3JQFA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 1,3,5-triazine-2,4,6-triamine (ax2)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 92
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqfA00
3EW7A 3JD4A 4GWKA 4KMSA 1IHXA 3KYCB 2VQ3A 4L9RA 1X1TA 1NPDA 4BIIA 2PKQP 2X9GA 4U5QA 3PP8A 3Q2IA 3DFZA 4R54A 2BFPA 4G81A 3ZW8A 1G0NA 1P45A 5EMHA 1A72A 3OJFA 1XQ6A 3RFVA 5EL0A 3CPSA 1KY4A 1NQAO 3V1UA 4RQTA 3T7CA 5JXWA 2IODA 4GGOA 1E3EA 3A06A 2GNAA 4IGFA 3AUTA 3F5QA 1KS9A 4FN4A 3TZHA 4NK5A 3WWZA 4BMSA 2BGMA 4IINA 1ZEMA 4IPTA 4I9UA 1TLTA 2J3JA 2AXQA 4B8WA 4JX8A 4Y8VA 1XCBA 2HQ1A 1RYEA 2YFHA 2O48X 2PTGA 2Z95A 4YBZA 2HMVA 3GN2A 4A5OA 3FBTA 3HZZA 1ENZA 4LN1A 3VPGA 1DXYA 3NTQA 4FGWA 4YJGB 4J9VA 4AJ4A 3TQHA 5ENDA 3TOXA 1DIGA 3DOJA 1H6BA 1HXHA 5T8KA 4NDNE 2X9NA 2XPCA 5F3RA 1WVGA 4FR5A 1T24A 4XYGA 3RJ5A 3VPXA 4KOAA 1AXEA 3U4HA 1JU9A 1FK8A 5BNIA 4GWGA 2VOJA 1ENPA 4JBIA 2QRLA 3I9LA 5CDSA 3PJEA 3RUCA 9LDTA 2P9EA 3AY6A 5AOVA 3M6IA 2NVUB 2ZB8A 3G1UA 3QWAA 2EEZA 1F0YA 2P9GA 4YJGA 3GDOA 2C0CA 4TRJA 2C2YA 1KOLA 3HFSA 4BKPA 2HMUA 2JAPA 4MVJP 4YCAA 5TIIA 4BV8A 3WYBA 5FEUA 2O3UA 2CDAA 2H6EA 3QHAA 1I0ZA 4ZRNA 1JLLA 3JYPA 3BMOA 3GMSA 3K92A 3IUPA 3CINA 2O4UX 4UREA 2RHRA 5THKA 3I9JA 1X0VA 3C7DB 5G4KA 5G4KB 3WYCA 1VC2A 2NV6A 4XB2A 5EN4A 2X5JO 3S2FA 4DYVA 3QVXA 1PGNA 1U8XX 3H65A 2X5KO 1XLTA 3K31A 2HDHA 5GMOA 4E2ZA 3KOUA 5L7TA 1E1KA 4DTIA 5CAEA 1I2BA 3FBGA 5L4SA 4O0LA 1OBFO 3PJGA 2EGHA 3DOOA 3ZU2A 1DFHA 2AMFA 2CVOA 3QY9A 2Y93A 2JD0A 2E48A 3HG7A 3S2EA 3PI7A 2HKIA 3X2FA 3PQEA 3KYCA 1FDSA 4I1IA 1QLHA 1BXKA 4LVCA 5CPFA 2P4HX 1UXHA 2DVMA 3KEOA 1RM3A 2DU8A 3PQFA 1PL8A 3UH1A 3RASA 1X7HA 3DHEA 3GZ4A 4U0JA 1A4IA 2WYWA 4MIOA 4A27A 1Z45A 4EGFA 4PZDA 2ZB3A 4TRMA 1NYTA 1HT0A 2UUPA 3GC6A 4AJNA 4PLGA 1YS4A 3EC7A 1PJCA 1Q7GA 4Q3BA 4D0SA 2DPGA 5B4UA 3WFIA 5BQFA 4D0RA 1YQXA 3GDGA 4IJWA 1E0DA 2PD6A 5ENVA 2FPIA 2ZTVA 4AL4A 4FPXA 4J2OA 1T4BA 1E7RA 1WAMA 4CLDA 3EDMA 3WBFA 2YUTA 4CLEA 2ZTUA 1CQIA 3NGLA 2W98A 2V6MA 3JQBC 3OFSA 4NMHA 4Q3AA 2GUGA 1LDBA 1LDMA 2WD7A 5HS4A 1DO8A 4JJFA 3DBLA 1VLLA 2G82A 1DHTA 1DFGA 4GKBA 5KVVA 1QR6A 3I4FA 1NPYA 3INRA 3JQDA 4B7UA 4OSPA 2I67A 5CEEA 2G76A 2X23A 2B5WA 5EQFA 1NNUA 4CR7A 1DIAA 3B1KA 1CRWG 2BKAA 2WM3A 4FB5A 1C1DA 4J91A 4AJKA 5IF3A 3K2EA 1GV0A 2GDZA 4MKRA 3OJ0A 4IQ8A 4OKIA 5CG2A 3QP9A 4J4HA 2PGLA 3RAJA 2ZQYA 2DBVO 4FSHA 1IHYA 2NNLD 2ZATA 5JAQA 4BO2A 5L40A 1E7SA 3SLKA 4AG3A 1KC3A 4S3MA 4E4YA 1F12A 4GI2A 5EIOA 2HLPA 3ZWVA 3EGOA 5I7VA 1O95A 1ULSA 3QWIA 1FMCA 1K89A 4M1QA 2IYOA 4BO3A 1KERA 1NPTO 2JFFA 4G65A 3DBVO 3ZNOA 4CLOA 1LRLA 1N9GB 1GADO 1GUYA 2CDBA 4Z0TA 2VWHA 4N5NA 2PV7A 2C82A 1N2SA 4NG5A 1HL3A 4NJMB 2JKVA 1UH5A 1NBOA 3IJPA 1LDEA 1DHRA 2DFDA 2VT3A 5C37A 2BD0A 3D5QA 5JYEA 3JQGB 2YV2A 2G5CA 1SOWA 1T2AA 4WNIA 4FFLA 5JS6A 4MKZA 2GZ2A 3PHLA 4UUPA 1G0OA 2Y1GA 2ZYGA 1V9LA 4MVJE 1DIHA 4W7IA 5DCYA 1E6WA 4LK3A 1I30A 1M6HA 2I76A 4M87A 3VTFA 4PZCA 3W6ZA 1LDGA 2WD8A 1PJBA 3I23A 1MB4A 3OIFA 2ZK7A 5DCUA 1NHWA 3LT4A 5L53A 2J8ZA 3TL2A 1K2WA 1I10A 3KVOA 4GAEA 4MINA 2D4AA 4JQCA 2DQ4A 2ZCVA 4RDHA 5BNTA 3ONFA 1CQJA 1L7EA 3N74A 3RQSA 4GX1A 5KJFA 3G3EA 1LX6A 5L4NA 4JP2A 4BNMA 1N9GA 3DO5A 3LK7A 2CDCA 1ZNQO 5DOVA 1GCUA 1U4SA 3E82A 4PLPA 1B8PA 3NKLA 1IPEA 3BTVA 1GZ3A 1UZMA 1WWKA 3HHPA 4YPOA 1TT5B 1HE3A 1I36A 4PLZA 4ND3A 1EDZA 1SEPA 2O3RA 3O38A 2V6GA 3ABIA 4FOSA 4IGEA 1SAYA 1CYDA 1R0LA 3F1LA 3I9MA 4B7CA 4CM8A 1QXSA 2EJWA 2E4AA 1YQGA 3ZN2A 2C07A 3H8VA 1BDMA 1CERA 1ENOA 4RCVA 3JD1A 1FDTA 3M2PA 4FQ8A 4JP3A 3ZV4A 1XQ1A 1J5PA 4QO8A 3JQ8B 1PGOA 4WLUA 3DBHB 2DC1A 3HDHA 3UCXA 3ULKA 3U0BA 1E1NA 5ES3A 1QRRA 4XGIA 4YYZA 4BNVA 3U9LA 5KOIA 5LC1A 5TT0A 2HRBA 3DDNA 5ADHA 3BIOA 3LF2A 4ZHSA 1YBVA 4LCEA 4QTZA 5C3MA 3L6EA 1VL0A 3TN7A 4ZICA 4J7XA 1G1AA 2A94A 4EYEA 4WKGA 2QQ5A 2YV3A 1LSSA 2H5LA 4TROA 5A9TA 3EZYA 3C3XA 3HJAA 1JVBA 1MLDA 2IRWA 4WLVA 5F1KA 1LC3A 1C0KA 4JBGA 2FMUA 2J3KA 1DEHA 3VZRA 3I6QA 3I4CA 1WW8A 3BTUA 4GQAA 4D3DA 4GX2A 3C8MA 1P1RA 2CZCA 2Y66A 2IYPA 5AYVA 4GGPA 1KIFA 4ZGWA 2EIHA 1Y81A 3PHGA 2XXJA 4P4GA 3KUXA 3I1JA 4OGWA 2P5YA 1DC6A 4TKLA 3S1LA 1GL3A 1UDCA 1PL7A 3PRJA 1L7DA 3ZWYA 3EAGA 4ZQBA 1PL6A 5ILOA 4DIOA 1HWYA 3E5RA 4CV3A 3G1TA 1UP4A 2BH9A 1FXSA 2HUNA 4JGBA 1E3WA 5CG1A 2E82A 4CV1A 4N18A 5B4VA 1UZLA 5JE8A 4GMGA 2OBNA 4BNIA 4CPDA 4R3WA 2ZCUA 3A9WA 3OBBA 4NIMA 2NM0A 4I5FA 4B4VA 1O6ZA 1JKIA 3MWDB 4BO7A 3ZWPA 5JAZA 1HDXA 3GF4A 3Q9NA 4HFNA 5I8ZA 1PZFA 3WQSB 2YFQA 3WJ7A 2GN8A 1LA2A 1X15A 3S55A 4ALMA 1GUZA 3D3WB 3OH8A 3RKRA 1XHLA 1JA9A 1LRKA 3VVBA 2JCXA 3MTGA 4U0KA 4TVOA 4QQRA 4D44A 3L9WA 3WLFA 3WYEA 4I9NA 4PLTA 2EW2A 4WEOA 3PHHA 1NQTA 3PQDA 4TQGA 3RCBA 3WB9A 1HE2A 1RKXA 2C20A 1QYCA 1O8CA 4HUJA 1KVQA 2Q1TA 2Q4BA 1EE9A 1YL5A 4FW8A 1WP4A 3VOSA 4TWRA 5G4LA 5DCWA 1ZSVA 1ZJYA 1JWAB 2GPTA 4EITA 5CDYA 1I5RA 4CR8A 1LLCA 2Q45A 2NU7A 4A03A 4R51A 4R16A 3DAGA 3NV9A 5K6AA 3RUEA 4DQUA 5T6BA 3H7AA 3ANMA 1WNTA 4YEDA 4NFHA 2J5KA 2Y0CA 4U7WA 1OMOA 1GTMA 1HSZA 1MXHA 5C7IO 3PPIA 2FP4A 4XQGA 1O89A 2O50A 4E12A 1HDYA 4FFMA 4YQYA 1PIWA 4YACA 1VI2A 3VKVA 1E1MA 1Y6JA 4FJ0A 5EQDA 3JQBA 1QYVA 3JD0A 3ADPA 5CPBA 2ZJ0A 4YWJA 2Q1UA 1PJ3A 4E31A 1GFSA 2JHGA 3E8XA 3H9GA 1GQYA 3LQFA 1JVSA 2VZ8A 1BRMA 4PLFA 5IXYA 1R15A 1P33A 4NH4A 1UR5A 1S6YA 1V3VA 2HO5A 5JC8A 2VYVA 3HN2A 3RROA 4NBRA 2NQTA 3GDFA 3P19A 3HB5X 4IIUA 4Y6SA 1GQQA 1KETA 4CMEA 2Y05A 2RH4A 3VH3A 4DC1A 1ADCA 1DOHA 1DJNA 1HKUA 4PVCA 4RV9A 5JCJA 4GVLA 2O3JA 4DXHA 3MOGA 3OETA 1TEHA 3GMDA 4WE3A 3ZW9A 3ENNA 1UXGA 2X0IA 2Y0DA 3MTJA 1VSUA 1YBAA 1JDJA 1EK6A 2WYVA 4MPDA 4WOKA 2CMDA 1PS9A 2YDYA 5A5EA 4OMUA 5IXSA 2BRUA 4TKMA 3WMWA 1E6UA 2QZZA 4TZKA 3RUHA 1A9ZA 3GFBA 3ITDA 4IDEA 3SEFA 4FGSA 5TNXA 3VH2A 1T2CA 5L51A 2VNSA 3DTYA 4ZQHA 1Q7BA 1YDEA 1X0XA 3TPCA 3U5TA 3WQRA 3OMLA 5CEFA 1ZK1A 3RC1A 2VRBA 3L9XA 1Z75A 1RWBA 1J0XO 3LZ6A 2NUAA 2AEJA 1LU9A 4RPKA 1N8KA 1KY5A 4CR6A 2X58A 3DC2A 4ZQFA 5IDQA 1PZEA 1LEHA 2P68A 3W8DA 2BLLA 4DLAA 1P1FA 2OHXA 2QG4A 5T57A 3ZHXA 4PG4A 1V0JA 1E6EA 3ZDFA 3WIDA 4MKXA 1I33A 2D5CA 2EP7A 4IJUA 2AE1A 4J3FA 3WGGA 1JKFA 3PGXA 5IZ4A 1ISHA 4HXYA 3FHLA 1ZMTA 4IIVA 4NU5A 1CETA 4M8SA 5COAA 4CMKA 1RYDA 3HSKA 4WLOA 3V1YA 3EVTA 5KIAA 1B14A 4KTVE 1BMDA 3GHHA 4PLYA 2AHRA 3F47A 1IZ0A 4OOFA 3RIHA 3ADOA 3ETGA 4BNLA 4BHTA 8LDHA 2NU9A 5THQA 3U4IA 3ZWBA 4WLEA 3FPLA 3MEQA 4PRLA 3JYOA 4YT2A 5IZCA 5DZSA 4J9UE 1B15A 3KB6A 3V2HA 4LSWA 1E92A 1UXIA 5AXCA 1EBUA 4HNGA 4QSMA 3VC7A 4D45A 1MX3A 4UULA 2AG5A 2NVWA 4YAKA 3FNFA 2J5QA 5A05A 4DVJA 3EVNA 4NPCA 3BMCA 1LTHR 2NADA 3OECA 5JY6A 4IJKA 4D42A 4MP3A 4PLHA 3B1FA 3RU7A 3FTPA 3HFGA 3QWBA 2OOSA 1NM5A 5CP8A 2ILTA 1Y8QB 2Y1DA 4XIJA 4XYMA 3QVWA 2QYSA 2I99A 1F8FA 2YHUA 4ROSA 5COQA 3R1IA 4JNKA 3TZCA 4IS3A 2C2XA 2TMGA 4IDCA 1X14A 3GAZA 4ONEA 4U6SA 2PGJA 1IL0A 1R12A 5K6AC 5BT9A 4DLLA 3HDJA 3MCVA 3PYLA 2DFVA 4IDDA 4Y6PA 1HZJA 1KEPA 3EHEA 1U3VA 5I9MA 1I2CA 4R5HA 4E2XA 4R41A 3RJ9A 1R16A 3GH3A 3AU8A 1OC2A 3UUWA 4K9DA 2PZMA 3FD8A 4Q3NA 4UAGA 3CZMA 5I9LA 2ZIZA 3GGPA 1WPQA 2D3TA 5KJ1A 4E5MA 4B79A 4BB6A 4BGIA 5L95A 1ZFNA 5DNAA 5L7WA 3WGQA 3JQAA 1AHIA 4CUJA 1JKJA 2D8AA 4YT4A 4C7KA 5C5IA 1XG5A 3F1KA 3Q9UA 2PD3A 2YJZA 1LDNA 3H9JA 3IP1A 4K1LA 4D46A 4Z0HO 2GD1O 1MFZA 3FSRA 4ND1A 3ONEA 4XRGA 1Y5MA 3BMNA 3C1TA 4DA9A 2NACA 2D1YA 4NR0A 4OKNA 1N7GA 2C29D 1BGVA 1BW9A 1MC4A 2PFGA 3PFWO 1XU7A 4CLOB 2XXBA 4XQ9A 4W82A 1UP6A 3H5RA 4KUEA 4B4WA 5JO9A 1NVMB 3NDIA 4OL9A 4E13A 4HFMA 1ONNA 3LYLA 3I5MA 1PGQA 4L4SA 1ADBA 2TMDA 4YJHB 2Q1WA 1SB9A 2F00A 2Z5LA 4ZJUA 2X22A 5IDXA 2X0JA 1FDWA 1OZAA 5C7OO 4OIMA 3AOEA 3FWNA 4KTTE 1ZO8A 2VZ9A 3WWYA 3GVPA 3AI3A 3IKVA 4R68A 1GZ4A 3K9QO 3QLJA 3ZZNA 1QLJA 4CL8A 2OMEA 5CDGA 1C1DB 1NXQA 4BNZA 2PH3A 2RAFA 2O3TA 3I9NA 5TS3A 5JO0A 3COSA 2HK9A 2Y1FA 2NTVA 3QJ5A 4UEKA 3UGKA 1HETA 4QFDA 4XGKA 1I3KA 3PZRA 3WGIA 1H93A 3AUUA 1IPFA 3V2GA 3OIGA 3NEPX 3GK3A 5KJCA 3Q6IA 1Y9EA 2XF8A 3BXXA 3OA0A 3H5NA 2DTXA 3C85A 3CMMA 3M2TA 1DC3A 5T8KC 1EUZA 3RUAA 5BSGA 1WXDA 1EE2A 4GLLA 1A9YA 2A35A 3FI9A 1N92A 3OSUA 3PWKA 1U8FO 3ZHBA 2BF7A 1GYRA 3WGTA 4Z3KA 4WCFC 1CWUA 3KBOA 4A7PA 4MVJD 1LUAA 5DBFA 4M49A 4J6FA 4JN6B 4RGBA 2DBQA 3RFXA 5GZ1A 5GZ3A 2GF2A 2UAGA 1U2DA 3MOIA 3IDSA 2PH5A 1PGJA 1R4MB 3E6AA 3H2ZA 5EINA 3UXYA 4PZEA 3ZWWA 1EVJA 4NQZA 1RM0A 4IS2A 3TZKA 1PJ2A 1SEVA 1ONOA 1BVUA 2HCTA 5L3ZA 1ADGA 1ZJZA 2YW9A 3VZSA 1PZGA 4MVJH 1YOVA 3O03A 2WDZA 4CM7A 5T5QA 4CMEC 2VOEA 4A26A 2EHDA 3G49A 2O2YA 3TJRA 4UVGA 1CDOA 3GRPA 2JFGA 4GMFA 5IFLA 4RVDA 2AW5A 2VHWA 1GCOA 3PDUA 2EW8A 2VZ0A 4NU6A 3ROQA 3OJLA 1JAYA 3S2GA 1PJ4A 5HRUA 3ROKA 4RVSA 2OGUA 4XR9A 2PGDA 3LU1A 3NDRA 1ZSNA 4HNHA 1XWFA 4CMIA 4KUGA 1QSGA 1LSOA 2PA3A 3PJDA 5IN4A 1P1IA 1Q0QA 3E5MA 2YV1A 5B1YA 4BS9A 1H0KA 1DIBA 5COBA 3AY7A 1MXFA 3K30A 1B7GO 3HB4X 3CH6A 2P9CA 3OJEA 1YL6A 4ZQEA 4N7RA 5A9SA 2Q49A 1HF3A 3D4PA 3DB2A 3GN1A 3U3XA 4L0QA 3H9EO 1A71A 1UDAA 3CKYA 4I5GA 1HYHA 4Q3EA 2DM6A 4D43A 2D59A 5JDCC 3GG2A 4FOOA 1Z82A 5H83A 1SB8A 1A7AA 1PR3A 1P1KA 1Z7BA 2B37A 4MDHA 3Q1LA 4CM9D 1KC1A 3QQPA 3AM3A 4BO0A 4XJSA 1HTBA 3PWSA 2FPPA 4PCVA 2CUKA 4NK4A 1NQOA 2Y1OA 2X0NA 2ZYAA 3I9KA 1QV7A 3AUAA 3KXDA 3OQBA 4KDEA 5JLAA 4E5PA 3L4SO 5A3JA 2FSVA 3ON5A 4JLWA 4IXTA 5DBIA 1HDRA 3L6DA 2D0IA 4OH1A 4JCOA 3AW9A 4BKOA 4PG6A 3E9QA 2POQX 1A5ZA 1U28A 3UKOA 2PKRA 2ZTMA 3EYWA 1E5LA 3DMTC 4L75A 4J1QA 5F5LA 4WJZA 2X8LA 4WASA 5TT1A 2UDPA 2D2IA 4G2NA 2HU2A 1JAXA 3V1TC 4AJ2A 1SMKA 1BXGA 2GYYA 2IXAA 3CEAA 4L76A 2Q99A 3JCZA 4J7CA 3GR6A 2AEFA 4RLSA 4IUYA 4NBVA 1GPJA 1F06A 1EBFA 1O0SA 3DBRB 3I3OA 2O7SA 4NZ9A 2CNBA 4URFA 1D1TA 4TMFA 3P5SA 4YRAA 4JJGA 4PG7A 3DFUA 3IJRA 1YVEI 3A1NA 3WIEA 4DREA 1ENYA 1T1SA 2HRZA 1TI7A 4IDAA 3RBVA 1YONA 5H82A 3ZNPA 3ZWXA 4BUCA 1ISJA 1OC4A 1T26A 4NHEA 4IDFA 3Q3CA 2O23A 4QO7A 2EWMA 4M55A 4NBWA 2C54A 4RORA 4Y67A 1E1LA 4CMHA 1N1EA 4BB5A 4BNKA 3MJEA 4XIYA 2P2SA 4OXYA 3JQ7A 1W8DA 2FZWA 4MVJI 1NAIA 4WCFB 3U4DA 4JBHA 4ALIA 1QORA 1IUKA 1UXJA 4YB8A 5HBRA 3G0OA 4AICA 2Y67A 2VWQA 4YAGA 4U6QA 1G6KA 2A92A 3MJVA 4C4OA 1QKIA 3A4VA 3LLSA 1IOLA 3OEYA 1A27A 3W6UA 4CQMA 1EMDA 3HQ4O 1ZVMA 3DZGA 3GY0A 1IB6A 5TX7A 5HM8A 4RPGA 4W7HA 5JBIA 2W4QA 3AFMA 4ZD6A 1UZNA 3GA0A 4BNWA 3JYQA 3ZWAA 4J0EA 4Z9XA 4GL4A 4YT5A 3P7MA 2EJVA 5I7EA 1H2BA 4FC7A 2RBEA 4D41A 3CIFA 1H6DA 1AN9A 1KVUA 4CQLA 4J2HA 1K6JA 3QSGA 1EUCA 1FF9A 1D8AA 4LMPA 2V6BA 4CM4B 4RVGA 2LDXA 2QX7A 4W9NA 1W4ZA 4JROA 3QIVA 1GQ2A 1H5QA 1YB4A 3TDKA 3ZNNA 4WLNA 5I9NA 4XQEA 4FBGA 2LDBA 1KEVA 2SCUA 4I5EA 4YAJA 1NX6A 4O6VA 1YWGO 2VYNA 3SC4A 4EEXA 4CLRB 1XELA 1M2WA 2AQHA 4IMRA 3ZV6A 4I5DA 1D1SA 4LGVA 3H3JA 4EI2A 5DT9A 4IM7A 1P31A 1Z73A 2V7PA 4WOJA 4CMAA 3PK0A 2QW8A 4AJPA 3ZU5A 4BKUA 4AJEA 1YL7A 1P44A 2X7HA 2G17A 2PR2A 3PVZA 1NAHA 5MGBA 2GGSA 2NWQA 4MOWA 5TQVA 4BQPA 4M89A 1VSVA 1WMBA 2FY8A 3VPSA 4WECA 3D4OA 4XKJA 1T2EA 2PNFA 1KVSA 3WSVA 1U5CA 1B3BA 4YJFB 3WNQA 4O63O 3PTZA 2YHIB 1GYQA 1Q2XA 2NQ8A 3STHA 3K6JA 3PWZA 3BMQA 2VCYA 4K28A 3V8BA 3EK2A 4II2A 3CE6A 1YJ8A 3DONA 5DP1A 1MP0A 1J49A 3WR5A 5A04A 1EDOA 4YQZA 2JFHA 5KTKA 1ADFA 3E9NA 4L73A 4NFSA 2GASA 5T64A 4JK3A 3ZV5A 1R4NB 2VUTA 2C5EA 3FR7A 3BHJA 1OI7A 1GDHA 1D4FA 4R5MA 3WFJA 4R1NA 3PLRA 4J1SA 1MC5A 3NJ4A 2R6JA 4EJ0A 1W73A 4C7JA 5ICSA 4XJTA 1LBEA 1NVTA 1X1EA 4Q3DA 4QXMA 4XGNA 5GZ6A 3DZFA 1M76A 4R9RA 4XZ3A 1N7HA 5TGDA 4XYBA 1H9AA 3DTTA 3CTMA 4DLBA 3D64A 3ZU4A 4HV4A 3RUIA 3D0OA 1NWCA 2WJPA 3DZJA 3D5TA 3IP3A 4K6FA 4MIYA 1QYWA 2BFAA 1FJHA 2O4CA 4FIZA 3JD2A 5F5NA 3VDQA 1XA0A 2VWGA 5A03A 1Y1PA 4R69A 4W9NC 2P5UA 1LLDA 3CXRA 1XIVA 2PZLA 4O5OA 3T4XA 5U9CA 3WLEA 2Q1SA 1CIVA 2FN7A 4L8VA 3O26A 4GSKA 2EG9A 5IJZA 1Y8RB 3FN4A 3R3JA 3ROPA 1IE3A 4HWKA 2ZB4A 3ETEA 4QX6A 3KSUA 4R4JA 3E1KA 4E6PA 2VTDA 4K6CA 4KWHA 3IC5A 5JC1A 1M67A 2W2KA 3DMTA 4KQXA 5IN5A 3QWFA 4EDFA 1DIRA 5DULA 6LDHA 1I3LA 4DYDA 4ESOA 4DQXA 2C5AA 1PR9A 5KJEA 4CM6A 3GZNB 2ET6A 3WICA 2DLDA 2JCVA 1PS8A 3RD5A 5F1PA 3K2BA 2IE0A 1B3RA 3R3SA 5KVQA 4EW6A 2JCYA 4IZHA 1DDOA 3KZVA 1U4OA 3IIEA 5KKCA 1I2ZA 5BSFA 3BMNB 4BNUA 1K0UA 3VPHA 2EERA 4BO1A 5A1TA 3L77A 3H5AA 1LLQA 1GZ6A 3DR3A 4CMJA 3H2SA 4OXKA 4LMRA 4R1SA 1N5DA 1GR0A 4A2CA 3RKUA 1QG6A 1LSJA 5JDCA 3GOHA 4X54A 3FF4A 1CF2O 3AFNA 4RF5A 3FNGA 4IZIA 3A14A 5K0ZA 3BA1A 2FZEA 4CM9A 4PFJA 3BAZA 1HDOA 3ETDA 3E9MA 4ALLA 3DZIA 5JFOA 4XDYA 1DRWA 2W2LA 4EUEA 3ZGYA 1MGOA 1U9JA 3KTDA 4YDRA 4A10A 4CM1A 2I5PO 2VUUA 1P1HA 3SLGA 3RC2A 2B5VA 3WGYA 4E21A 5LDHA 4GVXA 2GLXA 2CFCA 5FI3A 1QV6A 4CQMB 1VRWA 3B1JA 4YRDA 5AXAA 4NFYA 3DAFA 2HMSA 2X5OA 1UDBA 1BHSA 2GSDA 4WCDA 4XYLA 4GKVA 2CVZA 2HJSA 3DWFA 3SJ7A 3NUGA 3TRIA 3MZ0A 1VM6A 1LNQA 2QIOA 4YXFA 3CSDA 3MWEB 4GH5A 4EZBA 3EY4A 3TFQA 2IZZA 2Y0EA 2VWPA 3TWOA 1UJMA 3IMFA 1GU7A 4TZTA 3S8MA 1YH3A 4CLRA 3KYDA 1U3UA 1GEEA 3GLQA 4PRKA 3RC7A 2VRCA 4YT8A 5IAAA 3D4NA 1A4UA 4FFPA 4R1TA 3ZU3A 1JW9B 2GO1A 3NJ8A 2GZ3A 4RF4A 1R0KA 3RUDA 2R2GA 2E49A 3WOHA 1PJSA 1R0SA 1KYQA 3VZPA 3JQ9A 4JXKA 1ZMOA 2P4QA 2O3QA 1VPDA 1LSUA 1U7HA 3GUYA 1M6WA 4F6CA 4O59O 3OHSX 1ZK0A 3F4LA 2EGGA 4ND4A 3INTA 1N1GA 4WK6A 2JJYA 1HSOA 4NI5A 2WEKA 3OP4A 3AUSA 2YHIA 2OO5A 3PIIA 1EFLA 2HMTA 3O8QB 4FDAA 2DUUA 1ZH8A 5I8WA 4E2WA 1WZEA 3FCOA 1DC5A 1C0LA 2GCGA 4CJXA 3Q0EA 2DBZA 2HMWA 1E3IA 4BVAA 3TZ6A 3BYZA 4H3VA 1S7CA 2JL1A 4EJMA 4MVJG 2FR0A 5JY1A 3PDJA 1DLJA 4M86A 4CUKA 3JYNA 1C1XB 3VAZA 4J1NA 4IY1A 3H3FA 2W2LD 5IZCC 3ZNQA 2AA3A 4F3YA 1Q0HA 4IMPA 2FOIA 3RBXA 1ZEJA 2UUOA 3O4RA 4UUMA 4BNGA 2UV8A 3UOGA 1P74A 7ADHA 3KLMX 1P1JA 1RM5A 2YQ4A 3PYXA 4RVHA 1HRDA 1DBVO 2P91A 4QUKA 1Q7CA 5ER9A 2PKQO 1XEAA 2I6TA 1V3TA 5AXDA 3G17A 5KJ6A 1DLIA 1Q0LA 2J6IA 4LVUA 4PGFA 1R37A 1YRLA 4CMIB 5KCZA 7MDHA 3ENKA 3V5NA 3VKUA 5I7SA 2FSSA 1C1XA 2E37A 4BNNA 3OQ1A 4ZRMA 4RPLA 1YB5A 1AXGA 1V35A 3INGA 2CVQA 1R6DA 3PEFA 4BNXA 4Z9FA 4RDIA 1IZ9A 4B3IA 2AQ8A 1QYDA 4B4OA 4BOYA 1WDLA 3ITKA 4XB1A 1B0AA 4Y98A 4I08A 4FFNA 2X4GA 5IDYA 4BV9A 2CSUA 4CMBA 4B8ZA 1CEQA 3KLPX 4XEHA 2JAHA 1KEUA 4NBUA 3AJRA 2BGLA 4A73A 3WGHA 5KNLA 3BHMA 1QYXA 4BGUA 3JQ7B 1R4MA 2UYYA 1LQTA 3GFGA 4J90A 3C1OA 1C14A 3KETA 4PVDA 3QVTA 1M66A 1VE9A 5U1PA 2ZB7A 4E33A 4HP8A 4J0FA 4JIGA 2G1UA 4AFNA 3QRWA 3GVCA 3X2EA 1IYZA 3NTOA 1PQWA 1LDYA 1ZCJA 1HDZA 3WGOA 4ID9A 2Q3EA 4IXWA 3QW2A 3UCEA 1AGNA 4PG8A 4IBOA 4XDZA 3H9QA 1ISIA 3PYMA 1U3WA 4Z6KA 3VH1A 2BMAA 3HDYA 2Q4EA 1ISMA 3TNLA 4MVJA 5ER6A 1NP3A 1JQBA 1XU9A 2YY7A 2DT5A 2GN4A 2NU6A 4O1MA 4WUVA 3GAFA 3QV1A 4BMVA 5B37A 3T4EA 2OL4A 3GVHA 4OSOA 2C7GA 2QHXA 1SNYA 2CF6A 4U8GA 4E2YA 3FRJA 4S1VA 4AJIA 4L74A 5DOZA 1TB4A 3LC2O 3F9IA 2YZ7A 3C1AA 4MP6A 4N54A 3FNHA 4OQYA 3ZI0A 1T4DA 3DHYA 3KEQA 3O8QA 3TZQA 2R00A 1Y8RA 3N58A 3PJFA 2J3IA 1NVGA 3DZHA 1B2LA 4ND5A 4Z9YA 1LQUA 3LVFO 5FF9A 4GLOA 4XR4A 2EKQA 4P8RA 4CV0A 2GN9A 1IULA 1H6CA 1T25A 3A28A 1HDCA 3OA2A 3ZH2A 5ITWA 1DRUA 4BNFA 1YKFA 4OM8A 3AOGA 4DBZA 3WG9A 3L6OO 3K8ZA 1WDKA 3KO8A 1I32A 1SBYA 4E0BA 5AQ1A 1ZKMA 2X86A 2CD9A 1PJLA 3ZV3A 1K3TA 2IDZA 1BG6A 4RF3A 4RL6A 2BELA 3ORFA 4J1TA 4AJOA 3HN7A 5A06A 4YJDA 4GX5A 1BWSA 1PX0A 3DHNA 3QE3A 2V6FA 4CLXA 5JW6A 3KYDB 4L4XA 2Q46A 1NR7A 3LT2A 2BI7A 1BVRA 1B26A 4EEZA 1VKNA 3HE3A 3F46A 3EMKA 1GD1O 3GEMA 3JQFC 5BNFA 5HWSA 1NFQA 3GZNA 3WBBA 2O3SA 4D3SA 4EJ6A 1F17A 5L45A 1C3VA 3I83A 1MUUA 4FD3A 4RPHA 5EPOA 3NDJA 5A5FA 2Y99A 1HLPA 5A4DA 4RZHA 4YJFA 3VPFA 1ULUA 4PIVA 3GGGA 3FTNA 5TC4A 3H6KA 1X7DA 2VTEA 3E03A 1VJTA 3C7AA 4CM8B 1ISFA 2PZJA 2X1HA 5FYDA 3UFXA 4J16A 5JMWA 2F1KA 5HA5A 1HLDA 4YJHA 4H7PA 1HDGO 2C7VA 4AJLA 1ZK4A 3I52A 3JQEA 4XX0A 4D3FA 1F14A 3S2IA 4DQVA 2QZ9A 1HEUA 1DPGA 2NSDA 2JD1A 4ZN6A 5JCJD 1DB3A 2FR8A 3W8FA 4NBTA 3TFOA 2WYUA 1P0FA 3WTCA 1ML3A 4ND2A 3HADA 3LT1A 2YYYA 1UAGA 2PD4A 5FWNA 4GBJA 4YRBA 2RH8A 2OUIA 4FJ1A 2ZTLA 1L1FA 3F5SA 1MV8A 3D7LA 5TRTA 5KVCA 4CM4A 1E7YA 1PQPA 3D1LA 2VT2A 1PZHA 4DPLA 3JYLA 4D79A 3VVCA 3GUCA 4Q9NA 3RI3A 1KVRA 4R01A 1VJ0A 1E7WA 4LISA 3TOZA 4CQLB 5IG2A 3JQCA 1V6AA 4IDBA 4FJ2A 4BMNA 4UVEA 1VJ1A 1PTJA 4WNCA 4ALKA 5JNLA 2WE7A 1JWBB 3LT0A 2X6TA 3DXFA 4UVHA 2W2KB 3OICA 4WEQA 1TA4A 3SVTA 1P77A 3JQGA 5B12A 3PZBA 1XSEA 4DGSA 4MP8A 2I66A 2PWZA 4WPGA 4BNYA 3BMQB 1ZW1A 1VL8A 2VN8A 3MJ4A 4IDGA 3SJUA 4CM3A 1Q1NA 4FCCA 4E5NA 5TLSA 1XR3A 5G0TA 1PJTA 4DPKA 3ICPA 4DPMA 2OXIA 2R00C 3ASVA 1SPXA 3OIDA 3KSDO 1M75A 2BFOA 3H9UA 4BNTA 4ZA2A 1LRJA 2B36A 3SC6A 4BO6A 1C0IA 1K6XA 4BKQA 3L0DA 4WCFA 1T1RA 1HYEA 3L07A 2YQ5A 1Y8QA 1I8TA 2NU8A 1O5IA 3ZWMA 4Y6RA 4E5YA 1MG0A 4BQRA 2DTDA 1Z6ZA 2EV9A 1GY8A 2FR1A 1EZ4A 2ZJ1A 5A02A 1EEHA 4GSLA 1H9BA 1X13A 1XDWA 2DUWA 1PWXA 3DAPA 4H16A 4Q39A 1QP8A 4LCJA 3ICCA 3OM9A 4B4UA 2DAPA 4MO2A 3WX0A 5ICMA 2GR9A 5JPIA 1ISGA 4BO5A 2DPHA 4BNJA 2VHZA 4MVJF 3ANNA 3FNEA 4IQGA 3DBRA 5DBGA 5EESA 1BSVA 3GNTA 3WGZA 4BO9A 1J6UA 3T7EA 5CEJA 1X7GA 1RM4A 2ZQZA 1I3NA 4YR9A 1PU2A 4I9HA 2VNAA 3QWHA 4GPD1 3RBZA 4CL3A 1ONPA 2W90A 2XOXA 3ASUA 4MVJM 1NTOA 5B4TA 3DMYA 2VUSA 3DBLB 3ZCXA 3U62A 1Y9AA 3R6DA 4A0SA 5LCXA 4OYRA 4Z3DA 1EVIA 2QRKA 4DUPA 1A7KA 3PGJA 1AHHA 2NTJA 2EXXA 3MJSA 2ZKLA 3JD3A 4XD2A 4DC0A 2Q2WA 1YQDA 5A3VA 3E18A 1KVTA 1ZZEA 4CQMD 2O7QA 3DZBA 1D3AA 1T2FA 2WMDA 4QFCA 2VRCD 1ZXLA 3AWDA 3LC1O 2VHYA 3K5PA 4RLHA 2OP1A 4KQWA 1ARZA 1E3SA 2OZPA 3H4VA 3ZWOA 4UVIA 1GYPA 4J4TA 4B3JA 4NJOA 3OEWA 5FI5A 2EKLA 5C7LO 3JQ6A 3IUSA 2HK8A 3FR8A 5DDIP 3RC9A 3IAHA 4HADA 3AY3A 3L4BA 4CUZA 1P3DA 4BL5A 1JN0A 4P38A 2Y68A 3BMCB 2DTEA 3SBOA 4TSKA 2BHLA 4CM5A 3EUWA 2BGKA 1ZBQA 2B4TO 5EJ2A 5A9SB 1CJCA 3ZHZA 3R0IA 3NT2A 5G0UA 3GHYA 1DSSG 1YXMA 3NAQA 3IKTA 2VYND 3AU9A 1NHGA 1P9LA 2J3HA 2EP5A 3JQFA 2AQIA 3FPCA 3PFFA 4OQZA 3E48A 4LSMA 3RWBA 3UCFA 3DOCA 5JAIA 2AE2A 3IOYA 3NT5A 3VDRA 2FWMX 3KV3O 5G0VA 1I24A 5AXBA 1BXGB 3QA9A 2VHXA 4K26A 3FWZA 2X9VA 3BMOB 4RQUA 3I6IA 3BTSA 4XCVA 4G5HA 1YB1A 2NTNA 4DIFA 4KP7A 1HE5A 3GEDA 3GPDG 3K96A 1MG5A 2DKNA 1U5AA 1YOVB 3NX4A 1WDMA 3DEYX 3HDQA 4OHUA 1EUDA 2NVUA 5K9ZA 2UVDA 2JD2A 2OFPA 1DAPA 3GGOA 2HAEA 4ZVVA 5I7FA 1AUPA 4YA6A 3B20A 4ZQGA 4B3HA 1OOEA 3PHIA 3AOEC 1SOVA 1NFFA 4WGGA 5JAMA 5TJHA 3VTZA 2PK3A 3W1VA 5HTOA 3PXXA 4OXNA 5DP2A 3O9ZA 2A4KA 4LW8A 5JDIA 3V2UA 1UUFA 3UW3A 1PWZA 1J4AA 3G79A 1LLUA 3W4JA 4R3NA 3WJAA 4CLHA 1P0CA 3D3EA 4DMMA 5KWEA 2HJRA 4I8XA 4J7UA 4Y9DA 4OOEA 1UP7A 4W6ZA 2EKPA 1ZSYA 1T2DA 5AVOA 5MDHA 3WNVA 2NLOA 5F1OA 4HFJA 2XAAA 2I3GA 3DZKA 4HY3A 4ALJA 3M1LA 3NYWA 4LRTB 1DFIA 1O94A 2O2SA 1TT7A 3L4BC 3GEGA 3MJTA 1H6AA 4ALNA 1E5QA 2PY6A 3OQ6A 2GZ1A 2X0RA 1OAAA 3WMXA 1DAOA 4R9SA 5DN9A 3LDHA 2WTBA 4KUHA 4QECA 1YO6A 1HZZA 3WXBA 2B35A 3ZWCA 5TJ9A 4DIBA 5BSEA 2V65A 3RUFA 1GEGA 3AI2A 4IQ0A 1KEWA 4N5MA 4B7XA 3Q11A 5G0WA 2FHSA 4PLWA 4W4TA 5KVSA 1H2HA 1RPNA 1B8UA 1SZJG 3WS7A 1D7OA 1E3WB 1GAEO 1GV1A 2BI8A 2OP0A 4ZU3A 3WSWA 3GT0A 3M1AA 4MIEA 4Z0PA 1PEDA 3VZQA 4F45A 2D5AA 1W6UA 4WLFA 3PIDA 3B6ZA 1Z7EA 4F6LA 3C24A 1QMGA 4RPJA 6ADHA 3WTBA 3HNPA 4TRNA 2RIRA 3TL3A 4JJIA 2H9IA 4RZIA 4EUHA 3KSZO 4RF2A 1YE3A 3NTRA 1B16A 1I3MA 2CF5A 4OJNA 2RCYA 1U7TA 3ANLA 1PJQA 1E3JA 4AJ1A 1BW9B 3VHRA 1NR1A 5JMPA 2IEBA 1DRVA 2B4RO 3GNSA 4AJHA 4BNHA 1PS0A 4YTEA 3P2YA 1BXZA 1PGPA 3RVDA 4EBFA 1NASA 4PN3A 3U4CA 2OORA 1U2GA 4OAQA 4CMGA 4P22A 3LLVA 4PG5A 2GN6A 3ONDA 1YDWA 5IDWA 9LDBA 3F6YA 4DMLA 2PLAA 5CDTA 1H94A 1O9BA 1SC6A 1EVYA 3JQAB 4KDFA 5LDGA 1BTOA 2AG8A 2Z1MA 3D3WA 1U1IA 2B0JA 3IQDB 4M54A 4BGVA 4OO3A 1E7QA 3GPIA 4D7AA 1YBMA 4HX5A 1SCUA 1ZUD1 1PQUA 1WZIA 2Y1EA 1VKOA 5A9RA 2VYVD 3U49A 4P4NA 2AQKA 4J4BA 4PLCA 1WMAA 4E3ZA 5T67A 2I65A 4QEDA 4F46A 3MJCA 3NRCA 1GPDG 1SO8A 3KHUA 5ILGA 1NQ5A 5KKAA 4UEOA 3NGXA 1NFRA 2RHCA 3CUKA 3KYBA 1B8VA 3QVSA 4L4RA 5DF1A 5BR7A 1LI4A 5JSFA 3OJOA 2GERA 4NJMA 3JSAA 4DWVA 2Q50A 5JCXA 1Y7TA 1LXCA 4N5LA 1TT5A 4HBGA 2J5RA 2Q2QA 2B83A 3W4IA 3CMCO 1UXKA 2IZ0A 5L7YA 2OBYA 4XRRA 1FDUA 1ZK2A 2CY0A 4BKRA 1TVEA 3JQAD 4J49A 4RVUA 1K5HA 2E6UX 3HUDA 2ZYDA 1K6IA 5JYDA 4W99A 1E7MA 2EF1A 3UHAA 8ADHA 1HE4A 4ITUA 3TSCA 4FC6A 1E77A 4HKTA 5G2OA 5CDUA 4DBVO 2G0TA 2QRJA 2B4QA 2H63A 2Y1CA 3LC7O 2JHFA 4INAA 3IS3A 1JTVA 5JDIC 4YVFA 1W0CA 1FDVA 3K73O 1ZXBA 1R4NA 3EZLA 4CV2A 4J43A 4UEJA 3UAGA 3I9OA 4UVDA 4DRYA 1ZK3A 2W8ZA 4YAEA 4E30A 5U4QA 2WD7B 2B69A 1BDBA 3ST7A 2WSBA 3DBHA 4NNJA 5L9AA 1XKQA 3JQ8A 4BO4A 1Y5RA 4RO0A 3KRTA 5L4LA 2NVBA 3ROMA 3WQQA 3QVOA 2A9FA 4LRSB 4EUFA 3RSHA 3W4KA 1IY8A 3GNQA 3UN1A 1ID1A 5HS6A 3GRKA 1U3TA 1I01A 4KZPA 1TXGA 3KM0A 3BZUA 4II3A 5H81A 1ZIDA 3RU9A 2IZ1A 2FRDA 4FS3A 3W8EA 3ZWNA 1YGYA 5G0SA 5TSDA 4PLVA 3RFTA 1AE1A 2VHVA 3SX2A 2BFMA 5EERA 1KBZA 2I9PA 5BSHA 1DC4A 1DJQA 2HK7A 3VH4A 2C59A 1VL6A 3GG9A 3OF2A 5CHEA 2IEDA 1ORRA 1OFGA 3AK4A 4UUNA 4E32A 4AVYA 1EFKA 2AEMA 4XYEA 3LSYA 4QT0A 4CMCA 4XA8A 1EQUA 4TVBA 1E3LA 3IL2A 3HWRA 3N7UA 1V3UA 3DL2A 3LF1A 5CFZA 1XGKA 3Q2KA 3AI1A 3CZRA 4RVFA 4YAIA 4BO8A 4BGEA 2IXBA 4GX0A 4KWIA 3BTOA 4P4LA 5F21A 3JQ9C 3U09A 1PSDA 4HFRA 1V8BA 4TRRA 2HSDA 5GY7A 1LJ8A 4UUOA 4XQCA 4ILKA 3WDSA 2WE8A 4RJTA 1LC0A 1MFPA 1UAYA 3AM4A 3UVEA 1C0PA 1R66A 1XYGA 1EQ2A 1EK5A 4XWYA 4MJLA 3UICA 3F3SA 1EVZA 3UF0A 3DQPA 1YJQA 3PHJA 1NWHA 1MA0A 4FFOA 4CODB 3GQVA 2PZKA 2QYTA 3GVXA 1F8GA 5J23A 2Q2VA 3NT4A 3P2OA 4H15A 5TF4A 3B70A 4E5KA 1HYGA 3JTMA 3TF5A 1GUFA 2DBRA 1Z74A 3ZHYA 4IJVA 2WWRA 2Z1NA 2H1SA 4DL9A 5ITVA 4R1UA 2FPGA 3AM5A 3C7CB 4AJJA 4Q3CA 5FFFA 1RJWA 3GVIA 2GRAA 3F4BA 2I3AA 2YDXA 3PLNA 3BHIA 3JV7A 4FFRA 3SXPA 1WLYA
chains in the Genus database with same CATH superfamily
1RMTA 4TV9B 2ZWVA 4GWKA 2C5BA 2VJMB 1R0WA 4HRYA 2O5EA 3KYCB 1NT2A 1NJ8A 1XDBA 3FCUB 3L0OA 3QJYA 2HRDA 1C4WA 2PKQP 2AOTA 2X9GA 1CUHA 2ZUWA 3EISA 3OZDA 3NDPA 3DFZA 3LX4A 3PP8A 4P3KA 3G2KA 1JQJC 1P9WA 4DA7A 2Q4RA 1WEHA 5CNJA 3RODA 1S3SA 4H7HA 4KXWA 3BERA 3LPDA 3EPHA 3OJFA 3OTQA 3DMDA 4B3GA 3CPSA 4GPIB 3R0XA 5EJ5A 4YP0A 4MLPA 5EIEA 3ADCA 1NQAO 3NH9A 3V1UA 4BNDA 4H1WA 4KK4A 1PW7A 5JXWA 4Q3OA 1E3EA 3PX2A 1SVWA 2Q8QA 2IWHA 3SYMA 3CISA 3AUTA 3N6RA 4S05A 1CEXA 4A15A 4DR4B 1PK8A 1VP3A 1ZESA 2GD6A 3NASA 2ZWOA 4YUZA 4JJ6A 2YJ4A 2Y1KA 4RZXA 1RXIA 4PANA 3SFTA 1JR3E 4EPRA 1GPNA 2F9LA 1DQRA 1E63A 2PSJA 2XRZA 4B8WA 4US2R 3MBOA 1RYEA 3F74A 3HTXA 2X14A 2H4YA 3O92A 4LHWA 1U94A 2CW5A 2PTGA 4RY2A 4YBZA 1ZN2A 2HMVA 1KMHB 1CG6A 3GN2A 5ALYA 1BJRE 1DADA 1ZHOA 3C70A 3IEUA 5DXAA 4B47A 4DG9A 3D59A 4FGWA 1H4TA 2GJ4A 3F5FA 3NHBA 4MK4A 3TKAA 3M49A 4RHYA 4WINA 2F8LA 3BRQA 2XZOA 2VPTA 3RAFC 3DOJA 4CN9A 2QYHA 3HWSA 4HEA6 5DYWA 3V4LA 4B3BA 1WMSA 3EXIA 4R9NA 4AKEA 4H59A 2BH2A 1K92A 2XPCA 4O2BB 3UWPA 4FR5A 2GK7A 2WUEA 4XYGA 5C35A 5JNRA 4KOAA 5K7SA 4KXUA 4HDNB 3HC7A 2R6AA 5D3QA 2LBPA 2PEZA 3ONVA 3PCXA 4PFSA 4BMCA 4OL0A 3TSOA 2BHTA 3TG8A 1M33A 3B2NA 3LGAA 3PUKA 3ABQB 5FNVB 3SYTA 4LS3A 4GWGA 3VNBA 2R9VA 1N6LA 2VOJA 5BNIA 3UPUA 4LHEA 1RFLA 2JBWA 3ABOB 1Z22A 1GUDA 3PJEA 2D6FA 4QQKA 3V46A 1U11A 2DY0A 2V97A 2YXEA 2ZR7A 4BWYA 3OKCA 2BMWA 2YV5A 3OHMA 9LDTA 3AY6A 2AR9A 2Z5VA 3CX4A 5IASA 1OYOA 3B48A 2NVUB 2IGTA 3S8YA 2QE6A 3L1IA 2P9GA 4YUVA 3RR2A 4O3MA 4NCXA 1K27A 3M89A 2Q41A 3D2AA 4TRJA 1C3OA 4BKPA 3BKWA 4ZYVA 2FSVC 1ESNA 1M1NA 1F5SA 2F48A 3C2QA 3WYBA 4YAWA 5FEUA 4IOMA 5BV0A 2ZIGA 3UFBA 3G82C 3QHAA 4INJA 2GHIA 2PT5A 4Y9UA 4ZRNA 3K92A 1OV4A 1R0ZA 2CXHA 3RSFA 3O2NA 3RS0A 1Q5PA 1SOMA 3OSZA 3WYCA 3M82A 3TMYA 4BYGA 4QTYA 1YDMA 1Y6QA 2J5BA 3ER6A 1Z2AA 5BP7A 3QVXA 4RIFA 2D1RA 5FOUA 1PGNA 3UHFA 1UJ6A 1VBFA 4HWOA 4XPZA 4F1WA 1M5UA 3A6JA 5DEOA 4RHCA 2ONYA 3FGPA 4MPRA 1SIWA 3PQ6A 1ECBA 2Z4SA 5CAEA 1I2BA 2F1JA 3CGWA 4FQ7A 4JOQA 4RA9B 3UIEA 1OBFO 3AEUB 5L4SA 1CJSA 1LZLA 3NIFB 3UENA 4DR7B 1G2OA 3A6HA 1RYZA 2EGHA 4D2IA 2XUJA 4YI3A 4H7FA 3DOOA 1M2JA 2UVPB 4J94A 4KLRA 4MVYA 4F4JA 3QY9A 3HG7A 3JZDA 2HKIA 1M6VA 3T4PA 3AHHA 3PQEA 3KYCA 4I1IA 2JPDA 2M1ZA 3VI3B 3GLVA 1AV7A 4JL8A 3ASZA 4MR9A 3UH1A 1ZVJA 3RAGA 3RASA 1II8B 1PKEA 2PS1A 2Q4TA 3C39A 1BROA 4FVTA 3L7OA 4MUAA 3VTAA 2R1TA 3EIWA 2FUEA 3L7DA 1SCBA 4H31A 1SBHA 4EGFA 1E2HA 3TEMA 3OEED 4ZAGA 4C0BA 1HT0A 4F8YA 3EC7A 2VH1A 2GEVA 5A4FS 4M1SA 2XIJA 2A1UB 1PFUA 3I30X 5AVUA 1XVLA 2W2VA 3BS4A 1AKNA 1TVCA 1ZM2A 1ZN8A 4WXMA 1VMIA 1LI5A 4QUEA 3L8EA 5AW8A 3GDGA 1XDUA 1XVUA 4JOSA 1O97C 4P83A 4RGVA 3TLCA 2R47A 3WKAA 1OV6A 2ZTVA 4AL4A 2K87A 1NF8A 5BQXA 3FTEA 1E4VA 4GPEA 2XDQB 1T4BA 4ENVA 5KZMB 3EDMA 5J2UB 3WBFA 3U56A 3A4IA 3CEMA 2ZTUA 2FSPA 1CQIA 3NGLA 1QH9A 4CLEA 5K99A 4KI7A 3DYIA 3JQBC 3OFSA 2ZUVA 4LZWA 1HOTA 1WY7A 1LDBA 1LDMA 1N0IA 4QJIA 1PTJC 4KPUA 3SC2A 2B4YA 1KP2A 1S4MA 1TGVA 1WKVA 2XT6A 5CTAA 1P62B 2R97A 1DHTA 2NIPA 2OXTA 1QR6A 2GJKA 2G04A 4MCIA 2JDIA 4KW7A 5E2IA 4FZRA 2RGEA 1W5AA 4DIEA 1W8IA 2V55B 3BZWA 2LD4A 2DT8A 3NTVA 1UFRA 3WGNA 2PANA 4CR7A 2V98A 1SBQA 1UM9A 5K6TA 4PGHA 1ST3A 3LPLA 1BX0A 2FETA 3A1DA 4WZAA 2GEJA 4Q19A 3IBYA 1Z37A 4MKRA 1UPXA 4IQ8A 1XCMA 2OYSA 3AONB 5CG2A 4BQFA 2YY5A 1PD0A 1ND6A 1DUVG 1KMCA 4K46A 4D97A 1IHYA 2IDMA 4KQGA 4M0KA 1NUTA 2ZATA 4D3XA 5JAQA 3G2OA 1UBKS 1YRAA 1XZLA 2PJZA 2BVNA 3AR3A 4REMA 2RHWA 3U7JA 1KHTA 1KC3A 1YULA 3QK7A 4S3MA 1CZOA 5C5EA 5DO9A 2VFAA 4GI2A 3GROA 4TSRA 3ECSA 1MTZA 3KEMA 4WOCA 3EGOA 3ZWVA 4GPTA 4B3DA 2GHRA 2LCIA 5HQ3B 2NXNA 3IT2A 2JLUA 5DTJA 1S8FA 1U99A 1VL5A 1NPTO 3FHOA 3NB0A 2JFFA 1CRQA 3DMPA 1STOA 1LRLA 1PT8A 1JEEA 1VCIA 3I64A 3C97A 1QUEA 2CXXA 2EYUA 3HZHA 3T0IA 4WK2B 2C82A 3QUAA 1DCMA 4NG5A 2J67A 4TXMA 4ZRDA 3H9BA 3PL1A 5FUMA 1BEUB 1CLEA 1QO7A 5ALLA 3AR9A 3TE6A 2CDRA 2W2TA 3HYSA 4PGAA 1UH5A 3T0FA 1LDEA 1DHRA 5C37A 2VT3A 5JMOA 1CNEA 2QU7A 4IHJA 4K6OA 5JYEA 4D26A 4M60A 5CUQA 1XD9A 1ZOLA 2KLBA 1UM9B 1T2AA 2O8VA 4FFLA 2DWOA 3Q7IA 1Y4DE 2GZ2A 3EYAA 4XIFA 2O57A 2ZG6A 1JX6A 2JLQA 1XN1A 2F59A 2JFBA 3LZCA 2WSLA 3L6CA 4GOJA 4DYHA 1YI8A 2ZYGA 3GJSA 5E3IA 3G0HA 2CJWB 2BSAA 2YWCA 1SG9A 3AXTA 3B7PA 3LUHA 4W7IA 1DTWA 1VMDA 2IOFK 1T6NA 4LK3A 1BZYA 5FTMA 4C43A 1ESEA 2I76A 4LVOA 5T4BA 4BP9A 3VTFA 5JS1A 2R0QC 1SVMA 2C2KA 2Q3BA 3TI9A 1Z0UA 2F43B 2IZ5A 2GRUA 5I3CA 3VJRA 2H4JA 2VDJA 2PRIA 3I23A 5KNBA 2PGIA 2ZJOA 3H8JA 4UDXX 5DCUA 3LT4A 5TXGA 2J8ZA 3A3PA 3L04A 1YHZA 4C07A 2AJCA 2J6BA 3HLYA 3MM4A 5JHGB 5KPDA 5J43A 3KVOA 3OU7A 1MCZA 1WB6A 3D8SA 4HZGA 4XARA 5KAPA 2D4AA 3HU5A 2ZCVA 4IDPA 5BNTA 2BFWA 2ZZKA 3D7RA 4B48A 3D8NA 2VHEA 1L7EA 3RQSA 4YRIA 4GX1A 2C4WA 4EL0A 5BW8A 5CW2A 4Q5IA 3DO5A 5JJKA 3CEHA 3IH5A 2CDCA 2P9QA 2XT0A 3LFUA 4OAPA 2WWWA 1XP5A 4WDRA 5DOVA 3SQDA 3ZQ6A 5K8UA 1B8PA 1QP4A 1NV8A 1MT3A 1JJAA 2ECQA 5LYJA 1II8A 2B3TA 4ZT3A 2O3RA 3QF4B 4FOSA 3FKSA 3ABIA 2AIRA 4X6YA 4B74A 3C3AA 2CUNA 2UZ3A 4ENTA 4DSAA 4IGEA 4KV7A 4MGYR 1P4HA 1R0LA 4PHFA 3C3BA 3ZHQA 4I50B 3I9MA 1TJPB 4HDKB 3Q4GA 1R8JA 4QBIA 4CM8A 1TUGA 3F0TA 2XMCA 4NMXB 2AYYA 4LHZA 2WT9A 1BDMA 1CERA 3TW0A 1ECLA 2GJ9A 1JG2A 2PHZA 1FVXA 3N1UA 4FQ8A 4HDRB 4JBYA 4I4IA 4JP3A 4AF7A 4AO6A 3C3EA 1ZICA 1PGOA 1NP7A 3DBHB 4KACA 4MUJA 5CAEB 2VK8A 4OJMX 2LVBA 4M7RA 1BDHA 1QRRA 4UAVA 3ZQKA 1XRSB 3IRUA 3D2BA 1R64A 4XOUA 4Y9SA 2AT1A 5DM0A 2QM3A 4BVBA 4M9XA 1U0TA 1YBVA 4GO1A 4QTZA 5DXJA 3VZDA 4ARCA 4DIKA 3TN7A 4ZICA 5AM2A 1XVTA 4L8WB 4DF3A 5BUQA 1DJMA 2A94A 1T3LA 2Z3WA 3BE8A 4EYEA 4WKGA 2QQ5A 2ZBDA 2YV3A 3R44A 1H5UA 1ZNZA 4OI2A 4M4SA 2H5LA 2GZAA 3QX9A 2PX3A 1DS6A 3QH4A 2FK8A 1Y5LA 2IRWA 1Y89A 1GSIA 3JAWB 3T7DA 1LC3A 1A1SA 3CRVA 3PVCA 4JBGA 4XVCA 2HM7A 2J3KA 3OPQA 1L5SA 2ZSAA 5FFMA 1TZMA 1NOIA 2DR0A 2RHBA 3LQQA 1SPBS 2D1QA 3G0DA 3D2LA 4FB4A 1DG9A 1O96A 4GX2A 3JXEA 3C8MA 2CZCA 4K8RB 2Y66A 3AR7A 1Y81A 3GCXA 3HXLA 2GTIA 3PHGA 4HC4A 3DT6A 2UZ1B 2XXJA 4P4GA 2AWOA 4RTMA 3IBSA 1JQ3A 3R0ZA 2DHRA 3HJFA 3HWX1 4OGWA 1DC6A 3S1LA 1AKTA 1GL3A 3IXQA 5BQPA 1PL7A 4AIIA 3PRJA 4C78A 4RVCA 4FK8A 1PL6A 4G4GA 4DIOA 1E3TA 2G83A 3IDZA 3E0QA 3DV2A 3HUTA 2BH9A 2G9ZA 2HUNA 1EDBA 1R6BX 2VDKB 4JLUA 5DM4A 5KTRA 3OKFA 5CG1A 1TADA 2IFTA 4TTIA 4N18A 5LUBA 1DG1G 1V95A 1ZAKA 4YV7A 5B4VA 4GMGA 3ZE8A 2XXAB 2OBNA 1T5SA 3C3KA 3G5MA 1MZPA 1C81A 3A9WA 3PQ3A 4NIMA 4O4JB 4D81A 5TQ2A 3I5XA 4UTPA 2O0JA 4GZ5A 1L8LA 3WLHA 4ZOAA 3ZWPA 1HDXA 3PUZA 5T7BA 2AOXA 5I8ZA 2QTMA 3QPVA 4TLLB 3E22B 4E2FA 4EY6A 3AVTA 2YFQA 2ENWA 2GN8A 3HVUA 5HE9A 1HV8A 1MHTA 1X3SA 4CDRA 4HNQA 1XEWY 4ALMA 5KMGA 3D3WB 3VKGA 3KQQA 4RJIA 2JIPA 3SK0A 3PC2A 4BRSA 4JJ7A 4HQKA 3KPUA 1LRKA 3VVBA 1AQYA 3E15A 1XBTA 5EZ5A 5A2GA 4UUQA 3L6BA 3G0CA 3WYEA 3JR3A 4PLTA 4DLKA 2W0SA 2IT1A 4LC0A 1VOTA 2B8JA 1OW3B 3AP2A 1DKRA 3OZTA 3WYGA 3PQDA 5B1EA 1S2IA 3BHNA 1LVGA 1FP4A 2HN9A 1HE2A 3BQMB 1G3QA 5CNMA 2Q5OA 2WLSA 5EIFA 1VYUA 4UFPA 4DDUA 2P90A 3VHXA 1KVQA 3ZOZA 3NALA 1WP4A 1RWWA 4H0NA 3A7DA 3CUUA 2GPNA 4R7TA 5DCWA 2PMWB 1LJLA 3CNQS 3RHSA 4CGYA 5GONF 3RHTA 5EUQB 2HMYB 1EZZA 4JVMA 1XQXA 4EY3A 4CR8A 4EHKA 2QG6A 3GLHE 3TTWA 3FTQA 4R51A 5J1SB 3FTFA 5FNVA 2YNMA 3DAGA 4YRRA 3NV9A 4B87A 4N8EA 2GWHA 3CRW1 3TXXA 4DSTA 2XITA 2JJ2D 4G8BA 4N1AA 4W8GA 2OGSA 2J5KA 1YACA 4B7AA 1MXHA 1HSZA 4J2TA 2BHNA 5HKKD 4XQGA 1UINA 1Y5IA 3U7EB 4E12A 1XKLA 4FFMA 3R7WB 4JAVC 3ASYA 1PIWA 5KX5B 1FTNA 1VI2A 4LYYA 3GRFA 1VP9A 1Y6JA 2AD1A 4FJ0A 5ALTA 1GPAA 3JQBA 4YWJA 5HVNA 2DUJA 1TJNA 1DAGA 1CTQA 3F73A 1EB9A 4LJYA 3NOVA 1NBIA 5H70A 4INOA 5BO5A 4HAWA 2QT1A 1VSTA 2PG3A 5BYAA 1E3DA 4W5JA 4DC9A 3LQ2A 5GVSA 1R15A 1C9DB 2ISCA 3OQMA 3SEZA 5JC8A 2OV1A 2ZTSA 2VYVA 5JJ5A 4IOKA 3HB5X 4DDWA 4EAAA 2D7CA 2K7ZA 2X8JA 4CMEA 1EQAA 1ADCA 2ODBA 4MS4A 4CEHB 4GVLA 4O1IA 1Y9DA 1TEHA 3V34A 5AKEA 5H9WA 5LQKA 3HMKA 3LUCA 2Y0DA 3VR5H 1NVXQ 3STTA 1PVDA 1JDJA 2WYVA 4QPZA 3WDMA 8ATCA 2RONA 4MV6A 3HDGA 4YXWA 3WL7A 1RI3A 1EWTA 1A9ZA 1CHDA 2WHXA 1GGMA 1OJ7A 5H3LA 1USGA 2UXCB 1H23A 4IDEA 1UJNA 3ND7A 5JT1A 3M1YA 2RHMA 3KS9A 2PLRA 4ZT6A 5ELMA 2JLCA 4FGSA 3LOQA 4GRAA 5G3YA 4IGAA 1QHIA 2HIMA 2VNSA 1W88B 1YDEA 2VJMA 3GXBA 4UD2A 4ZQHA 3TPCA 3NV7A 2LIPA 4X6UA 3TRJA 4HDNA 4QGSA 3WNBA 3N2IA 3TLKA 4LJ7A 1VIMA 5CEFA 5LWHA 4BQSA 1I5OA 2GAAA 3ZHTA 1QQ6A 1V7CA 2G4LA 3X3HA 5JRJA 4B5LA 3DT9A 5IANA 2AMYA 3B7GA 4PZPA 1OXMA 1TQ6A 4RPKA 1SCAA 2QX6A 2IYWA 1TCVA 1LEHA 4RSHA 3W8DA 1GSOA 5D84A 3L43A 2OHXA 2EJUA 2QRVA 4IYRA 1K1EA 4LXHA 2CBZA 3WOVA 1DJPA 3N2GA 5FLKA 1UBOS 2VO1A 3CV3A 1KYIA 2AE1A 4J3FA 1JKFA 2DHDA 3PGXA 4KXLA 4RA6B 3E2MA 2X0EA 4KLCA 3NG1A 3NWPA 6YASA 2CJYA 4XFJA 5H3CA 5BV2P 4YCMA 3RTBA 4M8SA 4CMKA 3EEIA 4KAAA 4FDUA 4EH1A 1NE7A 5DWVA 2JC3A 3HSKA 2R7KA 5ANRB 3AF0A 3MLAA 2WM9B 5F98A 4AQYB 4ZCQA 1D1QA 4UASA 1BMDA 3G7SA 3F47A 1IZ0A 5CH5A 1WB5A 3UPDA 1A2BA 1KI9A 1TCAA 4J0GA 3TXAA 4C4YA 4DT1B 1M0EA 2QBYA 9MHTA 3I1FA 1Z39A 1XQYA 4DUGA 3WK8A 5BVHA 4F11A 1ZLXA 1P3Y1 4RZ2A 4ETNA 4YT2A 5IU6A 3R9IA 1B15A 3TRDA 1LS6A 2JASA 1VKJA 1E92A 1H1LA 1UXIA 4I55F 5B64A 4CIAA 1EBUA 1CVIA 2RHDA 4ROTA 4HNGA 4QSMA 4LXYA 4TTPA 3RYHA 2IDKA 1X2BA 4IW3B 4H60A 4WOBA 2NVWA 4LOLA 2C5FA 3THWA 3PCRB 2QDXA 4JS0A 2Q1YA 3ROZA 1ILEA 1OXXK 3BMCA 2NADA 1T34A 3OX2A 3PUXA 4HOYA 3B1FA 3FTPA 5DYGA 4IIJF 5CP8A 5AW9A 3P0HA 4XIJA 3QVWA 3NZEA 2HCFA 3EEYA 1P2TA 4YO7A 2YHUA 5FOWA 4IWXA 3N5CA 2JFOA 1XPOA 3OX4A 2R1VA 2XKJE 3PSHA 4W8HA 4JNKA 2V8BA 4IIEA 4F3RA 5LMZA 1EI9A 2QVZX 4FOTA 3EIQA 1X14A 4O33A 5E7QA 3H11B 3VPCA 1IL0A 2ZU0C 5K3OA 4DLLA 2BFEB 3K2IA 2XD4A 1AF4A 3PYLA 1G8FA 3IUEA 1XZNA 4NECA 3ORRA 2SKCA 4MUXA 1D9XA 1QUFA 4Y6PA 1G6HA 1SXQA 2M6LA 1KEPA 2NXEA 1MC8A 1XTUA 1TC1A 1IONA 1OH7A 4WXYB 5KNCH 4HO1X 5DYIA 3VKWA 1Y6FA 3RJ9A 1KQNA 4X7PA 5KWIA 5AKGA 1GT91 4EK9A 3VR2D 3GH3A 4Y2PA 3V1LA 3QYPA 3MNFA 1OC2A 3Q85A 4N6GA 4K9DA 2IU4A 4PWYA 3I05A 2PZMA 2MU1A 1Y7LA 4UAGA 1L5LA 4B76A 4BJ1A 4YCCA 5J4VA 5I9LA 2ZIZA 2GETA 2D3TA 1AUQA 2HJHA 4YMHA 5KJ1A 4B79A 5L95A 1YKSA 3OT1A 5AW7A 2OFFA 5CA1B 2UKDA 1QZUA 2VAWA 3JQAA 1LPPA 4CUJA 4ER5A 4GYJA 2D8AA 3O73A 3R0JA 5F64A 4NV1A 2VJNA 3F1KA 2PSDA 4L5AA 1OAKA 2FN3A 2GQ0A 2OSVA 3H9JA 2VXCA 3IP1A 2E1PA 4Z0HO 4P31A 3FSRA 4H9GA 1RLMA 5DBOA 1RFGE 2DX7A 2QI9F 4JYBA 4V2UA 3TS1A 5HYVA 2CXTA 3Q8XB 5ADWA 2DWQA 4NR0A 3TD9A 1E5VA 1Z8FA 1N7GA 4OKNA 2GF0A 3L7IA 3PFWO 2PFGA 4IIFA 5CJJA 3RFFA 1T9KA 1JHOA 1XU7A 4X6LA 2PZEA 4XQ9A 1UP6A 3N6XA 4DLUA 3NDIA 4IKPA 4XX0B 1M72A 4BQIA 1PGQA 4GYKA 2TMDA 1SG0A 4WNYA 3E27A 3GGJA 3E2IA 1M5TA 2ADMA 2ANCA 1TK3A 3P8ZA 4FS8A 3D6MA 3A1SA 1QF9A 4YDSA 2F00A 1L7BA 4KQKA 3DPUA 1GSHA 2IUTA 3Q0TA 4OGFA 3KD2A 2JGJA 4MKIA 1X2EA 2OVBA 2OBFA 4QPNA 1XMVA 2JAQA 1ZIXA 2HA5A 5JNWA 1P39A 1Z9BA 4P54A 3OE7D 4QRHA 1G63A 5BOVA 1DAIA 2WPNA 4TTJA 2NAFA 1JQEA 1ORIA 1QGOA 2YHBA 1PHRA 2OMEA 4UHCA 2PL5A 3KUKA 1LX7A 2VQDA 2BFNA 4BNZA 1L5HB 1R4ZA 2CWDA 5H80A 1VDZA 3S81A 4OQDA 2PH3A 3TRHA 3ZYCA 1ZD9A 4DJEC 3IIJA 1Y63A 3A2MA 2XUAA 1M83A 3COSA 4HDMA 4I46A 1A5AB 4K9MA 3SGLA 5MGNA 1OTXA 3CPJB 1GGNA 1KAQA 3QJ5A 4UEKA 2WHPA 3LE8A 2YASA 4KQ6A 1HETA 2WJGA 5JWOA 2A9QA 1SXIA 1I3KA 4RX1A 1VE7A 4Q16A 2F1IA 5FBRB 3OIGA 4ZT7A 1LW7A 5C46F 4WFJA 4C4XA 2BP7A 5DN6D 3GK3A 5K0CA 5I7AA 4BLVA 5KJCA 1Y9EA 2XA2A 2XF8A 3OA0A 1GNRA 4N41A 3H5NA 3VV2A 2GN0A 4FEGA 3CMMA 3M2TA 4H27A 5LP6F 1VA5A 5T8KC 4YJ3B 1JPVA 3UJHA 2EYQA 3DEZA 5JI2E 3RK4A 4RZUA 1WXDA 4AB1A 3DKVA 3UBTA 2A35A 2VF7A 3IAEA 3L05A 1TKCA 4K05A 4HN2A 4HTFA 5BXYA 3DE0X 2BF7A 1I2AA 5B2ZA 3U3MA 4Z3KA 4WCFC 3ETHA 1R9GA 1MAAA 1LUAA 3MJFA 4NCJA 2DBQA 4CF4A 4E7PA 3WBJA 3F9RA 4KDCA 2UAGA 3F7TA 3M9XA 4PXYA 2Q07A 2A5FA 1R9NA 4G37A 1A3CA 1GCIA 4AM8A 3N8HA 3OJXA 2EX0A 1DMSA 4Y2QA 3WLAA 4PZEA 3U7FB 3ZWWA 4NQZA 2FMTA 3IAXA 4B4KA 2RJOA 3VU9B 1S2LA 3IUMA 4J0DA 1ONOA 1BVUA 3DOIA 4YMVA 2HCTA 1JMVA 1CB7A 3M1IA 1T6ZA 5J1TB 4QLBA 4NH0A 3EZ6A 4RIEA 5KHLB 1Q7EA 4R05A 1GG9A 1PZGA 4G5QA 1Y8ZA 3CZPA 3FZEA 1DUIA 1T4GA 3DEKA 4QOGA 4A26A 4CMEC 4X9XA 5JAOA 2VDMB 4DMHA 1BE1A 1CDOA 3IEIA 1UEJA 2JFGA 3GRPA 4GMFA 3BRCA 3EFHA 1KIAA 2VHWA 3NC0C 4XGRA 5F7OA 5IFLA 3G7UA 3QFSA 3SSMA 1HX7A 3GLGA 2RK6A 3PDUA 1IBKB 3CC8A 3RABA 4JT2A 4GDMA 4N12A 4NU6A 4JI6B 1JAYA 1NONA 2V7BA 3S2GA 4RTPA 1SGWA 4EPXA 2BKEA 1DKLA 4TL6A 1MB0A 5K3CA 5CA0B 5SY6A 1OKKA 4G1CA 3RU2A 1XZIA 5F7JA 3LU1A 1LPMA 1DBQA 1EYZA 3K1AA 2EQ5A 5G1OA 3U6BA 1M2GA 4KUGA 1QSGA 1OWNA 3TIFA 1P73A 2OUKA 4F2DA 5L3QB 3HCBA 3KLNA 3UMSA 1J70A 2OD2A 3BOSA 4RESA 5IVHA 1SCNE 5IN4A 2XNHA 1Q0QA 5KWVA 2YV1A 5C32A 5LKRA 1YI0A 2GEFA 2ZJAA 2OXRA 3DM5A 5T41A 2ZWMA 1MXFA 4PQGA 3OJEA 5A9SA 3FUVA 4ZQEA 2Q49A 1HF3A 3DB2A 3EIEA 3GN1A 4UXJA 3U3XA 3EFOB 2J9XB 1Y3BE 3TD6A 4Y2UA 1TTPB 2WZBA 1CUUA 3NEYA 2DM6A 4Q3EA 4WZBB 2AN9A 5TGZA 5JDCC 4ZOQI 1A9XA 3O8RA 3IE0A 4I66A 2Y0BA 2BONA 1OWPA 1PR3A 4JYPA 4LMAA 2B37A 3K9BA 4QDXA 4ZT5A 4ERXA 4F84A 1ECCA 2Z3VA 4UE3S 1UIMA 3WAKA 1MOQA 4HYTA 4DLVA 2C4UA 4OA8A 1JQDA 1SVKA 1Z12A 2W58A 3AM3A 4UTOA 1ZNWA 5E1BA 1C3JA 2ZYRA 5CMLA 3N87A 1ECFA 2FPPA 5BVGB 5HF8A 3WHPA 2Y1OA 2X0NA 2ZYAA 3NANA 1SELA 1V7ZA 3I9KA 5LQSA 2C9YA 5JLAA 1W2HA 1TCCA 3OIYA 3SJBA 5ICCA 4JLWA 1SKQA 4R2KA 4BIMA 1BN6A 4LE0A 2G9NA 4C0LA 4JCOA 4QOIA 3U48A 4E6EA 3QG5A 2H11A 3E9QA 5IK2A 1A5ZA 2QE7A 3KNZA 4TXHA 5A6VA 4GHWA 2B30A 2FPWA 2PKRA 4PFKA 1UMDA 3ZS8A 2ZTMA 2G40A 1NXOA 5CK4A 3FCAA 4J1QA 5F5LA 2X8LA 1HZZC 1C1HA 4KAFA 3NHLA 4WASA 5FPPA 3SXUA 2D2IA 1FX0B 1KI3A 3B5EA 3C3MA 3QXHA 4G2NA 2PMDA 5CNIA 1BXGA 1GCAA 2O1EA 4BEWA 4L76A 2HWKA 3KL4A 3JCZA 5KB3A 4J7CA 3VNUA 4IUYA 1NF9A 2VPXA 3GX1A 3I3OA 4HH4A 1Y3AA 2O7SA 5DM70 2PKXA 3BKXA 5GAJA 4JJGA 4C20A 3DXYA 2FJPA 1EJ2A 4PG7A 5ADUS 1NI4A 4ZZIA 1D2RA 2FI1A 3H4IA 3O1JC 3WIEA 1T1SA 4MA5A 2BR4A 3T34A 5ES4B 4U7TB 5HKLA 1Z5ZA 3L46A 4LDZA 1W5FA 3CLTC 4CU2A 3PC8A 4BUCA 2XWQA 5LQAA 1OC4A 1T26A 2WWTA 4FI3F 3PNLA 2ENUA 4EL5A 3DPIA 5EPEA 3LSTA 2R5NA 1WDWB 3ZKWB 1NC1A 4TYPA 3KE8A 3W90A 2VP9A 4YMSA 1AK1A 1L3CA 1MU0A 5LBIA 2E55A 1FLAA 3GUVA 1E1LA 1XNQB 2W6PA 2OESA 3UK1A 4XIYA 2P2SA 3U4DA 5DI9A 2VL7A 3O9MA 1W34A 1IUKA 1O9HA 1UXJA 1O87A 1XJ5A 3DS8A 1R7RA 3G0OA 5DX0A 4AICA 2VWQA 4C3UA 5LSAA 1R74A 2H65A 1IN1A 5A0TA 5EJMA 3MJVA 3PR1A 4ZHQA 1YU6A 5E38A 1D5CA 1ZRNA 3LLSA 1NBMA 1P19A 1ICEA 3AF4A 4RSMA 3OEYA 3W6UA 3ZTYA 4Q47A 3ZVRA 1FFWA 1VKRA 2QLJA 1TC2A 4YROA 1AMUA 3DFKA 1BJKA 1XC7A 1ZMXA 4W7HA 5DBHX 4M6WA 3CYFA 3QU5A 3RYFA 5JBIA 4KRYA 3DWEX 1B6TA 4BNWA 5I7WA 2O1WA 2CNLA 3MJDA 2MINA 4J0EA 4Z9XA 4GL4A 4UPVA 3P7MA 5I7EA 1A2KC 3CIFA 4A0RA 3TZLA 3FPEA 3W7BA 1H69A 1ZJ4A 3C6XA 4I99A 4FFWA 4CQLA 4J2HA 5DI3A 3K1JA 2ATEA 2JGDB 3K0EA 1EUCA 3W2EA 5EY5B 4WA7A 3EFOA 4L78A 1FF9A 3ET4A 2VC2B 4PE5B 2Z5GA 3EIXA 4CM4B 2Z2IA 1QM5A 1DINA 3N0VA 2RGYA 2LDXA 2ORED 1NMXA 2ZYIA 5BWBA 3QIVA 3H0KA 2BMFA 2V7UA 3FUXA 2D7JA 3O1IC 5TMEA 2CXOA 4OJTA 3TDKA 3ZNNA 4CQJA 5IUJC 5JH7B 2D54A 5IK2D 3F49S 4FBGA 5EHQA 2GA8A 1A8IA 3KP1A 2ST1A 4CF5A 1CNFA 4V0KA 1NX6A 2E1RA 3M6AA 2QW0X 3MMSA 4EG7A 4FMCF 1M2WA 2AQHA 3LD9A 1XCLA 3W2HA 1JBEA 1D1SA 4LGVA 3FM9A 3H3JA 1P31A 4KG7A 1C9MA 1CHNA 4NCKA 1AQIA 3NTXA 3PK0A 2KLHA 2I2XB 3U39A 3A6FA 5J3JA 4AJPA 1M34B 1V16A 3ZU5A 5K8VA 4NAUA 5AKJA 3P4YA 4GZLA 3C74A 4GOOD 3ZLUA 1P44A 1RJ9A 4A9AA 2PR2A 1G59A 1NAHA 1MB2A 3ENWA 3DV0B 4G63A 4PSAA 2Z8XA 2XWBF 4HAIA 4MOWA 4NG4A 5JATA 3UGQA 1JG6A 5CYOA 2HNKA 5CVDA 2GN2A 3UV6A 3D4OA 2XQVA 3SYLA 2QTNA 3VPSA 2PNFA 2Q6TA 1Z7YA 2QW1A 5CVVA 3PQ2A 1NUPA 1B3BA 5D5QA 5DYNA 3ZXXA 3OIUA 4KXVA 4B6EA 9ATCA 4KU4A 3PTZA 2NQ8A 5K8LA 3VSDA 2C2MA 1IHPA 4TMKA 4PR0A 2QDKA 1PTKA 1B0PA 4ZPXA 1OYYA 2MWMA 4KFRA 3WGKA 3V8BA 1KE1A 4CCWA 4P3XA 5FPKA 3RVSA 3DONA 4QATA 2VNIA 3RE1A 1G8GA 2H5EA 3WR5A 4NV0A 1RCTE 2RHOA 4KO3S 2JFHA 4XCQA 1K86A 2C84A 5KTKA 3ADDA 2QI9C 1Y8AA 5BW4A 1KYVA 4NCAA 2FWRA 3E8SA 1J8DA 1J09A 1NVKA 1V45E 2C5EA 2Y76A 2ZR9A 2XZTA 1XZCA 2JGAA 1L4UA 3GRAA 4KR7A 1D4FA 4R5MA 2RSLA 1F6BA 1YZHA 3REQA 3NJ4A 5TEWA 3HR4A 3C98A 3MQ4A 1W73A 3PL5A 4DEVA 3KALA 4TV8A 4EA8A 5IEJA 4BAGA 2OAP1 4Q3DA 3EY9A 4IKOA 3CWQA 1KZ4A 4R9RA 4YJ3A 1T9GS 2IPAB 1UBLS 3G8BA 1AU9A 3ABSB 5EP4A 3VKHA 4UU7A 2P4SA 1H4VB 2BCJQ 4GUDA 5FO0A 3A1TA 3ZU4A 1UBTS 4LECA 1VPLA 2EZ4A 3D0OA 2WJPA 4P98A 1B6SA 2CKMA 3FAZA 1QYWA 2BFAA 1JI0A 3IGFA 2B34A 3N8NA 2WPDD 2O4CA 4MIYA 4LPSA 4M21A 1JIQA 5CB6A 3GJ7A 4JBWA 4C29A 1W9HA 5F5NA 4L3VA 5TPWA 4IJQA 5AESA 3ND5A 3VDQA 2VWGA 1HQDA 4JNCA 4EQ6A 1YVRA 1DI0A 3QX7A 4RE5A 3ZD8A 1BCSA 3IFSA 2RGGA 3O47A 2Z3ZA 4J3JA 5AKZA 2H31A 2PZLA 3T4XA 4CT0A 3WLEA 5GM2A 3OZFA 3EIHA 1K3FA 4YRJA 1QVRA 2FN7A 4I1VA 2EG9A 4XVQA 1Y8RB 4BJ5A 4ZYZA 2BFCA 2QLBA 5IJZA 1F2DA 1X1RA 1JHRA 2ZB4A 5LB4A 3I2IA 3E1KA 4PO9A 3VR6H 1L7AA 3AUFA 4P36A 3UMGA 2BKLA 1GNPA 2W2KA 2R7MA 4H7JA 1N8SA 1NN5A 5IN5A 2JGEA 1KA9H 1Y33E 3QWFA 2BSQA 1XDZA 4U2BA 1XTJA 3H97A 6LDHA 4LSGA 3LUPA 1WX1A 4X63A 4V0SA 1U0GA 5D7BA 5FO1A 4LNAA 2B92A 4MULA 5FTKA 4LF4B 2C5AA 3AP1A 4EYOA 1L4FA 1PR9A 5KJEA 3GLIA 2Q0XA 3T99A 3EMVA 2DLDA 3WDLA 1MAVA 1PS8A 1QTIA 4HLQB 3V7YA 3Q6NA 3B6JA 5JSZB 2IE0A 4IDOA 3K09C 4L4ZA 4PZAA 5EGSA 1SIUA 4MW6A 2N9UA 3ACBA 2JCYA 1JEJA 2DERA 4BZQA 4C06A 3STWA 1IZ7A 2YWEA 5TVKA 3FJ1A 1S3GA 4BNUA 1IY2A 3EQZA 4MV3A 4C4TA 1FU4A 3VPHA 1N78A 3Q3GE 2HPZA 2PUEA 4EYSA 5F33A 1KH1A 3L77A 5K03A 1NDHA 4KYTA 1U8EA 2GOYA 3CKMA 3T52A 4OXKA 1K2VN 1T8YA 2I6GA 4LMRA 1N5DA 1YDHA 2GNOA 1GR0A 2K2WA 1D4AA 5FV7A 1NXTA 4ZCRA 3FPGA 1M8KA 3IAFA 4DG5A 5JDCA 1YB2A 4YNBA 4P6VF 2P65A 5UKDA 5JROA 3OQJA 1E2JA 3BJRA 3ITEA 1E8NA 2ZEJA 4TTAA 4JOCA 1WU8A 2DZDA 4Q7LA 4Y7CA 1CDDA 5AMXA 3MQFA 4KOEC 4BRUA 2FZEA 4D6YA 4PFJA 2PQ2A 3I09A 2IHUA 2OLEA 3OPMA 3WLKX 1JPUA 1DCFA 2IP1A 3HVHA 1JHDA 1RRGA 2QQ0A 3BD9A 1U0FA 2P69A 5K3FA 3UH0A 3PA6A 3ZGYA 2RGRA 1M74A 2ZDGA 3IMGA 2B4AA 2AWNA 2BRUC 2HJVA 2I5PO 2VATA 3N75A 4RM3A 5ALDA 5EZYB 5EMMA 5KQLA 2B5VA 5C31A 2FMHA 4PSKA 2IA5A 1ZGGA 2J46A 4KK3A 5FI3A 3GQBB 2BBTA 4YRDA 4R71A 4NFYA 4Y2TA 4TZ6A 3MBKA 4X71A 5E6SB 1NATA 1U8TA 5DTMA 4EJSA 1HDIA 2YUIA 1XQWA 3B36A 4WCDA 3HYRA 4XYLA 4A1FA 4GKVA 1RBQA 1Z17A 2DPMA 4H4DA 1JSLA 5TQ0B 1W44A 2HJSA 3WADA 1JJ7A 3VX3A 5CCXA 3K70D 3L4KA 4Q4AB 3MERA 3FUWA 2ZTHA 4TMXA 3TRIA 3UV7A 1LNQA 2B1IA 2QIOA 3T8YA 4YXFA 1V3QE 5AW6A 4JI2B 2PQ0A 1ZIOA 2AG0A 1L5QA 2F64A 5AI5A 1P2VA 4FT4A 4ZYUA 2WJ3A 1D09A 3DV9A 3KYDA 4JOBA 4X3OA 5IHPA 3TQFA 5EIBD 2CN1A 4WKOA 2ZULA 1KDZA 4PRKA 4OQEA 4I4TF 2QAGC 4JUBA 1JR6A 3D3KA 5DHQA 1D6NA 1JHYA 3FYUA 1YFLA 3RANA 3CLSC 3DE7X 4XCXA 3RSLA 1PT5A 4JYAB 1A4UA 4M0PA 3QPUA 3A58B 3O8CA 3K0FB 5CLQA 1R0KA 4XLZA 4I55A 3HKEA 2UVQA 5FPYA 3R0VA 2F1RA 1L4KA 1KYQA 4Q24A 3N2LA 4EABA 3WYFA 1YS9A 3H04A 3N2KB 5ETJA 2R6R1 1K68A 3AUJB 1GU0A 2O3QA 4W5RA 5CFQA 2GTPA 1AUVA 2HX1A 2QQFA 4O59O 3Q5DA 2XRMA 3F4LA 4KIFA 4ZCTA 1AQLA 1MA3A 4DM3A 1AS3A 1OHHA 4YV2A 3ZWQA 1A9TA 3AQIA 1EUYA 2XCOA 4JA2A 5ISMA 3AUSA 1EX1A 1JZQA 3UANA 2V0GA 3PIIA 3DO6A 1N5IA 3O8QB 4FDAA 4ZQCB 2DUUA 5CLGA 1ZH8A 3U1VA 1JSXA 5BMVB 3HA7A 5D85A 4YN3A 1WZEA 4XVRA 4RXUA 5IKEA 4I1YA 4YALA 2ZJYA 1B8NA 2GCGA 3TJZA 5FAKA 4OXIA 4LF7B 2HA2A 4QJBA 2DBZA 2HMWA 3JAMA 1VECA 3TXYA 2C61A 4H1UA 4RSGA 3DNFA 1HFKA 1S7CA 5LA6F 2RHTA 3L7JA 4JSYA 3WL3A 5JSYA 3FRHA 4Q4JA 4PCLA 5JY1A 1EDEA 4CUKA 3AVQA 3L8MA 4PHCA 2IKQA 3VAZA 3CVJA 2C78A 1NVWQ 3H3FA 1U63A 2AA3A 3DGFC 2F3TA 5DFAA 3ZI4A 2CL0X 3W3AH 4B5KA 4KMRA 4QGBA 2DFLA 5KNBD 2R48A 5HXAA 5G3ZA 3ZLBA 2ZRGA 3QLEA 3NFRA 2YZGA 2CLKB 3PYXA 3DE6X 2PUWA 2BEJA 1V4BA 2AYXA 1QGZA 2CLSA 1R50A 4GE0A 4HHEA 1NOKA 4QA9A 1DBVO 2P91A 1GPBA 3B13B 2ZE5A