5JDIA 2QQ0A 2RK3A 4U0KA 5LLSA 5AW7A 3PUWA 4I6EA 1Z16A 3N28A 2PKWA 1O9BA 3KB6A 4JQYA 3OVMA 4LHZA 5P21A 2AK3A 4RXTA 4YMWA 3AFHA 3BFXA 3WLHA 1XU4A 4GWKA 1EX6A 3LL7A 2NNLD 4HTFA 2PSSA 3MRXA 3QUSA 4O1HA 3ZE6A 2NWQA 1JDBC 2ZRQA 1BQ4A 4K26A 1U7OA 2PGXA 5DLEA 4IGKA 1F2UA 2JDID 3VDQA 5B6PA 1XWFA 2W11A 1DWQA 2JD1A 3LOUA 3TQRA 4K9MA 3OE7A 5KKAA 3R0VA 3D2CA 3WBFA 4BVLA 1JP7A 5IBPA 2Y8EA 4C3VA 1P77A 2CFOA 5B58T 5A4KA 2CCJA 4Q02A 1JJVA 4U7WA 1WOYA 3R0JA 1MVOA 1UMCA 3AILA 4BNLA 4DHWA 4W5QA 1C30B 3E3AA 5T64A 2JH3A 4ILKA 3FOWA 3TR6A 1CY2A 3JWGA 2MTBA 4CPDA 1N0VC 4DA4A 3A4LA 3CVUA 4LDQA 3QKUA 1RJGA 2D1RA 2C9CA 3KOWA 4NTZA 5GADl 1X7GA 1UFQA 4C0QC 5EERA 5TC4A 1DCFA 4Y2TA 4XB6B 4OP3A 4RD0A 2R44A 3SVTA 1P61B 3DGFC 3IP1A 2ZSHA 5C8YB 4I9UA 5F12A 3DHNA 3WTCA 1YS4A 5HF6A 3IAXA 4PAWA 2QMYA 2W8BA 1QCZA 1MNQA 2GBPA 3AHCA 5EZYA 3MGBA 2P2ZA 2X7XA 4INOA 5JFTA 3NHPA 3RC8A 5E4FA 4ENSA 1QQBA 3TEMA 3WZ2A 3A3YA 4CUZA 3BB4A 1GCOA 2JHFA 5AVTA 1VCHA 1K5DA 6LDHA 4G5RA 4V0SA 4TYMA 2JLUA 1RLOA 2AG0A 4U0JA 5EPOA 4UAVA 2QNRA 2WT9A 5CHYA 1T15A 2ZJ7A 3IEPA 2X0NA 1Y8ZA 4V0MA 3EY9A 1AY0A 1E2QA 5H3HA 2DTDA 3F4LA 4Q5IA 1BS2A 1I2MA 2J48A 3EEQA 3LOPA 2C7GA 1W0KA 1KBZA 1SVKA 2IYAA 1KO8A 3H2BA 4GWLA 2FZWA 5K2MA 5IJZA 1AQJA 4DC1A 3R9IA 2AF4C 3EIUA 3IV6A 2D00A 5CJJA 3TTSA 5EUBA 4ARUA 2O57A 2XTAA 1JA1A 1Z0AA 2C03A 3FKSD 2I8LA 2Z9BA 1YA6A 2UAGA 2MIIA 2C7PA 1G38A 1Y4AE 1HR0B 1V26A 3JYLA 3OZFA 4IJMA 3ROXA 5I7HA 3II6X 2IV2X 1YHNA 3LVRE 4FEAA 3LX6A 1JQEA 2OCBA 1Y8CA 2JFNA 2OK8A 5JATA 4F9TA 3FSEA 3EA4A 1CF4A 4L7VA 4NZMA 4LX8A 2DPHA 2XUDA 4IDOA 1EFLA 4Z1MD 2JD0A 4GU5A 5L8VA 2BGRA 4F9EA 4IAOA 5CB4F 4MAMA 5GP1A 3WWCA 3TSWA 1X19A 3EFOB 1GPMA 5FXMA 3KYCA 2PPLA 5DI3B 1BZYA 1VP3A 1G64A 3CKYA 5H82A 5LP6C 4H1HA 2JGNA 2C1EA 3WLAA 4AW9A 4OAOA 2YUIA 3X1KA 1D07A 4L8GA 2I2CA 2O7RA 2Q3FA 4TVKA 2JFOA 2PT6A 1IXZA 5JSHA 1XU7A 5FOSA 2O50A 1E1RD 3M5DA 1O9HA 4PRKA 2HQSA 2RJ3A 2C9ZA 1X2EA 1OIVA 2CYAA 3G5UA 3KKZA 1TQHA 1XJWA 3FSJX 2JD2A 1NZDA 2H4JA 4EG1A 4PINA 4A36A 2DF8A 5BVHB 1RLIA 2XE4A 2XT9A 4XKJA 1SHLA 4XFJA 3L0YA 5EIFA 4BZXA 3P2MA 4JH0A 1MLDA 4YMHA 2JAOA 1A2KC 1X1DA 1KSFX 1DS6A 4PSCA 1DEAA 3C3MA 4NKRA 2PANA 3VR3A 2GZDA 2Y67A 1NT2A 2PYZA 1KO4A 3CH7A 3P9SA 5JROA 4BIIA 2I6QA 1Z5PA 4Q7KA 1LSOA 3DNMA 4Z4HA 2FNAA 1TF5A 2PLAA 5BRJA 4EUFA 1N2BA 4N65A 4OJNA 5ALGA 2ID8A 2PKRA 1KWGA 2FJUA 4PLYA 1Q1ZA 4C4OA 2Q28A 2VRBA 3V2IA 1WXHA 4GS5A 4N12A 4RHXA 1JHQA 3PYXA 3WMEA 3CZCA 3PQ7A 3C8ZA 4TWZA 4EBFA 1PJQA 1JLLA 1Z6PA 4KU4A 5F1YA 4DZZA 5KNBA 3FVVA 3HPRA 4GKVA 1XZAA 1A27A 3KYBA 1FCJA 3L4KA 2XVXA 1T4CA 3CRRA 1BGVA 2ZB8A 3WWYA 2OBNA 4YUVA 1I4DD 2OEPA 1QS0A 1RVV1 4BUZA 2HJWA 2OGSA 5K0SA 3AERB 4YV1A 1VPTA 1U02A 2V96A 3EGDB 2BTOA 5JCXA 2Q6TA 1XNJA 3W79A 4BBAA 2HBRA 3TFQA 2QI9F 1AMUA 3JD0A 3WL8A 2BHLA 2X58A 4NSNA 4ZV9A 5J40A 3RO7A 4M87A 5C46F 1KMHA 1PGPA 4RWEA 1T1SA 1BD4A 1KZGB 1GTVA 1GU7A 4RM3A 5EYPB 4B9AA 1E9CA 1PSZA 3FUXA 2OLKA 4KQIA 4DV1B 2IYQA 1TJPB 4B6QA 1Z15A 3D6JA 4PX9A 3GLFE 1EJ0A 1QHHB 1T0IA 4RPLA 3BFKA 1C8BA 1QGUB 5T7BA 1M6NA 2Y05A 1NFQA 2DT5A 3HXPA 1KYVA 1IN7A 3G49A 5AKXA 4J90A 4ZT5A 5TMPA 2PRSA 3C3BA 4WLOA 1A8UA 3HO1A 2XMPA 2ZYTX 4DQKA 3B82A 3OICA 4K3UA 3EARA 4HO1X 4S3MA 4B71A 3ZDXB 1J0BA 1OLSB 4Q12A 4F4JA 4TT3D 4PBTA 1PBTA 1HTWA 5E6RB 4AO7A 3PEWA 5KTPA 5CVUA 5GGYA 3TJZA 1WUHS 4MVJF 4WJKB 1V1MA 2OO3A 4KPEC 3W3AH 3RVRA 4MRVA 4EJSB 4EZIA 3IDOA 4EF4A 3U7RA 5ER9A 1SULA 3RIGA 1QVWA 3U26A 2BFCA 1OPXA 1Z5UA 2XYPA 4QUBA 2EX1A 1D3AA 2TMDA 4N8EA 1GPWB 5COAA 3CRZA 4QNRA 3PF8A 4AD8A 2RIPA 2YASA 5M29A 1U80A 4J75A 3W6UA 3O74A 3ZWMA 4P5EA 3AZPA 3DDSA 2OYRA 3TUZC 1OY1A 4ZMBA 5IDWA 4FSDA 2EGHA 2YYAA 1P3JA 2ZJ8A 4J7CA 5I3ZA 4DSOA 2ZTVA 2Q62A 5EZ5A 1FFXA 4LRQA 5K6AA 4B09A 3SHWA 1AK2A 5CEJA 1KXZA 2OYCA 4GD3Q 4PYKA 4ENWA 2IXTA 4YXFA 2VTDA 3RUFA 3VHXB 2D2VA 3OX1A 3FNGA 3KWFA 2FTKE 2HNAA 1FDOA 2E1PA 1CV2A 2X1LA 4HH1A 1Q1AA 4M7RA 1XJ5A 3HZHA 3E9EA 3EXFB 3NT4A 1E2LA 4R51A 3TLAA 3ZQJA 1S7CA 4Y2HA 5AJYA 5LZ2A 4Z4GA 3TZEA 3V00A 2XCRB 3I1YA 3W5SA 2VCEA 2IPMA 1JEQB 3V9AA 1BFUA 1QTQA 2SBTA 3DEIA 3GRRA 1ZESA 4S1WA 3IEUA 2D1YA 2JAXA 4OXKA 1OBFO 4ARZB 5LZ8A 3UOWA 2F1RA 1F1BA 4YLEA 2X40A 4R8LA 4BQSA 3PX3A 4PZPA 2JLRA 4FK8A 5HK8A 5EUMA 1NI3A 3ONVA 2JIZA 4RHYA 1B6SA 4INPA 4M86A 3S2UA 1G6KA 1NMSA 1IAVA 1S3GA 4J0HA 2DCUA 3O8QB 2Q2WA 1E6CA 5IMBA 4GT1A 3MC1A 5D5HA 4YT5A 1HETA 2NOAA 4OV6B 5AW5A 4GIBA 4RJ2A 4C03A 1LUAA 4YYEA 2H2AA 3QKRB 5KDLA 3SGLA 1DBQA 2O0HA 3DLTA 3OESA 4BO6A 1NXWA 4F7DA 5CYGA 4URXR 1Q1QA 1GRVA 4MW5A 1XTRA 4F96A 4FQ5A 2EF1A 2FH5B 2F2TA 3Q8WA 1Q0HA 2OECA 1SIOA 3QBJA 3INYA 1DL5A 5KS2A 2FPPA 3P32A 4IP0A 1H2AS 2VDMB 3MJCA 3GEGA 3DA8A 1PW5A 1C9EA 4QPNA 5F3WB 2NUPA 4YRTA 5K3DA 4A0RA 5CAEB 4E31A 3WNZA 1C7ZA 1G2PA 3R3VA 3TZKA 3FRIA 3OTIA 2ZI3A 4LJ6A 2JLVA 3SBDA 3AR4A 2Z3VA 3ZQKA 3SZRA 2QN6A 2CDCA 1NATA 1HDGO 4MV0A 4RK7A 3AXTA 1GD1O 2C2XA 3WMGA 3F73A 3STXA 2H51A 3DF7A 3U4DA 1ESMA 2WJ6A 2LZ0A 4IIUA 4C4SA 3DDNA 3EX7C 5A0VA 3I76A 3OJLA 1MKYA 4BX8A 4AVYA 5KTSA 2OWDA 3X1XA 3J80A 1ZJYA 4D8XA 3GN2A 4R05A 2Z2JA 4IIFA 5HHTA 1FNBA 1RJFA 5F5LA 2GF0A 5HVNA 3IAM1 2WKWA 2HF2A 3EYWA 3LNCA 4NCKA 3E5RA 2B6NA 4TQGA 2CE7A 1PNVA 1C3JA 1OJLA 3CR8A 4IIYA 4PLVA 3DMTA 4PG8A 2FSVA 2FUG1 2WUWE 1NN0A 1GPUA 1DAPA 1GCUA 4RADA 4JASB 4N48A 2X9NA 3WK8A 4IHJF 4IXMA 1FP4B 3FOBA 4K9OA 2O1XA 3FHTA 1SURA 2QTRA 1PR5A 2QRQA 5BQ5A 2XUFA 2F8MA 3E35A 4YQFA 2ZT8A 4YASA 3AHFA 2W98A 3FR7A 4IFBA 3PTLA 3HB7A 3LRXA 3TCKA 5KSYA 2QT1A 4GICA 2C61A 4C5CA 3WE7A 3KUCA 2A0WA 1DJNA 4BBPA 2W71A 4GP9A 4BP8A 3B3FA 2Q5FA 3COYA 1JKJA 1ZM4A 5E38A 5E7QA 3V4LA 2F67A 2JGKA 2YDXA 2YX1A 2ZBVA 1P9WA 1YIOA 4RZXA 1Q0UA 3L6CA 4XZ3A 5IM4A 5L3QA 1DWUA 3EEIA 1ZISA 1STOA 3E7FA 5LB4A 4PYOA 1FDUA 3FH0A 4BMCA 1JFFA 1NBAA 4TSFD 3FW1A 4FB4A 3B6EA 2BEVA 3LUPA 3MFYA 3FBGA 1O0SA 2XUPA 4MI9A 2C0CA 1L4BA 2GD0A 4PYMA 5H3LA 4WERA 1CK4A 2XYRA 1VCNA 1ZCZA 3DTNA 4P54A 1N1EA 3SR4A 4HXFB 1OLOA 4MJXA 2V5UA 1LTHR 4DLLA 5L3QB 4M0MA 4G84A 5GMOA 4B6EA 4I7EA 2NYUA 1B2RA 1SQSA 1TKAA 1E3EA 1TADA 2WWVD 1G8HA 3PZRA 1R64A 5IZ4A 3CX4A 4ZTZB 1ACJA 3K72B 4C21A 3ZDBA 1PQPA 4YJ2F 2H2IA 2RI1A 1CZKA 3OC6A 3TDKA 3FBTA 3MM4A 4ISBA 1R8YA 4FYVA 1U9JA 1PYDA 2B8JA 2ZUSA 2Z8ZA 3H9GA 2IU0A 1YUNA 2PKEA 1XNQB 1YDGA 1U1DA 2AWOA 2W2PA 1P7CA 2FRXA 3U7GA 5BN5A 4HCJA 2PSJA 4OHFA 3HKBB 1DUVG 5AW9A 3U48A 1BN7A 5CDYA 4JI2B 3WK6A 2H4FA 5EXPA 1EG2A 1O3YA 3BRWD 1R0CA 3DEFA 3SEFA 2OBYA 2NT4A 4TLLB 1XEWY 3GXBA 4DCNA 4FOSA 2O2HA 2FK7A 4LFAB 2QRVA 1CUSA 4MRMB 4YAEA 3H7AA 5TEWA 5CA1A 3V1TC 1GG8A 3PTZA 4JUFA 1P29A 1M7GA 4HDRA 3NHKA 2WB4A 4GNRA 3R76A 2NU9B 2B8EA 2E5WA 2IYOA 3JQGB 3P9IA 3ENKA 3EHEA 1DC5A 3DEAA 2GAAA 3GMTA 4Q48A 5I6DA 2EVWX 1I30A 2VRCD 4JEUA 2O3TA 4MV8A 2QGZA 1Q0QA 1L9KA 1CQWA 3WB2A 1RAEA 4I81A 4WT7A 3RYIA 3MB8A 2D3TA 5KSPA 2WFLB 4O29A 3F97A 2XUZA 4MVJE 4YLGA 5BT8A 3UKDA 3CPJB 1O95D 4KR9A 3BE4A 3WGOA 2ZT5A 1XHLA 4TT8A 2NU9A 4Q7JB 1RRPA 5ESDA 2ZIWB 3GAFA 3FTFA 1YVRA 2OCPA 5AI6A 3OZAA 1ZK2A 3MTIA 3BRCA 4AXXA 3ZWVA 5ILQA 2AGVA 3IP8A 3OPMA 2A67A 3A6KA 4JIGA 3JQBC 1UPXA 2CNKA 1Z82A 4LXYA 2W6OA 2B1RA 2GEKA 2GILA 2QTMA 2QVYX 3P2IA 2X3FA 4B31A 4RZ2A 3Q2KA 3QLVC 4IO1A 3SLKA 1XZQA 6NULA 3DFZA 4FE7A 4BEJA 1N9GA 1Z6GA 3HN7A 1OAAA 5ESXA 2GCNA 2J6IA 3JALB 3FUUA 3E15A 3KNZA 2CVQA 4J16C 4YHBA 4ZCPA 3RFUA 4N4AA 2QX9A 4RHEA 4ZEWA 3V6MA 4XWKA 3BDAA 3CR3C 5B37A 1E99A 1Q0PA 3OPNA 4RJJA 5CA0A 3HUUA 3UMJA 4MQ5A 3RWBA 4F3TA 4QVIA 1NYRA 5BSWA 4E94A 5A4DA 1YRAA 4AS1A 4XPZA 4TKLA 2BDEA 4NQRA 3UMVA 3FOAA 1FVHA 1X3LA 1EESA 3CSSA 1CJTC 3Q6IA 2NVUB 1IG3A 1Z4PX 4LC9A 5ADWA 3DJYA 2Q4TA 4HDSA 1GZ4A 3LMKA 4R1NA 3KSBC 2D4AA 5THQA 1X42A 4G9GA 3PB3A 2O9JA 4RQAA 4G56A 4CHGA 1R9JA 1R6XA 2FSUA 5KSZA 1URPA 1D0IA 3L4BA 3IOMA 1WDMA 3FF1A 5K0LA 5KTYA 5G0SA 2NTYC 4YRDA 4E5DA 5A4JA 3QEBZ 2BY4A 5CK4A 2WSSA 1BVRA 5K0JA 2ZETA 3B1KA 3PSAA 2A8YA 4TV9B 3SDBA 3QX3A 1SU8A 2ZAGA 2PMFA 4A8JC 5JFGA 1T2NA 4QUJA 4K03A 3OC0A 3M6LA 3QKSB 4EL5A 1UAGA 2F9FA 2QIOA 3AVWA 3LT4A 4R0NA 2PRJA 1YR6A 4Q3AA 2PSHA 5TE9A 2CXRA 3WYFA 3WOVA 4ZQEA 5HDBB 1IJBA 4XIJA 1BG6A 4RVFA 4U2EA 3WGQA 1XALA 2LNDA 5HYVA 2Q0SA 2FEMA 5DTJA 1VMIA 5FOUA 1IPFA 2IYFA 4FMPA 1XZBA 3ZC3A 1DP4A 1UMBB 3TQCA 2DY0A 2AUTA 3GJ0A 1E1CA 2PWPA 4I66A 3BBLA 2PMDA 3QI2A 1LDGA 1VKZA 4DCSA 3IVXA 5B53A 4V39A 4F11A 1DCMA 3ZNNA 4RYLA 3PNKA 5LCXA 1L7AA 3OE1A 1XV5A 4TLBA 1ZW1A 5LQMA 3I42A 3LZCA 3RAGA 1J97A 2JI6A 2DHRA 3ZHXA 1DQRA 2UZ4A 4Z9XA 1YBVA 5K9ZA 1YGYA 3PVSA 4EFMA 4RA6A 3GVHA 3BREA 2FDCA 3M1LA 4L5IA 2YXDA 5SZIA 2G83A 1MAAA 3PCTA 3GG2A 4OQ4A 5B6JA 3T3HA 1AKWA 1JPVA 4JXKA 2BR4A 2FDXA 1K6XA 4AS3A 1F4PA 2V7QA 4EOGA 1BH2A 2ZR0A 4G1BA 1IXYA 5TVGA 3KP1A