3K32A

The crystal structure of predicted subunit of trna methyltransferase from methanocaldococcus jannaschii dsm
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
191
Chain Sequence
LMDVHVLFSGGKDSSLSAVILKKLGYNPHLITINFGVIPSYKLAEETAKILGFKHKVITLDRKIVEKAADMIIEHKYPGPAIQYVHKTVLEILADEYSILADGTRRDDRVPKLSYSEIQSLEMRKNIQYITPLMGFGYKTLRHLASEFFILEEIKSDYEAEIRHILKERGESPEKYFPEKQTRVVGLKKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0690
publication title The crystal structure of predicted subunit of tRNA methyltransferase from Methanocaldococcus jannaschii DSM
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 59
structure length 191
sequence length 198
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3k32A00
3IUEA 1M8GA 1F7UA 2X3FA 4MW2A 2DR2A 5LM3A 3ILVA 1ZUNA 3E27A 1YIAA 3K32A 1O96B 3CLTC 3AFHA 4GRIA 5J5AA 2O8VA 2QUJA 3ZIUA 2D54A 3CLSD 5HUJA 1M8KA 4MVCA 1GTSA 1OWLA 1KH3A 4NAUA 1IQ0A 3N9IA 5H7XA 1TYCA 3IOEA 4WNYA 4L2IA 5TEVA 2CUZA 4MW7A 3P52A 4JZYA 3TQOA 1QU3A 1O95C 3GLVA 4PBTA 2A1TS 1T9GS 1NSYA 1JMVA 4I6EA 1PFYA 4L2IB 3TZEA 1F9AA 1NUTA 1LW7A 3IMGA 3CA8A 1J1UA 3D6VA 4YMIA 2X1LA 5IJXA 4K03A 1K92A 3IODA 4G5YA 1KH2A 5DASA 4PBRA 4MW1A 2X1MA 2A1UA 1TYBE 3UY4A 3P0HA 3SP1A 3KT0A 1N78A 3CVUA 2HGZA 3TS1A 3AG6A 4MUGA 4ZCTA 1QRUA 3PNYA 1JEDA 5FO0A 1M8FA 3FHJA 2WQ6A 4BWVA 1M8JA 3COVA 2WQ7A 2V0GA 2QUIA 4EFKA 2PZAA 2CV1A 3A4IA 3COZA 3VGJA 4EG8A 1CT9A 3ZJTA 1R6UA 2HZ7A 1QRSA 3FG9A 2ZUEA 3CR8A 3FETA 5AHWA 4JXZA 2PFSA 4RUKA 4DNXA 1K97A 3TQIA 2A1TR 2E21A 1M83A 1ILEA 3M5WA 2RD2A 4PY2A 1TYAE 5KCMA 1WXIA 1N3LA 4J75A 2RE8A 3A2KA 3QTBA 3NV7A 3X1MA 1P7PA 1K4MA 4XFJA 5TEWA 4QBTA 3RK1A 2CT8A 1OWOA 1OBCA 2EJCA 1T6XA 5FO1A 5K0TA 3UOWA 1TQ8A 2IELA 4ZT2A 3A04A 1UFVA 2ZP1A 3ZJVA 2QJFA 3ND6A 4RPIA 4YP5A 3COWA 4HJRA 1COZA 2J4DA 2AKEA 4G6ZA 1VBMA 4S1OA 2AZXA 4UZEA 1O94C 4TS1A 4F4HA 1XNHA 3IMCA 1JZQA 1YIDA 4MUIA 3ND5A 5LLTA 1EFPA 5KWVA 4ZT6A 5BNZA 3DLAA 1EE1A 1QU2A 1NYLA 3H9BA 5HUHA 4MLPA 3UK2A 2CYCA 3FNRA 4NATA 3RJZA 1KORA 1U3DA 1O95D 1JILA 3AIIA 1KQPA 4MWEA 5FNZA 4DJAA 2QUKA 2J09A 1HYBA 1KP3A 3FWKA 3N2YA 4CT0A 1O94D 3BL5A 4U8HA 5DEOA 5F23A 3LCJA 1EFPB 4MAFA 3X1KA 3Q12A 1F7VA 3IDFA 4G5FA 2VXOA 2E18A 3H97A 4EG6A 1H1TA 4EG5A 4DDMA 3IUBA 2D13A 1Q19A 2H29A 3MMXA 2QTRA 4I6GA 1N2BA 1DNPA 2PZBA 2JANA 1EUQA 3KT3A 2BTEA 3COYA 4MQ6A 5EKDA 3G59A 1IFXA 2GM3A 4MUNA 4EG1A 1H3FA 3GUZA 3QE4A 2I1LA 4JXXA 2DLCX 1OD6A 4ZCRA 3SDBA 2HMAA 4Q93A 1O97C 4MVXA 5TS2A 4EF6A 5LFAA 1TYDE 4KPUB 1QQTA 3SZ3A 5H16A 4DLPA 3KT8A 3CLRD 1TFUA 3KT6A 4ZT4A 3ZGZA 2X0KA 3N05A 1J1ZA 2AG6A 1U0BB 1LI7A 1WOYA 3CVYA 1EXDA 3P0IA 3NBAA 3H05A 4MUEA 1G8HA 3P0JA 1Q15A 1N1DA 4YP7A 1FFYA 1MRZA 3MUEA 1QRTA 1PFUA 1VBNA 1IQUA 1J70A 2YWBA 3G6KA 4ZT7A 3L93A 3FDXA 1WQ4A 1WJGA 1WXGA 4NAHA 2DPLA 1NZJA 5JBNA 4XSVA 1K4KA 4PBSA 4EG7A 3C8ZA 1J09A 1WXEA 2GOYA 2YXNA 4MUHA 3SEZA 2DXIA 1Q11A 1V47A 3QTTA 2Z09A 4HJXA 1M1ZA 1NUSA 1IRXA 2TS1A 3HMQA 1G8GA 1JIIA 4OUDA 1FYDA 1YUNA 1EFVB 1NUQA 1JZSA 3FH0A 1N2GA 1JECA 3ZXSA 1VBKA 4CQNA 1O0CA 1KAQA 4R0NA 3N8HA 3ND7A 1I2DA 3IVGA 2Z08A 1O97D 3U1VA 4GU5A 4MUKA 1Y42X 4E1AA 1O0BA 2PXHA 4ARCA 1J21A 2PIDA 3OTWA 3S3TA 3IVXA 1N2OA 2JA2A 3TZLA 1JEEA 4U7JA 1QTQA 4OUDB 1YULA 4ARIA 4R2MA 2YY5A 1MC1A 4MWCA 3UMVA 1GAXA 4EG3A 4JFAA 4NDAA 1U7DA 1V8FA 4ZCPA 2A4MA 4MVYA 4MWBA 5J58A 3VRHA 4MW0A 2QJOA 1JIKA 2A88A 1GN8A 4P2BA 2VTBA 2WB2A 2A86A 4EGAA 1J20A 2J07A 3SEQA 2QTNA 5KHAA 3ELBA 1R6TA 2A84A 4KKVA 1YI8A 2VTBB 1KQOA 1ZH6A 4ZT3A 3MLAA 4MVWA 4MW6A 4ND6A 1X6VA 3ZXIA 3DV2A 1I6MA 2YWCA 1IVSA 1N75A 1WY5A 1MJHA 2GKSA 1G8FA 4MUJA 1A8HA 1BS2A 3CLTD 3PNBA 1KQNA 3CVXA 4HK4A 1ZJWA 1KP2A 1TEZA 3IVCA 1JIJA 1QNFA 1MB2A 2DERA 1B6TA 2XRYA 1GZUA 1LI5A 5IHXA 2PZ8A 3INNA 1EUYA 1N2HA 4AQ7A 1NP7A 1N2IA 1M8PA 4QREA 4YBRA 5K0SA 2J08A 3G5AA 1R6XA 3L92A 4H3SA 1KH1A 2E89A 2ZUFA 4Q16A 4A91A 4KR6A 4ZCSA 1RQGA 1PFVA 5DB4A 3JXEA 3A05A 2QUHA 4MULA 1VL2A 3OP1A 3HL4A 1F4LA 2NZ2A 4DDHA 1GPMA 3CVWA 1KAMA 3FY4A 4FZJA 3HZRA 5J59A 3SZGA 1IHOA 3H9CA 3ZJUA 1QJCA 1N2JA 4MW9A 3F3MA 1YUMA 1XNGA 1GLNA 1X8XA 3NBKA 2CSXA 3RBAA 2G36A 2IJGX 3IOCA 3VU8A 2DETA 1NUPA 4U63A 1N77A 3Q4GA 4I6JA 4MWDA 3HV0A 4MUFA 1VLHA 1T6ZA 5DK4A 3CLSC 1KR2A 2JAXA 3ISJA 1IH8A 4J76A 2CV2A 3AG5A 1H3NA 1PFWA 1O6BA 2QJTA 4NZPA 1XJQA 3PXUA 1T6YA 2B7LA 2C5SA 1PG2A 2CV0A 3RHSA 2QTMA 3I05A 4ZT5A 3LOQA 4WSOA 4QRDA 1ZH0A 1MAUA 2A1UB 3CLUC 4R2LA 2CFOA 2O5RA 1MBZA 3FIUA 4EG4A 3PRHA 4DE5A 3PNVA 3D6UA 4XFDA 1OWMA 1U3CA 1H3EA 3HFJA 2CYAA 2OQ2A 3CLUD 2J5BA 3H99A 4F3RA 5HG0A 3IOBA 2CYBA 4CDNA 1OWPA 3FI0A 3GMIA 1MB9A 4ZCQA 2EL7A 3AKZA 1NURA 3FOCA 1WXFA 2E0IA 1MOPA 1O96A 3KFLA 3AL0C 1OWNA 1JGTA 2NSYA 2BYTA 1N2EA 1D2RA 3K9WA 2A7XA 3RFFA 1WKBA 4MW4A 3LE8A 1O5TA 3UC5A 1IQRA 3DO8A 4KR7A 4YP6A 1XNJA 1GTRA 1KKUA 3Q10A 3MLBA 4ND7A 1SURA 2DUMA 3DPIA 1NUUA 4K0RA 1MAWA 4AS1A 1Q77A 1NI5A 4X0EA 1PG0A 3MXTA 5TGTA 4CDMA 4DDKA 2Z3VA 4JYZA 1WXHA 3HGMA 1G59A 2H2AA 2IP1A 3CVVA 1WZ2A 1T9GR 4OJMX 2R5WA 4UZFA 1EFVA 1EJ2A 1U7XA 1OBHA 2V0CA 2WSIA 4KR9A 4KPUA 2OV4A 3CLRC 1I6LA 3RK0A 3SYTA 2DEUA 2PG3A 4NX2A 2XRZA 1WQ3A 1JHDA 4HPWA 3X1JA 4MW5A 1S4MA 1ULHA 2D5BA 3IMEA 3TNJA 3ZUGA 1I6KA 3IH5A
chains in the Genus database with same CATH superfamily
1RXUA 1CJUC 4WZBE 3W6ZA 4IJQA 1FNCA 5KJ6A 2I3DA 4RJKA 4KXFB 5G0SA 4HYEA 1E0DA 3KJGA 4RQTA 4KIUA 3CKLA 3ZY5A 4EEKA 3HYLA 3AF0A 4DKXA 3DNPA 1HI9A 2GJ4A 2L69A 2QUJA 4R83A 2CXUA 3MM4A 4HVTA 5ALMA 2BGJA 3BD8A 1M8KA 2J7KA 5G0UA 5DBIA 2MMGA 2XXBA 5CLHA 2IGTA 3QW2A 2CHVA 1HBJA 3RUEA 5ITWA 1HLFA 5T41A 1RJGA 4L2IA 1E9FA 3P52A 4JT8A 4PXAA 2RHDA 1PVDA 5C8DA 1UDBA 5ALUA 3DF7A 1ONNA 2UV8A 5IC6A 3EGDA 4EUSA 5LQUA 1K2VN 3WGIA 1ISPA 2R6JA 1E1RA 2AEEA 1P4RA 1KJYA 1FP4A 2H18A 4X7BA 4IAOA 4OJYA 3EC2A 4TQAA 1U04A 1B8VA 2F1IA 2GBPA 3FR7A 3H65A 4D9CA 1JQDA 2JFQA 3I0MA 4L8GA 5E8RA 3ZGXA 3DR5A 1A8IA 1YQEA 1U5BA 3WGUA 4C07A 4ZPJA 2YWXA 4KHZA 1XO1A 4NYMR 1II8A 3UTCA 3VX3A 3DTNA 1OREA 4PYNA 3PEVA 4J0HA 1NZDA 3K70B 3KFXA 4NCAA 3BTUA 5T4FA 4ZAYA 4CM8A 4MV1A 2ZRIA 5KX5F 3OPVA 4A26A 3ZUPA 3NRJA 3RREA 1BYIA 2JGIA 3DYBA 2YH2A 2QENA 3QFSA 4AURA 3M2PA 1PDOA 4AMYA 5HF9A 1NBAA 4W5OA 1DFGA 1PR0A 1KAEA 1F0NA 1ZJ5A 3DFFA 3CM0A 1V5EA 5IBRA 5I7VA 1I01A 1B74A 2XUHA 3CVJA 5KSPA 4BE4A 3EGXB 1WDMA 4JQOA 2WWXA 1DIRA 1OC4A 1VE7A 3QY9A 2HZ7A 1KDTA 1MB3A 2OM2A 2R96A 4BKQA 5EEHA 4UTPA 1E2IA 2OO5C 5EJFA 3F5SA 4QUBA 5EPOA 4HB2A 1UPBA 1CS4C 1A5SB 1WHTB 3E70C 4JXZA 2QE7A 8ATCA 4PE5B 1GNVA 2FHPA 5JXWA 2VRCD 3E9RA 2C58A 2QL5A 1NQAO 5FFNA 3GDFA 4AUMA 4B0PA 4LHEA 4K6GA 4PY2A 1TYAE 1ZCBA 5KCMA 1KS9A 2N1BA 4NG4A 3K7EA 2EP5A 4PTYA 1OX4B 4Y6LA 5F5LA 3HDQA 1JU3A 3EE6A 2FSIA 1H65A 1JKFA 5GONA 2PMEA 5K51A 2G09A 3LC1O 3GH1A 4OQLA 1NVAA 2FWAA 1OWOA 2HSGA 4C30A 4JBLA 1NSTA 5DNYB 2QN7A 2Y9PB 3NTQA 1V1MA 3H4TA 1Z8DA 4HEHA 4I55F 4KXXA 4QLAA 5EWJA 1QIHA 3STTA 5I48A 1IK4A 1MUUA 4TKMA 3THXA 2PJRA 2CJFA 5J3JA 4RVNA 3MXOA 3AERA 2QJRA 4TKUA 4U8GA 4BGDA 3ANTA 1H42A 3AEQA 3MOIA 3QZUA 2A9VA 3SJBA 5A5VA 3ICQB 1GUFA 3SYKA 2Z98A 3COWA 3NWEA 1XVLA 2BJVA 1RR6A 3IBTA 1HORA 1XEXA 4HLQB 1KFJB 1R66A 3SC4A 3NHAA 3U5ZB 1TKAA 2HFJA 5EJ4A 1YXMA 1OPRA 4Q9LA 2LGJA 4URYR 2HI0A 4HLUA 4H7JA 1ICIA 4AJKA 1SUPA 3UJ9A 3WMXA 1FU8A 2VPWA 2CJYA 4PV7A 3BJEA 2O0LA 2CDCA 4LRQA 5JEEA 4JIGA 2Y1EA 4O3MA 2EQBA 1UKYA 2FQWA 3DL2A 2AFIB 5IC4A 3LRTA 4YCAA 4NATA 4P3OA 1KVSA 3DEJA 1KWGA 2WB2A 3AIIA 3T5MA 3VOTA 4HUTA 2E4ZA 2QM7A 3UB4A 2O2CA 3Q6IA 3U4QA 4JJ7A 4HXEB 3CJRA 1RXYA 3T99A 1E6EA 3ZEAA 3QNUA 1TECE 1PR2A 2HK9A 2UYQA 4U7FA 3LV8A 4G26A 1P5JA 3M1YA 3NT5A 2LV8A 3HH8A 4G0PA 4G56A 1QF6A 1C14A 5G1OA 3PDWA 1B23P 3HB7A 4KIWA 3HXKA 2UZIR 2F62A 3AEUA 1OV4A 2DSTA 5A06A 1JZTA 2VDJA 5BSFA 4GOOD 2ODNA 5F77A 2Y6UA 5IEBA 2WWFA 4PYQA 4WKGA 5ANRB 3TAUA 4V0SA 3IUBA 4UNSA 3ZV7A 3TWOA 3VDMA 4AF8A 3BA6A 4I6GA 1SOWA 4CEHA 1DNPA 3GJYA 5FBLB 2CLFB 4RH0A 3CR7A 4RULA 2RARA 5KWSA 4U0KA 3TXXA 4YI3A 3QLUC 1OXUA 3A1TA 4L6IA 2BHNA 4ZO9A 2AKAB 4QC2A 4TTSA 3SDBA 4ZCRA 4M21A 3BDVA 3GFTA 4D9KA 1OYOA 2OOSA 2HIAA 2J4CA 5GJVC 1DIGA 1SXJD 3JQGB 2A9PA 4KBGA 5BMVF 2FLVA 4HWOA 2AHRA 2JLWA 4FB5A 3AETA 5TV2A 1RKBA 1BJKA 1RJFA 2MR5A 2YWJA 1AUVA 5H16A 5M3BA 3ZDYB 4B31A 4HNSA 2PUDA 4C7VA 1Q44A 1DUVG 3D8TA 4OJQA 1TUIA 5DBEX 1GL9B 1ZESA 1OBOA 1LD3A 2X0KA 4BASA 4G4SP 4C0HA 3PFCA 3OE5A 3I32A 3WMFA 1A97A 2PFGA 2XTMA 4ZOCA 4F60A 1JHUA 2KMLA 3E7XA 4LHSA 1V25A 2OG2A 1LI7A 5CGQB 2YVAA 1WW8A 1P2UA 1Y4UA 2PLAA 2Q0QA 3MGBA 1XWFA 1KZYC 4M1EA 4WZBA 5CX1B 5CA1F 2X0RA 3RB8A 3QXJA 3EVNA 1YB6A 4RGQA 3U31A 2QGFA 2R4UA 3L8DA 1E2JA 1Y33E 2HWYA 1AUPA 4DJ5X 2NU8B 1IDOA 2PA0A 1WUIS 3VUFA 3EA0A 4JI3B 3FYCA 4B3TB 1J8YF 1N8NA 1ONPA 3L7JA 3QU5A 3F5MA 5CPBA 5AD1A 1SKMA 2W2XA 3AEUB 4M55A 2XCQA 1R4NB 4IJ5A 3KD3A 3VYSB 3I5YA 4DWVA 1L8AA 1BHJA 4DREA 1KY5A 2XB6A 4R1QA 1T25A 2O2SA 1UBMS 1ZFNA 2QTLA 2V9ZA 2L82A 3HB1A 1NZJA 4FR2A 4N5DA 4QHYA 3ZXYA 5HJEA 1OZAA 2NNWB 5JBNA 4HUQA 3D0KA 1C7FA 2GN9A 1LPSA 1LBTA 3I3OA 2HH9A 3ZK9A 1PQYA 4DMLA 5JISA 5F9MA 2SHKA 2ZRCA 2ZWOA 2PGXA 2Y76A 1AKNA 3LKVA 4PZDA 2G1KA 1DC8A 3DOEA 4AJEA 4F3NA 1BC5A 1E8NA 4ZO4A 4G8JA 3FDFA 3IEVA 2ANCA 3F7OA 4GLJA 2ZYTX 4RL6A 1Z4KA 2NPFA 2OEPA 1D9ZA 2VTDA 3DXFA 1VLVA 2I65A 3R3VA 5AQ1A 3ADCA 4LY9A 3BRWA 4FONA 3KJEA 2CL5A 4LC1A 4PLWA 5EEGA 1ES9A 3EVDA 1FEZA 4J1SA 1WHSA 2QD1A 2R1VB 2YYYA 3M6MD 3TD2A 4MO9A 2UYHA 2JGKA 4TL9A 2A58A 1LBHA 2VT6A 5DH9A 4C05A 4XA8A 1O97D 3KU1A 4E1AA 1PZHA 2FFJA 1BGVA 3ZVLA 4A0HA 4BX9A 1B15A 4X93A 1ZXXA 3CWCA 3WGMA 5AI5A 4F1WA 1T5OA 5TARA 3TZLA 3OT1A 4MRNA 4P98A 4CCYB 4CLOA 2IPXA 3WLOA 4I1PA 2P3LA 4FFPA 1AX9A 3VTAA 4G0VA 1VPEA 2GK3A 4LRTB 2N47A 2G9QA 3QVLA 4K9DA 1NLMA 3KSUA 5EXDA 3DGFC 3ZZUA 1Z5VA 1MRNA 4MSUA 3L1HA 2VI5A 1JSZA 3CEMA 3E3MA 1SVOA 1ENZA 4MB0A 1G42A 1JU4A 1LCIA 2CHUA 1CQIB 4DBLE 5EJ8A 2EFDB 1B2LA 1KNQA 5JW6A 4B6PA 3HO8A 3EAFA 2ZRFA 1XDWA 2QS9A 2QTNA 2VT2A 4EY5A 1SC4A 4MI3A 5J2TF 2QBYA 4MARA 4UULA 2XMCA 3FPSA 4PO1A 1UT5A 1U2DC 2DJIA 4FFBB 4TYPA 3ZVNA 2VATA 2NUTA 1CFZA 5EINA 4E21A 2GXAA 3IQHX 2ZIFA 3GRRA 4O4LA 4UM8B 1T3GA 5F2EA 4M1MA 3ZZ0A 5AVZA 3O31A 4ACAA 1HE1C 2JLQA 4E0BA 2R8PA 4MRPA 4DLBA 4EB3A 3OTQA 1NXPA 3PWKA 3QKSA 5A2QA 3JRNA 1U6JA 3KJXA 5CVCA 3K70D 2UZ3A 3JALB 4G0ZA 4ZGWA 5HZKA 3DUFB 4Q9KA 5YASA 4GO1A 4A7PA 4PM4A 5ETJA 3I8OA 1DFHA 3W2IA 5JUWA 3HBFA 3N2GB 1GT91 3QYFA 2G82A 4FC6A 4LN1A 2DCMA 2Q1XA 1LS1A 2VYND 5EE9A 2CMGA 4I5EA 3WIUA 1IHYA 2HQOA 4NZ9A 4IV5A 2XQFA 3VNBA 4LECA 1VHJA 3PUJA 1YDEA 5KDLA 1QB8A 2YV4A 2DKNA 4JLBA 1AMOA 2O3TA 3LRXA 3ODPA 4QU5A 2V45A 2W93A 4F86A 2IOQA 2H7VA 3LCUA 1L0BA 4ZI5A 3ZY4A 1W87A 4LJSA 2FP3A 3C45A 1BX1A 3DMYA 2GXSA 2Q99A 2W0SA 4D81A 3UHAA 3P2KA 1NPDA 4P35A 3CVWA 3HXMA 2EJVA 3SZGA 4EENA 1QDUA 4XDYA 2XD9A 2I4NA 1EB8A 4JLUA 1UEXC 1PR3A 3IUSA 2C95A 1LDMA 2RH5A 3NBKA 1WSWA 1X3LA 2DCUA 1H2RS 3NTVA 4IFBA 3FHCB 4DQ0A 5DU2A 1T1EA 1VYTA 1XWWA 1UBHS 1VDZA 2WAOA 2NWQA 1PT8A 2FRDA 2ZLBA 4JOBA 4QWMA 5AXBA 3W7VA 4BVJA 3L8MA 4HMPA 5AM1A 3ITNA 1NF8A 2GYUA 2VQSA 3QE0A 4Z8YA 1AQUA 3WLAA 3JSAA 1RLIA 3VI4B 1JJBA 3LWZA 4QKQA 1N8SA 1QF9A 4M1YA 1A0OA 1M2KA 1VMEA 5JDIA 3RSLA 3H5TA 3INGA 3P7MA 1PZFA 1HZZA 3E9YA 3FWZA 1LPNA 3G2QA 5MFZA 4OB7A 1G17A 3W3AD 3P0RA 1EI9A 4M7RA 5CTJA 2OAGA 4YN3A 1M0TA 1HEIA 4EG0A 1L1RA 5EQJB 3DG9A 2DE0X 2X2FA 3G8CA 1IMOA 2P9QA 4U7WA 3LOQA 5K6AA 1A8UA 1LBEA 5F73A 3GFRA 4KOEC 5JSZA 1ND6A 4X94A 1M1UA 3FIUA 2AN1A 3IIKA 5A0FA 4XE5A 1HE5A 2GN0A 1UBNA 1VL5A 1BCRA 1YZHA 4I1SA 1OWMA 3MPOA 1JS1X 1Z7EA 4OAOA 4CXMA 5CDUA 2P27A 1TCCA 4YT5A 3ZGYA 3KSZO 1RI4A 3R0IA 5EHIA 2CYAA 4DEYA 4NV0A 3DTVD 1H4VB 1QC5A 3RS0A 5I9IA 3V4ZA 4AMUA 5G2OA 3WGYA 3BMQA 3GMIA 1ZMOA 1JPJA 4YROA 3KUUA 2C0CA 2YWRA 2CBXA 1CRWG 1IC6A 1X8LA 3I2KA 4FYMA 4NP6A 2WFMA 2XCTB 2C94A 2JK1A 4C7BA 4N48A 4YTEA 4WZBB 5CX1A 3SHVA 4F45A 2XT6A 1ZQ1A 1DEKA 2YS6A 4XOUA 3DEIA 1CLUA 3SQNA 1EUZA 1O9GA 2ZDHA 4AJJA 2I3ZA 3U4CA 5EJ6A 4BVLA 4Q21A 1RHMA 1P81A 2I4MA 2P5SA 4NBVA 5CA0B 2NN3C 1N7JA 4TM8A 3ZWKA 5KNCD 2OM6A 4FHCA 4Z9XA 4N6GA 5AM4A 5BWNA 1O5TA 4CKXA 1SQ6A 1RRFA 2KE5A 4KR7A 3EYAA 4QDZA 3IT2A 1GTRA 4Q3CA 5SICE 2YX1A 4ZOLB 2B9EA 4RZQA 2PNFA 4TTPA 3BILA 2E1RA 3GP5A 3J81A 1DAEA 1NULA 3IMKA 4LPKA 1KRHA 5B6JA 1KI6A 3RVKA 4BO6A 5KHLB 3N70A 2AMLA 3D7KA 4NYIR 2X0IA 4G5GA 5B55A 5HSGA 5JNRA 3ELWA 2Q29A 4LGCA 3VI3B 2G4LA 1RBMA 4JBGA 3B7WA 1WVMA 4DMKA 1CP2A 1EFVA 1EJ2A 1Z17A 1OBHA 3IJPA 4IMRA 4J4BA 4N49A 4XARA 4ZA2A 4IVRA 1USUA 4WEQA 4XDGA 3U80A 4JI7B 4JQSA 4DIOA 1HMPA 1RBZA 1T2UA 1GADO 3HA7A 1OBFO 4H1UA 3RK0A 2CB0A 5BV0A 5KAMA 1XEAA 1EXWA 5DHAA 3WK6A 3K71B 5JADA 1JHDA 4IM7A 4NECA 4XVUA 4UAVA 3DZFA 1SKAA 4L4ZA 3AM3A 5E3HA 2AQKA 1CUIA 2YMMA 1F2VA 1GA4A 3IH5A 3H6HA 3T4PA 2PUAA 1BROA 1DT3A 4DNOA 1U5BB 3F2VA 4QBFA 1I7QB 4H17A 5P21A 1L7NA 5H83A 1FTWA 4BUZA 3T3OA 3N0TA 3PEWA 3UEOA 2BF4A 3A37A 4LVUA 3KAPA 1ST2A 4EFLA 4JVNA 2P68A 5MDHA 3PYLA 1E3LA 3RUAA 3V7NA 1QO9A 1IJBA 4KFRA 4OKSA 3ZIUA 2PCLA 1G55A 4RIIA 2H06A 3IVMA 3THWA 4GP9A 4Q1CA 2YC2C 1FRFS 2J31A 1ODIA 3ECCA 3UJCA 3W5CA 2A5YB 2OZKA 3EPHA 2VP2A 3GRAA 3EWIA 1NPTO 2VDWA 1DAOA 1FSGA 3LKDA 2WIAA 4G4IA 5HUJA 1W7AA 1KBOA 2ZYVX 4IY1A 4BVAA 3UPDA 1AK1A 1RLUA 3FCOA 2GO7A 4G1VA 3IEXA 4R4JA 3VR5A 3S70A 4ZOQI 1ZJJA 1YDMA 1O6FA 3EAQA 3K0FA 3T94A 3E58A 1QHHA 1DHTA 3HSYA 2FZVA 3LGSA 4P3PA 2VTEA 3TIIA 4ZK6A 5L4NA 3RV3A 4CZ2A 1M0WA 1Z4QA 2FZ5A 3SZOA 5CVDA 2DFDA 4JUAA 3T3MB 4EY8A 2O5EA 2YHUA 3RPEA 4V39A 1V9CA 4LOAA 3UKDA 5IM4F 3KKKA 3NNNA 4OFWA 2ZVDA 1DFIA 4FKBA 3RAJA 2IYZA 2VC2B 2J4FA 2B5VA 3IUNA 2I2BA 3H2BA 3LQRA 3OKPA 5D5PA 2E1PA 4QYXA 5EHQA 5FUYA 3L4JA 4JYBA 2IVZA 2FTKE 3DF9A 3NUGA 4A2WA 3AYZB 3KT0A 1MV5A 3EVZA 4GM4A 3GJ8A 1PLKA 1ZH4A 4GNKA 3RI3A 1Y1QA 1STOA 4BO0A 4MUGA 4ZCTA 5KINB 1VPTA 3VJRA 3EZNA 1CPYA 1EWRA 1GD1O 3FHJA 4R0VA 4X24A 5JVDA 2COKA 1H0SA 4A9AA 1LY1A 5BW6B 1Y1RA 1I7LA 1WB4A 1UAGA 4FHZA 3V42A 1GR1A 3A4IA 5BNFA 4EJMA 2CV1A 1FYWA 2P35A 4J91A 2BEUA 1NBEA 1KERA 3H13A 3RSSA 3WIDA 1JFFA 4C4ZA 2POQX 2B2NA 3TMKA 1GGJA 2F4NA 4X1KA 1IZ0A 3HCRA 4GM1A 1IBLB 1REQB 4I8DA 1Q6YA 4QBGB 1ZN2A 2KJQA 1YDGA 1OIXA 1TPYA 3E2MA 3P2EA 3SFVA 4LX0A 2R7NA 3TW0A 4D9IA 1V8DA 5DE3A 3BDIA 3OF2A 4I50F 3PFWO 3ABSB 4CMGA 2J5QA 1CZOA 3AVOA 1H0HA 3K2IA 4EL0A 1PZXA 2Z2YA 2QD3A 1QHHB 3FDZA 1DDIA 4RKQA 3KDAA 3MZ0A 2OCKA 4H59A 5CW2A 4H0NA 3NBMA 3RCBA 3UV6A 1GPLA 3JQAB 3IAM1 3P2JA 4CQMA 1RBYA 5AYVA 3DLTA 1T8TA 5E6SB 3AM1A 1HF3A 3P97A 4CMBA 4DQDA 1TUBA 5CH8A 2B94A 1ST3A 4RV9A 5K05A 3K5WA 4M1KA 4PXSA 2CL6X 2IA5A 3MD0A 1T6XA 2H1HA 2CXNA 1G21B 1XDZA 2FR8A 1CJCA 4JFRA 2GN6A 3D8SA 5F1PA 5HKKD 3SVLA 1YDFA 1TQ8A 2HADA 4W9RA 5BR7A 2V5AA 5LMZA 3OJCA 3I9FA 3QVSA 2GK7A 3KYCB 1PT9A 2JJ1A 2UUBB 3FTQA 3QNMA 1AB5A 3C3YA 4J0EA 1FP6A 1K2WA 1KJWA 3PRKE 2EYQA 4NFLA 5EZ6B 3ZNOA 1P0PA 1KJIA 1QVWA 1YDHA 2PRKA 3GAFA 3LNTA 2XKJE 1BH2A 2ZSDA 2I54A 1Y89A 1Y1PA 4L08A 1YIDA 1QR6A 3R9WA 2WU8A 4LJ4A 1A8QA 4DUZB 4R6WA 3NHKA 2XCRB 3MRSA 1LLQA 1DDOA 5K8UA 5AKHA 1Z3CA 3WE7A 3DLBA 3WDMA 3VR2A 2YOFA 4DCSA 5KYKA 5I7OA 1EHIA 1QANA 2UUOA 2YRWA 3ZW8A 1NIPA 4NY1A 2WV9A 3EFEA 4B3IA 4DJAA 3V97A 3UG7A 3JS5A 4OQQA 3NIFB 2XYHA 2ZOSA 2C2XA 3KEOA 1HYBA 1Z5PA 1K75A 3BCSA 4C78A 1L5RA 4JBHA 3HXLA 3JWJA 3FOZA 2ZTVA 3GA5A 3ASUA 3HR8A 5DVZA 5DM70 1XD9A 2W2TA 1UT6A 5CD9A 5DEOA 4DQVA 4UVGA 3BIJA 3UMJA 3V3TA 4PHCA 3WQRA 4BNZA 2XR1A 4FFBA 3SX2A 4A0GA 1P2GA 3Q9NA 2CMDA 2O3SA 3B7PA 3IP7A 3SIPA 3HM9A 1BS1A 1T5TA 1E3WA 3VO2A 4DMMA 1DKUA 3BJZA 1HXHA 4G5SA 3S68A 1H66A 1D2EA 2WWYA 1M2VB 2C1ZA 4DNQA 1KI6B 3VOSA 1E2EA 4HEJA 5FRDA 1I9CA 1QGDA 3W6PA 4LJ8A 2WMDA 1YZNA 4HDMB 3O9ZA 2OESA 1DCKA 5A4IS 2GDJA 1AQNA 5CM2Z 4OXKA 4B2IA 1IN7A 3U17A 3OJ0A 4F84A 3MTGA 2EW2A 4EPXA 2JD0A 2IYWA 4RHXA 3DZBA 3FVQA 4J1TC 2UXBB 3P71T 3CXRA 4X6YA 3QLTA 4GEGA 5GM2A 2C2ZA 1WU7A 5E9AA 4FIDA 3WGJA 3KR1A 1JG1A 3CLRD 2J0QA 1FQOA 2WJPA 1CVLA 5JRJA 4LBYA 4M0EA 1Z62A 4I5FA 3AEYA 4IIHA 3UPUA 2IIVA 2V7QA 4NOKA 1FQJA 1EHCA 1TK9A 3L06A 1IDN1 4BFCA 9MHTA 2QRNA 1XCJA 2P79A 2WKWA 3PJGA 1WHSB 2R1VA 3A9UA 5JZOA 3CVYA 1VHQA 4KREA 3IQEA 2BM1A 3GZ4A 2FWJA 3T4EA 3L8EA 1THTA 2XZTA 3GO4A 3HP7A 2FN8A 3OP4A 4BFSA 3LLMA 4D96A 2WUEA 1R8JA 1GUDA 1O77A 4I1OA 4L9RA 1E6UA 2RGBA 3TPZA 3WDSA 1SUBA 3HVHA 2PUHA 3V4RA 1AQYA 1PFUA 4M0DA 2VH5R 3O6VA 3FUVA 5TQ2A 2YWBA 2AFVA 2BI8A 2ZCUA 1VPDA 4QTXA 2X7HA 4OP1A 1V2HE 4OSPA 5F5NA 2OBXA 4GPTA 2CXTA 2EZ4A 1CP3A 3HCWA 4MTLA 4DRXB 3I5XA 5C1IA 1K4KA 3TQTA 3GLFB 4CRWB 1RJEA 3BMXA 4TZKA 3TKLA 2NMVA 4B45A 4Z7NB 5IAEA 4FM9A 2IUUA 3TLGA 1QK3A 2WTAA 1M1XB 3ORQA 4EFDA 3TG2A 2C78A 2YW2A 4GKKB 3WOVA 1C8VB 1L7AA 3R5KA 1CRZA 1FXSA 1GQRA 4LNUB 2CMFA 1U2TA 1ECFA 4KAJA 2BCGY 1CUCA 4QJIA 4UU0A 5DWVA 4DUGD 1E7WA 4HH1A 4GQAA 1ZMTA 3EA4A 3R76A 2H1IA 1WPQA 1DAGA 2VVTA 1RI5A 1XPUA 3PBKA 2GBIA 5CUQA 1HDYA 4XTCS 4A03A 4CGZA 5SYAA 1HDOA 2Y68A 3EFOA 4ENWA 3Q3HA 2F64A 5I7SA 1GDHA 4OFBA 3HJNA 3C3XA 3RVMA 1M6WA 3THYB 2NQTA 2PXHA 1H9AA 2GT1A 2VF7A 2EL9A 3PHCA 2LIVA 2LIPA 2JI8A 4G24A 2Y1XA 1W2HA 3EEFA 4MICA 1HH4A 3E9QA 4MV9A 4NABA 4QYMA 3LA6A 3KQYA 3TXYA 1PQWA 1AXGA 1V41E 2YZNA 3TRHA 2WZDA 3FCUB 4UD2A 4XSHA 3PQFA 1L1FA 1L2TA 4LQ4A 1BA3A 2EWWA 1Z33A 5JNTA 2ON6A 5HX7A 4DDTA 2O2ZA 2LKCA 4K05A 5J58A 5C0OE 3ZE0B 1XCMA 4YCMA 1XTRA 2IXBA 3MRVA 4JI1B 2A0FA 4IDDA 1P9RA 4ISBA 5G4KA 3ZHYA 5DSXA 3O2QB 3BWMA 4IJVA 3ZHCA 1CJMA 1KOJA 4LZOA 2FQQA 2VOJA 5IAOA 2IYRA 4DKJA 2GTHA 3K15A 1BKDR 1EK2A 1NI3A 1TJPB 3VX4A 1SIBE 4NK5A 3DZHA 4M0FA 1MEOA 3EG9A 4YRCA 4RLFA 5B7PA 1UC4B 3GZNA 2ST1A 2D59A 1I4DD 4V0QA 4A6DA 1NJ5A 3JALA 2FSHA 4LYYA 1AY0A 2YRXA 1JQKA 1KFBB 1W85B 3OZ7A 4RS3A 3T7CA 3VC7A 5C5CA 5L6MB 2BHRA 4XFKA 3QQPA 2W8BB 1DHRA 4MUJA 1A8HA 1O8BA 1A4UA 1DKPA 2GBCA 2M6LA 2Y2VA 1KQNA 2RGWA 4DXHA 4BQNA 5KNDH 4LG1A 1E58A 2PLRA 2J7PD 2MHCA 2DQYA 3ETGA 3IVCA 4K9MA 3SK0A 3UT5B 1P44A 2NW6A 3FMFA 2FZKA 3ORYA 4EO7A 2B1RA 2P65A 2Q1YA 5EXSA 4OXXA 4P9NA 3WGLA 1P9WA 4Q7LA 3MLEA 3I2JA 4H77A 4P4TA 4QYTA 5KI6A 2QAGA 1FMCA 4CQLB 1NRIA 4I9UA 4KQFA 1C0EA 1PF7E 2IHYA 3AJ8A 4MX8A 4E6PA 3A1NA 3W0LB 4CEIA 4FJ0A 1KIAA 2OBLA 3EBOA 4NS1A 4MJ3A 1J0XO 3IR6A 1Q5PA 3VH1A 4Q3KA 3STYA 4A91A 1HTBA 4QJ5A 1D6SA 2D8MA 1I36A 3BHIA 1KK0A 2XDQB 5JECA 2CXSA 3KM0A 1K6XA 4Y0AA 3BJRA 3DNMA 3TSCA 1XZQA 3LUPA 4TMXA 2ZT8A 3ENVA 3HBNA 3UFBA 1S7CA 4H1WA 1U9IC 3ZJUA 1EVKA 1C7RA 1KPIA 1LDYA 4KO8A 3TE7A 3ZCQA 4KPEC 2BDEA 1ODJA 1BVRA 1CYDA 1L7XA 3F3MA 1Y1LA 1ZJ4A 4CQLA 5G3YA 2EC5A 1BMQA 1M7HA 1R0LA 1XQ9A 4YCNA 3IIEA 1CQWA 3F8SA 3ESYA 3AHGA 1H9BA 3FVWA 1T26A 3SC3A 4EW3A 3DMRA 2CFSA 2DWCA 2OHXA 5DK4A 2Z8YM 5A4DA 5HVNA 1XJ5A 2XNDA 3AZPA 5IBQA 4P31A 5LU9A 1DIBA 3VKVA 3RJ5A 2IS6A 1NLZA 2W70A 4P38A 1WB6A 2I7XA 4Y1FA 4WBNF 1U31A 4YV0A 2G1JA 1YK1A 2A0XA 3FPJA 4TLDA 2Z6QA 1ZUNB 1QE3A 2PWPA 3EZ9A 3SIWA 5K01A 1WUKS 2QRKA 2R2GA 5ESXA 1UIMA 1H6CA 2GD0A 3QOFA 1ZOIA 4YWHA 1GVHA 5DFAA 1EUCA 2UZ0A 1DG9A 1P18A 4M76B 1V7CA 5TY0A 2HF2A 2I03A 4UHHA 5K9ZA 3CVUA 5FX2A 2PJUA 3UVEA 4C43A 2QR3A 1E1KA 1TM1E 2B1QA 4NOMA 3QLVC 4EGSA 3ORFA 1GQOA 2VT3A 3WTCA 3EW7A 5J23A 1IOZA 2P67A 4KR3A 4UUAA 3HN7A 5LUBA 3HFJA 3L9XA 3DKKA 3PE6A 4HX5A 3Q7SA 2HQBA 4F6LA 4LRSB 2YNMA 4LWZA 5DTJA 4CCSA 1SU4A 4Y9SA 1OZGA 3IUYA 3L8CA 2BKUA 3X43A 3B1XA 3MAAC 4BAUA 4DLZA 1RZRA 2CZQA 1UT8A 3E9MA 5B7GA 4IUBS 3GFQA 3WI7A 1RAEA 121PA 1ID1A 4RF2A 1W0CA 4GOKA 2XNJA 3OJOA 1CQIA 3BFXA 2QRVB 1H1LB 4O4IA 3CR3C 4B6EA 5DHUA 1Q95A 2VCHA 3E4CA 3OPNA 3WFZA 4CLRA 5JNUA 3NYIA 2EQ5A 5AIAA 2CVFA 1TCBA 4QECA 4UUQA 5CLGA 4CIYA 1WETA 1E0AA 2OCDA 2Y3IA 1GCAA 2K2QB 4EVRA 2W98A 4US1R 1W46A 4IJKA 4LTDA 2ZUDA 4ERNA 4LY0A 2DMRA 1K89A 1WCWA 1YZFA 3FDJA 1TF7A 1S3FA 2FMUA 1Z0SA 2W6OA 2BFFB 2VYVD 3LK7A 2KS6A 3MLBA 3QVGA 4D4MA 3EQ8A 4OB6A 5I7FA 1OI4A 3VNQA 3RH0A 1BGWA 1Z12A 2HHJA 5DZSA 1NIJA 2BZGA 2O20A 3IVRA 5HFNA 5TGTA 1YE3A 2H5LA 3M6AA 1W5AA 3L7YA 1XVUA 2WT8A 3NATA 1I4OA 5BYBA 5IVIA 2ZVJA 3TIXB 3MJRA 3IV6A 3R23A 4GI3A 4XIYA 4ON9A 3ER8A 3D3KA 4ZCLA 1HTTA 5HK9A 3HVUA 4PN3A 1DQZA 1YR2A 1PJBA 1T4CA 2DR3A 2OP1A 5EVCA 3RASA 1FJXA 1O03A 4HPWA 2AJLI 3RJMA 1YONA 1GZ6A 4EMSA 2PKXA 4MW5A 4PVCA 1PIWA 3S27A 4LJAA 1HFWA 2G4CA 3LQKA 4BTVA 2REBA 3CIOA 3PPWA 1Z4OA 3CO5A 3DAFA 1KTIA 2ZRPA 2DR2A 4HZUB 5LM3A 3FGNA 3HCCA 1IXZA 4EY3A 1APBA 2C88A 4Q4HB 4FFWA 1XEXB 2OFOA 5EKXA 4EY4A 2AOUB 3KKQA 4MUMA 1BHQ1 4XRGA 2Q4EA 4NULA 2QVZX 3KLBA 1PS9A 4BQRA 2FR0A 4FKZA 4A27A 1U3GA 5M34A 4KUGA 1PN3A 2YHIA 2D4HA 2NV6A 1EB9A 3ZDFA 5KOYA 5HHTA 2NM0A 2H3EA 3CV3A 3M7IA 4JKOA 1I3LA 1PNQA 1MW9X 4ZHSA 1JHRA 2OCYC 1UP7A 3ESRA 4RTKA 1KZGB 5FBVB 4UFOA 5B2ZA 2A1TS 4AZVA 5H1YA 3FX2A 1V1RA 3UJ6A 1H2AS 4GGMX 2C3MA 2JIOA 1VECA 4IQGA 2W00A 1QFMA 2JLCA 3IQGX 2DRIA 3IQIX 2SKEA 4HQFA 4ITVA 5FADA 4NNJA 2HHAA 1M2FA 5I7EA 2A9RA 3KQLA 1LLUA 1JLSA 4I36A 1ENOA 2CZGA 2XHZA 3SMVA 1BD3A 1LPOA 3X2FA 5LD2B 1TJNA 1M34A 1SC6A 1TKRA 3EC7A 3ITDA 1SUSA 2VJMB 3K09C 4B87A 4U9UA 3I0NA 5EE0A 2JGMA 1ZP6A 2VKQA 3NTOA 4IDPA 4MW1A 4WPGA 5JE8A 4P1ZA 3NPMA 2CVOA 2I3BA 2FG7C 2PMWB 3P9RA 5JSFA 5TJHA 3IPYA 3NB0A 4AZTA 4E2FA 2JAHA 4Z7JA 3IDOA 1Z74A 4B8WA 1U8XX 1D7OA 1KXJA 3IAUA 3PA6A 5FL7D 3IA2A 1CERA 4IG9A 1B6GA 4URUR 1UZUA 2WUGA 3SSOA 2ZRBA 4DMRA 3WICA 4DIBA 3BIFA 2H1RA 2VH1A 1M8JA 1YZQA 3D8RA 2IK8A 4JNCA 1DC3A 1CB0A 1YQUA 2WWWA 1M1NB 5EZQA 3PP8A 4GW3A 5K99A 4NPAA 1L7DA 4EG8A 3ZJTA 3HS3A 1XTIA 2RHJA 1XTJA 4CMEA 1QRSA 2ZUEA 1WEKA 3EZGA 3OX2A 2VPPA 3OLCX 2II6A 3Q9UA 1U94A 4ESVA 1JYFA 2H63A 5ER9A 5CK4A 1GGMA 2DWPA 4Q9IA 1H69A 3K9FC 5FXMA 2EGUA 5KVSA 4RVCA 4U00A 5LYJA 4ZARA 5EQTA 1COWD 2O1WA 3JWEA 1QVZA 4O0LA 5M2QA 2O3UA 4LMRA 2J6HA 4TYYA 4QJBA 5GWXA 3ZW7A 5JQGA 2CBGA 4KQWA 1N2CE 3KJIA 2IPLA 5FEUA 1B73A 2JIBA 1I1QB 3AT1A 2I91A 4LZJA 4CUKA 4N9WA 3HUFA 1ACLA 1V3TA 5EZYA 5LKRA 1K4MA 4HYQA 1KBZA 5TEWA 1KI9A 3BERA 3RK1A 3WKDA 1M0EA 1GPAA 4BMNA 4E14A 1YL7A 3AZQA 1UUFA 3R6LA 1MMFB 3KYCA 4ZU1X 3FA2A 5CRIA 2JD1A 3LBHA 4O2AA 4OMFG 3K4QA 4RMHA 4KYIB 4YRJA 1ORVA 3KEFA 1QBGA 2DBVO 3CHYA 5FO1A 1N9GA 4AMVA 3GC6A 1LC0A 1L5MA 2IELA 3GWZA 4AO6A 2XB2A 2EKQA 3QVVA 5BQOA 2ZP1A 2OR3A 1Y6GA 2GZ1A 4G8BA 3LY7A 3PXXA 4N8SA 5CYGA 4X63A 4CHTA 2PX3A 5E4JA 1UJBA 3FIJA 2AKEA 4L57A 4N7JA 4GL2A 1VBMA 2X42A 4N7RA 3ZE6A 3EF1A 1EEHA 1E4OA 1P9OA 1REQA 3G9XA 4MUXA 2WLTA 4OKIA 4ZDJA 4IMJB 2O8EB 2JGDB 1YS1X 4HVLA 2HRCA 3GJ6A 5BVGB 2PT7A 3BFVA 3R3ZA 3LPNA 2ZQ5A 1IXYA 1ZEJA 1X7ZB 2IEAA 4BGEA 1EWKA 1K1EA 2Z6VA 2BIFA 2JHGA 3HFRA 3Q0IA 1J2UA 4WTOA 5D3KA 1IG0A 4BZPA 4YAGA 3ESQA 3OZBA 1P2FA 3M4JA 1ZVQA 4J4TA 4ILKA 5TJ9A 1U7HA 2WPNA 4MUBA 3W1VA 2RKOA 2W5UA 3BWBA 3AU8A 4TXLA 4TWAA 5C1DA 2GK6A 1P9NA 3NIBA 4Q4DA 4DM7A 5JAPA 1YZVA 2XUQA 4BP9A 2PMKA 1MO5A 2F17A 1QF7A 2O2XA 3IJRA 1LVGA 3LCJA 4G67A 1J24A 1D07A 2B30A 3AVQA 4ZO7A 4MV6A 4Q03A 3CUTA 4XASA 4YP0A 3WFIA 1ELOA 1DVRA 3SYRA 3RVNA 3WWPA 3ZHBA 4HTFA 1VMDA 2QQFA 5TS3A 4ZJPA 4XLZA 2D13A 2YXDA 4LF9B 2VJDA 1FUYB 1T13A 3OOHA 2PMBA 4CL0A 3WS7A 1QH0A 3KWLA 4L78A 3S0JA 1FOEB 2GJ8A 1CQPA 3MGAA 2V6MA 1E20A 1JFSA 5JDIC 9GPBA 1KIFA 5D7BA 1NOIA 2WC1A 2H7XA 3EVEA 4S3MA 3PGVA 3DO6A 3R20A 4WBNB 1EQ2A 2HMAA 4L9WA 5G4KB 3KFVA 4J7AA 5CB4B 1X7HA 2ZS9A 3IXMA 4NZNA 3A6LA 3AIOA 2QVCA 4KPUB 1YZKA 2HW8A 4Q01A 1YF3A 2IP4A 1T2DA 4XQEA 1LGYA 1HE8B 2EBFX 4HXYA 2IS1A 3DMNA 4U7DA 2HNAA 1GG9A 4QGGA 4PGMA 2VJBA 2QZJA 3A11A 1NR5A 5FI3A 1GPBA 4ZI7A 2ZUWA 4ZV4A 4GLLA 3RC3A 4FD3A 1FFCA 3AY6A 3PHBE 2R65A 3V8EA 4IH9A 4EUHA 3OFNA 1UMDA 5KYVA 7GPBA 4YJ3B 3OZEA 4NE2A 4M9SA 3DHWC 5HM6A 2YHBA 4U2FA 4QL3A 3GN2A 1CZNA 4JC4A 4B1FA 5I01A 2MCFA 4NEQA 3DW1X 4F1KA 2IXTA 1UJCA 2Q3MA 2ATXA 4ME6A 2VSXA 1Y8QA 2ZR8A 4OH7A 4RDIA 1XMPA 3KKPA 1IJFA 1QWSA 2B83A 1KQGA 2QRHA 1JEYA 3X2SA 3ZQKA 1U90A 4LF8B 2WYWA 1MN6A 2PVCA 2AZMA 1G5QA 1ZJZA 1XMJA 4CCAA 1BWPA 3ANXA 3SJCA 2NV0A 4DR7B 4EA7A 2N75A 2RIPA 4MQUA 4BNLA 1LJLA 3I6YA 3NM5A 2Q2WA 1EVLA 5ED0A 3I1IA 5ABPA 4Y6RA 1U9YA 1XGKA 1YKGA 1YJ5A 3EXHB 1XQWA 2V59A 4LC0A 4KIGA 4ZQBA 3N59A 3N2NA 3WMGA 1QK5A 4GXTA 3CB2A 1UAYA 1X8JA 1L4HA 1YKFA 1ISFA 1OT5A 1W0KD 2CVPA 1GAEO 3EZLA 5ARBA 1EP2B 4YQFA 2VK4A 5FPTA 5DM1A 3MELA 1OLUB 2V8OA 3OPYA 5FTMA 3WA7A 4MPDA 4JI6B 3AFMA 2YN0A 3KKNA 2P5TB 3KKZA 2COEA 2WLSA 2QRLA 3ETNA 1TO1E 2O6LA 1GYQA 5JCJA 1YJXA 1RQNA 4ZZ2A 2Q07A 2PD3A 3RKSA 4A8JA 4W6ZA 1SVWA 1KZ4A 1X2BA 2XSZA 3AR7A 5IXSA 3KQHA 3PSAA 2RHHA 4UBJA 1BQ4A 2EIHA 3FCAA 3JATB 4QPCA 4Y0VA 4FWIB 1D0SA 4LSMA 2C5HA 3IBSA 1OTYA 4WNAA 4L0MA 3BN3A 3RVRA 1IEXA 3HKBA 3EMDA 1JAXA 5EWLA 2NTEA 1L5SA 4CM9D 2Z2JA 3GG2A 1OHHD 3RQSA 3Q40A 4B9EA 4RNCA 4EKGA 3A6FA 1XALA 4E08A 1VCNA 5JFGA 1F20A 3LZ6A 5H4HA 3TLGB 5D87A 4F4CA 2GX6A 1XDUA 4Z9YA 5EP4A 4DIFA 4O4JF 2AUMA 4D9BA 4TTIA 1E9CA 4W7SA 2BLLA 4ERXA 2VNHA 2H52A 2XMGA 4MP3A 3IKJA 4HWSA 4J0QA 2BGRA 4NTZA 2ILVA 4OHPA 3GFBA 3BCUA 1GY8A 2WJIA 4D8UA 4B3HA 3G5LA 2Q8QA 3L0ZA 1BEUB 3D6MA 3ETHA 1MQSA 2AUNA 3K6KA 3LU1A 1LPBB 1KFCB 3H1BA 2O19A 4YJ2B 5JI3E 5CA1A 3AQIA 4IZIA 3U13A 1XTZA 1GXSA 4Q3LA 3WQHA 5A4JA 4IHJA 1A5BB 3OEWA 5J4HA 1ZM3A 3K6JA 4B2PA 1OB5A 3U4AA 2CLOB 4UCXA 1XNRB 1KAHA 3FJ1A 3MSXA 1BS2A 3EIQA 4NK4A 4MAMA 4BN5A 4CIDA 4PSDA 1GCIA 2BHSA 2ZXEA 5ALOA 3VDNB 1UK8A 4NFHA 4CKCB 5C80A 1QQ7A 1SBQA 4BGVA 1K7EB 1U7UA 2C99A 3BMNA 4YO8A 5JDCC 2CCKA 1PQUA 4IYJA 5DHQA 4F9FA 3AEQB 2WSYB 3NP7A 3P9XA 1C7JA 2PGLA 1T9HA 2GTPA 3SXUA 4ZAVA 2HF8A 4RPLA 5D5HA 3LT4A 4X60A 1SKUA 4W8GA 3REQA 5FEMA 5AMXA 2WIJA 2V3CC 1KYXA 1V39A 3FTPA 2CXXA 1PSDA 3ZCVA 1QYCA 3D8UA 5BV1A 1N34B 1JEOA 1HYGA 2E3JA 4A8HA 1FVOA 2RSLA 2Z4TA 3B38A 2LDBA 4RFLA 5G53C 4WN9B 1XR3A 3JTEA 4JCOA 1RXSA 4DLYA 5CFMA 5F3RA 1M74A 3SSAA 4A0QA 4MIEA 4AL4A 3HL4A 3S1SA 4RK1A 4DV2B 2WJGA 4OFZA 5JXIA 4JUFA 2JAWA 3JQFC 3MJEA 4R16A 3WAKA 4NCXA 3EB9A 3JX9A 3GCGA 2HSZA 3QMMA 4IGFA 2GASA 6GPBA 1MP0A 3GLGA 1GLNA 1SC9A 1NLUA 3BFPA 2X4GA 1U0FA 2X23A 4FLFA 4MKRA 2BM8A 2ZYHA 4MWOA 4OG2A 3IOCA 2A5JA 5EY5B 3LYLA 3MIIA 4BN4A 1AHHA 2PFKA 1FTSA 1ADBA 2JFOA 1PG5A 3L0OA 1Y3FE 3WDLA 4BV3A 4B8YA 3IELA 4MWDA 5TE9A 5K0CA 4K86A 3QVJA 7ABPA 3JQAA 4C2AA 5DTRA 5KTKA 1MABA 4KL8S 4CR7A 1GT6A 4CQJA 1MAAA 3PFHA 4MLCA 1YVRA 4OM7A 4AD8A 2JH8A 2QSUA 3ISTA 4TSRA 5DHSA 5FT9A 1BG6A 1T29A 3WGZA 2BAGA 2R00A 1BX0A 4I50A 3PXUA 5C4GB 3WG9A 4NBNA 3L7CA 3AEZA 7AT1A 3K1JA 2F55A 2IF2A 2XUIA 3ZU2A 5C4IA 1PBNA 3C97A 1CY4A 5TPWA 2D2XA 2CC2A 4I9HA 2V7UA 3KG2A 2RGUA 5ALRA 2NTNA 2JIQA 2ZI4A 1NW7A 1KS2A 3EVTA 1Y3BE 2R751 2CFOA 1N5RA 2PUWA 3I37X 1U02A 3KKMA 3ESCA 4LMBA 4A0SA 2ZSAA 3CJTA 3KOZA 4RCVA 5AVJA 1K8XB 3WWDA 1W4ZA 1PSWA 4KEAA 1DKOA 1QYIA 3E7DA 3GLUA 3R7WB 1U28C 3A3PA 1DX6A 3DDSA 4C6HA 3K9NA 3CSUA 4IPTA 2W42A 2OV6A 1IZ9A 3LECA 4B79A 1N2CA 2PJZA 3D2BA 4HV4A 5BMOA 1K8ZB 2ZJOA 1BDMA 3NXKA 3FI0A 1Q0RA 3EUAA 3OUZA 2GJKA 3K6RA 2O8NA 3BHNA 2HMYB 3DD5A 4G1EB 3PPYA 4Q66C 1Y34E 4WZ6A 4C20A 2ZI3A 5A5DA 3VHXA 4C76A 1UDCA 4NWIA 1VE5A 5EIWA 1X15A 2CDBA 5KJ1A 3PFIA 1QV7A 3KEQA 3HVJA 2FPMA 3SIXA 2IV7A 2WF7A 4N6NA 4P7KA 3RIMA 3GVHA 4RVHA 3U1TA 1GYRA 1UMBB 4AP9A 5HS6A 2QG6A 2D8AA 5IKPA 3VNUA 3F98A 4AJLA 4E1BA 3DEAA 1I2BA 1PJZA 2PAAA 1BE1A 2Q4TA 2QF7A 5D00A 2VXYA 4GSYA 4UPDA 2M98A 4NICA 1PEAA 4PICA 4XGNA 5AJTA 5DKFA 1WAMA 3R9KA 3TCXB 5JZBA 2P1DA 4CEIB 2D7CA 3AF4A 3AFOA 3EDCA 4LXXA 1CE8B 5DW0A 5F35A 2ZIXA 5CG2A 3SF8A 1FC0A 1O6GA 1XHEA 1SURA 1S4QA 3TSYA 3ZTWA 3KAKA 3ZV4A 4BO4A 3E5MA 3MXTA 3FB1A 4C29A 1VXRA 3FTNA 3GAAA 2YXLA 4E13A 2F9LA 1XAJA 2H2AA 4QLBA 5LZ7A 2DBQA 3H18A 3BIOA 3E7PA 4MA0A 2FK7A 4EY6A 4C7JA 4F6CA 1Z6YA 1IAQA 1PR6A 3PE4A 2OILA 3UHFA 2WSIA 5LR6A 1MORA 3CZPA 5HIIA 3WGQA 4C3OB 3NM6B 5C35A 5A5GA 2J1LA 1Z73A 1U0JA 2CXQA 2G28A 3JPYA 4L5AA 3PNPA 4Y6SA 3WHKA 1FK8A 1WDTA 3P5SA 4NX2A 2XRZA 2ZZNA 1NVDA 3DS8A 3ZK8A 3VMFA 1H5NA 3FFTA 3RC7A 3M4NA 2D5BA 5I5GA 1F6WA 2ZB2A 4XLTA 3ZYCA 4FYXA 5ALLA 4QARA 5JYCA 2PMCA 3QWFA 3FSRA 3ZV5A 5GZ6A 3LF1A 2Y9MB 4IWYA 4KO3S 5LZ8A 1BSVA 2W2LA 1T9DA 3L1JA 3KUDA 1NP6A 2A35A 5BWBA 3TLEA 3BZBA 2V98A 1KPGA 3V1YA 3DAGA 2O8VA 1JDBC 1LSJA 3THXB 4OX9B 2PRYA 1B8NA 4QXAA 3K0EA 3KKLA 2WTBA 1KH3A 2JW5A 3L6CA 4TWIA 4NDZA 3UWSA 2YV1A 3B3GA 2PZKA 3BKXA 3FGPA 4JEHA 1TYCA 4XEHA 5ENVA 4B0OA 5JMTA 3DJFA 521PA 3C3AA 2NVWA 4ETWA 2H51A 3GVIA 2ZRNA 3NYRA 4WCFC 5T6MA 1CF9A 3OTIA 4M1QA 1LNZA 1XU9A 1X80B 1L7MA 3AHFA 2BGTA 2WEKA 2G8NA 5I9TA 3OT5A 1ECGA 3ZPXA 1LW7A 3BMCB 2VBIA 5JYDA 1QM5A 2R66A 4QTTB 1J0DA 2ZBVA 1TM5E 1U0RA 1Z34A 3GDOA 4B7CA 1L5ZA 2C57A 5AWFC 3UQZA 3QHQA 3V2IA 2XUKA 3CNOA 3FTFA 4K03A 3DM5A 3RDPA 2Y77A 5BWLA 1Z0ZA 5DASA 1G60A 3IX7A 1C4OA 4PYLA 1GFSA 5FHQA 1A4IA 2DHEA 4M8IA 3UB2A 3GPLA 1TAUA 1FQKA 4KQGA 1NOKA 1MVOA 4YRZA 1E96A 4LEIA 2QLBA 3C4QA 4ND8B 4WK6A 3IV7A 3QSGA 4JKYA 3T7SA 1U3UA 3VR5H 4UVDA 1O8CA 2ZI6A 4TRMA 4AQDA 4BKPA 1T2EA 1N78A 2GHQA 1M1NA 2HGZA 4GM0A 1HA3A 1Z08A 2VNKA 2FK8A 4KBYA 3VU9A 3ZI7A 3OX3A 4N5IX 1CJTC 2OQIA 4RE6A 5F1YA 4C0AC 2YMQA 1SD1A 3ROEA 5E1MA 2OB2A 1N9GB 1FSSA 3W77A 3GD5A 4QEZA 1MENA 1JHVA 1WR8A 4R05A 2CL0X 1R6VA 4YAJA 5IDYA 4EFKA 3BAZA 2Z3ZA 5GMOA 5IKOA 4D8TA 3OM9A 1LSOA 2IW3A 2NYRA 3FNIA 1WMBA 3GIWA 4B40A 3GLSA 3UGJA 3H1TA 2NYAA 1E79A 2R25B 2BMWA 4DNXA 4HYTA 1ECJA 1FP4B 1VJDA 4YP9A 1RHKA 3Q7PA 1GRQA 2DAPA 2IY8A 3BICA 2FJ0A 2NADA 2CW5A 3FPAA 4RORA 2H1OA 4NLLA 4UDYX 5KOHB 4XX0A 1N3LA 4IWNA 4L51A 2Z1MA 1MOZA 3D59A 3UUWA 5FYDA 1YL5A 3MJSA 3U7HB 3AX6A 4QXOA 2QSYA 4YALA 2ZW9A 2KHZA 1JN0A 5TF0A 2EOAA 4N6OA 4GWLA 1RE0A 4I1IA 4MVJE 1A5ZA 4UTOA 1HOXA 1SVSA 2V65A 3M5DA 3MTAA 2C5FA 2D3WA 3WNVA 4IQ4A 5LIRA 1I0IA 1NAHA 1CR4A 1NNUA 2C4KA 1O6ZA 1XRLA 3AUTA 4K9KA 4IICA 1SEPA 1H5QA 4B4VA 1XQ6A 2VAPA 4DRXA 3LG2A 5DM4A 2K7ZA 4DBVO 1JYSA 1LRLA 4ZT2A 2IYYA 3NDIA 1K08A 3OESA 4ZD6A 1PEDA 4ZYYA 1ESNA 4G1MB 4XX0B 2N9UA 4N5NA 1JLMA 1CIPA 4DSZA 3AJDA 1E5QA 4G6ZA 2QV7A 4FYWA 2YZGA 2AQHA 2VRNA 3L7KA 2NVUB 2GSWA 2EF1A 3NBYC 4U7HA 5GQSA 1JZQA 3OZUA 3GHYA 2PBZA 3L04A 2PYIA 3EMBA 4WK2B 2FFRA 3PI7A 1Y4AE 4J2TA 3BEOA 1J7KA 1Z6ZA 2BFNA 2CXRA 2NZJA 3DLAA 3G8YA 3PIDA 4ND2A 5HDBB 1MOSA 4MLPA 5HZMA 4G0QA 2QUZA 5FNZA 1EFKA 1OUMA 5FTLA 2QR2A 4N3CA 5ALXA 1GR0A 1GGFA 4IMIB 5ECDA 3PJRA 2FEWB 3NHZA 4LK3A 1JDPA 1UXOA 2QK4A 2WWHA 4PQGA 4CKWB 4CT0A 4YXWD 3Q0TA 3U61B 1J5EB 1QOPB 4R84A 2F1JA 3T0IA 1FFGA 4K2AA 1UOQA 4XWTA 4YY3B 4BZQA 1TRHA 5GIPE 2CVHA 3WLQA 2WVAA 1RYBA 2F3RA 1I3MA 3JARA 2A9OA 4JX9A 3DOOA 4ASUA 4O4LF 3AP2A 1DCFA 4DIDA 3ZQUA 4EO4A 3FD8A 4LZPA 2FWNA 3LGAA 2FMIA 1SUDA 4UHBA 2BGUA 5EWLB 1OVGA 5JFTA 2OK7A 1X1CA 1B0PA 3QBJA 4TGLA 4OI1A 2W58A 1K98A 3HKEA 1I80A 4PGGA 2ECQA 2P5YA 4PWYA 4TYNA 2K5UA 2LUOA 2JHAA 2Q3CA 3R2JA 2Z8XA 3HUDA 2WP8J 4H7FA 3L5KA 4L15A 4YV1A 1FZTA 3M2TA 1ULAA 1B6RA 3JQCA 1MA0A 1V5WA 2ONCA 3PRJA 4UDOA 3WDKA 2FMKA 1JTEA 1O97C 4MPPA 4UZSA 3H2JA 1ZZGA 2IODA 3EBLA 4TKLA 4XVHA 1SVNA 1YQQA 1ZKDA 1EX6A 3V1KA 4ZDKA 4HVAA 4YRPA 4QPNA 1D1TA 3HK2A 1IPEA 3QMPA 3VPGA 1ZMXA 2G9UA 2C4TA 2R7LA 4PPYA 1KWKA 5ECYA 3OM1A 1IEWA 1X1RA 8ADHA 2C4UA 2XZLA 5LZ2A 1SU8A 4ES6A 4GXRA 3D3JA 2DWOA 1AKTA 2R60A 2XNKA 2WVHA 3CUWA 3PC8A 4JJ4A 4PTZA 4YXWA 4BYMA 1ZVJA 5BOVA 1OGIA 2QXYA 1P5RA 3HYTA 1AMUA 3SPXA 2ZIUB 5KVVA 4ZI7F 3AONB 2QMOA 1OAKA 3K53A 3O93A 1Q15A 2ONKA 3P0JA 4V0MA 4BQSA 1Y3CE 3K4HA 1E2QA 1KO4A 4CKBA 1N5MA 1KO5A 1X9HA 4OQZA 4R8LA 3K0SA 1TPZA 2OXRA 1M2JA 2YMPA 3QLUA 3AL3A 4DJDC 5IKEA 5JI2E 4NCBA 13PKA 4ONEA 1C4KA 2HRBA 4JSRA 5AESA 1ZCAA 3PL1A 4G65A 2BKEA 1OTXA 2G9ZA 4IHJF 3USCS 3ZHOA 1ANKA 1EZ4A 1PUJA 2JRCA 1L9XA 2J3LA 2Q8PA 1YT5A 1XLTC 3CUVA 2O0KA 5DBGA 1TCUA 2W8ZA 4KLZA 4RA9A 4XKJA 3WRYA 3F2IA 3AI3A 1UQRA 2ZQYA 4DZTA 1E1NA 4UHEA 1W36B 4DDKA 1LW6E 2DP4E 4WN9A 2W6QA 3KLNA 5TR9A 3VKWA 4XVQA 2NO1A 4KGDA 4URZR 2VQEB 1G8GA 1Q1ZA 3OM0A 4LE2A 2PKQP 2UZ1A 4M9UA 4F4UA 3C41J 3RABA 2R7KA 1JP7A 3TUJC 4YIHA 2JK0A 2Q4OA 2OP0A 1UC5B 3U6KA 1DU4A 2HK7A 4C5CA 3L8FA 4Z7QB 5DGXA 2ASVA 3HN2A 1L4MA 1F8YA 3DVQX 4URXR 1YDWA 1U2DA 2Z08A 1JBKA 1OLOA 5BSEA 3LC7O 1A9XA 1PEYA 1B3RA 1U8EA 3ZH9B 3N2KA 3NYWA 2F9MA 4L3WA 1A50B 1T5LA 1JEEA 1XQXA 2BR3A 2Y4OA 4OOFA 3O38A 2BP7A 5DCLA 5FDFA 5LSAA 2YXPX 1N6IA 3A9WA 1EPUA 2BEWA 3B6KA 1K7YA 1LC3A 2ZR0A 1M76A 1H8HD 2XKBA 3MFQA 3WQQA 5ALKA 4FNOA 2Q3BA 2HO5A 4UVIA 3W8EA 1GAXA 2I4OA 3GVXA 4ZCPA 2IU3A 4KXUA 2OZLA 3QMVA 4FQ7A 1DO2A 2VSOA 3O8DA 1ONBA 1XMVA 3LO8A 3UW3A 1JFFB 1FVXA 1Z4LA 2A88A 1CUSA 2FVYA 2VTBA 4QPPA 4B8ZA 2WSLA 2MSNA 2N1MA 3GFGA 3CF4G 3IO5A 1CETA 1BW9B 3EUEA 3ZW9A 3NJRA 1O1YA 4HAVA 5FWNA 5JAZA 2HPVA 3DKVA 3A8TA 4HAIA 1P0QA 1CUYA 2R6R1 2ZTSA 3THOA 3WYAA 3GNTA 4I1UA 1KQOA 1ISSA 1VYHA 3X1XA 5FR2A 2GEBA 4CMCA 2WIFA 4Z5XA 3VNVA 1AGPA 3OCJA 1X6VA 4LC9A 2NAPA 3O3CA 3GY0A 1OXMA 2VHCA 2AX3A 3I9OA 4C1BA 4EABA 3W78A 5AJWA 5L7YA 2QUBA 3CF6R 2G8LA 1HT0A 3GRYA 4LBVA 4BMOB 1QKIA 4BUJA 1MJHA 3PCXA 1JPVA 4LPSA 1KRXA 1G20B 1QHXA 1ZM9A 1CZKA 1T15A 4FZRA 4WNAB 3R6DA 3QVMA 4BS9A 4M8SA 3U3RA 3IVAA 4JDPA 4B3MB 1WP9A 3ER6A 2BEJA 3DSRA 3KOOA 1QXSA 2D1SA 3CUKA 4RMJA 4RETA 5T64A 5KNCH 2WFAA 1JIJA 2VSYA 1ZN9A 2BE7A 2JGEA 2REQA 4FOSA 3D0RA 3AKEA 2ZK7A 4L76A 4PWZA 1JH8A 1ORTA 1SKYE 3AF5A 2PAFA 2HPAA 3ABQB 3K5PA 1V6SA 1WKCA 3BT7A 4AG5A 3VVLA 2YHSA 4P32A 1TA0A 5G40A 1JEQB 3FJYA 1W76A 4H3SA 5B7NA 3L0DA 5LIPA 2O8DB 2WQZA 4CLXA 4ZCSA 4LWPA 3T4XA 3VUEA 2NO5A 2PZJA 2CWWA 2Y1OA 2XT9A 3R8FA 4FMCB 5FWYA 3MAGA 1V8ZA 1VL2A 3KPJA 1Q1GA 1DC6A 4MHSA 3N8KA 3CE6A 1PZMA 4O2LA 4WDRA 5FJJA 3HU3A 4R68A 2M2IA 3OSZA 1RYEA 3WLLA 1E59A 2J85A 4FZJA 5J59A 3VR5D 1TM2A 2WAYA 2JIRA 1DTEA 1XIVA 2I6XA 2UYGA 1EFCA 5D1HA 1FDVA 1FCJA 5ADUS 2C7RA 2XSZD 2CKMA 3OFKA 3OKAA 2CSXA 1QIDA 2I9KA 3NEPX 4G5OA 4CMKA 4WXPA 5CBKA 4KODA 4U63A 1DUIA 2GD2A 2C2BA 1XROA 2C84A 2ECFA 3I09A 3Q4GA 3QPBA 2IX3A 1RPAA 1AUOA 2WFLB 3BGOS 3OOJA 2XDQA 3R4CA 2Q1SA 2WPDD 2IU0A 2JEOA 2JAXA 4RD0A 3T12A 3QHPA 1PKEA 1P17A 2X13A 4MVJH 4DBLC 2OD2A 2QRMA 1ISHA 3DBVO 3F5DA 3OOEA 4Q15A 5ALNA 3OZAA 3WY9A 4R1SA 2I6FA 4BO2A 4DJFC 3KJFA 4C4SA 2OAQ1 3C1UA 3AFGA 3AINA 3LKZA 1MEEA 1P77A 3KB6A 4B3CA 1W5EA 2XYGA 5EESA 2C1EA 2I9PA 2ZBPA 4BYGA 2B7LA 1JLRA 4V1CA 2VHTA 1T0HB 2O52A 3I76A 3QLJA 4PGHA 5E4YA 3UHOA 4CGYA 5GM1A 3RHSA 2I2CA 2AR0A 3HC7A 1D4ZA 1JAIA 3T0FA 3EZFA 4HDSB 5A7GA 5CXUA 4JXXA 3R09A 2HSWA 4YK7A 1ML3A 2ZSEA 1SOUA 3DMDA 1LX7A 5DP1A 5EUCA 1RAAA 4XR9A 4J7XA 2AC4A 1VI6A 2ZBEA 3Q3GE 4KH0A 1JHAA 4C6RA 5FPKA 5JALA 1E9SA 2OZLB 4ZEOA 3CKMA 3D3WA 1W44A 2V8BA 3QF4A 3Q3EA 4PPQA 3ED1A 2IZ0A 3O4RA 3IUMA 2OECA 2C8VA 1DO0A 4WVLA 4ZRDA 3ZZTA 1K06A 2FW8A 1QKJA 4UU1A 4HHEA 3P9NA 3AKZA 1NURA 3KB8A 2H11A 4H1HA 1A9OA 2B4KA 2J3HA 3D64A 5KTYA 2E0IA 3M4XA 5F7XA 4FSXA 1G98A 1P6XA 4C0JA 3DZGA 4H3KB 1B1CA 4IXDA 1J00A 2XMDA 2ZE7A 3V34A 4CV3A 2WRZA 4YO7A 2Y05A 4OLBA 1Q2UA 4I4TF 2QN6A 2Y71A 4B71A 3TMAA 1PJLA 1SHLA 4IP0A 4F72A 5I3CA 1LLFA 3LFUA 5EMKA 2JAQA 5E2IA 2D3TA 1SIWA 3CWZA 1ZD9A 4HG2A 1E1QD 3RYCA 2WTEA 3O74A 5ITZB 2NU7A 4H0CA 2I8CA 4G8DA 4GHWA 4B17A 5AUPB 3VVMA 4P84A 3OJXA 1LUAA 2C20A 2H4XA 3L1UA 5K0NA 1JIVA 3FHTA 2CZCA 5FOTA 2C1XA 2QVBA 4YUZA 4GSLA 4G4GA 4OJKA 4R54A 4XAQA 3MB8A 1VFPA 4JXKA 2VUHB 3SQDA 1G2IA 4ZKEA 4PLCA 1EQUA 3ZD9A 4W5NA 4LRYA 3WTBA 3NHWA 4P4SB 3C7TA 3I5AA 3ONWA 4ITRC 1X1DA 5EIHA 2IKQA 4HN9A 4BLRA 2SCUA 1BRMA 1V45E 1H8EA 3A4VA 4DLSA 1SKYB 4CG0A 1IVNA 3HJRA 2WMOB 1J8FA 1WLYA 3ZDAA 1KJ9A 1E1CA 3FFWA 4DR1B 3E1GA 2NU9A 2P9HA 3HVIA 5FWXA 3BBPA 1TMGE 2R87A 4Y9UA 2V0NA 1BDIA 1RPJA 2A59A 4Q7EA 1NZFA 1YL6A 3VFDA 4EFMA 4KE7A 4RFVA 4OMCA 4DR2B 2ONJA 4AC9A 3ZHTA 2R79A 3L2OB 1PCXA 5GZ1A 3FJOA 2C4MA 2X3FA 4MW2A 4NENB 3V9PA 3O82A 3ULKA 4UBMA 4Z6KA 4IKOA 4FS3A 3ZKAA 3T5TA 3PQ4A 4DV0B 1YVDA 1WB9A 2NQ2C 2AHOA 2X4IA 3OEEA 3P1JA 1D1SA 4KFSA 2R85A 4N0DA 2W2LD 4OXIA 3AR8A 2D54A 2TRSB 1Q7RA 5CVUA 2ZRAA 1M6EX 1QH9A 5ALQA 1WV0A 3HG7A 3T6KA 3RYCB 2G5CA 5CTAA 3MCZA 5IAGA 4QULA 5KIAA 4HSGA 4R2KA 5TEVA 1RWPA 3TLMA 2O9JA 2WJZB 1GUYA 2XZDA 1FLVA 1QGUB 2AOTB 3QENA 4FE7A 3TNYA 4CNQA 3LBYA 4F5ZA 1UK9A 2MYUA 4PR3A 1VSBA 1U63A 1O5IA 1KDZA 5CU7A 3MVEA 2VAXA 1PLJA 1R3DA 1TIKA 1VG8A 4JX8A 4XQ9A 4YPOA 2GVZC 1ICEA 1Y8ZA 2WWGA 2VZLA 2HBRA 3PIIA 4I3FA 2ILTA 1JWLA 4ARVA 1F9AA 4OSEA 5A4KA 5K3BA 4UOEA 1K68A 1DOAA 1IZYA 4R1UA 3V7WA 2GCOB 4OHKA 3PEFA 4M36A 2YHIB 2OLKA 1CW2B 3ZHZA 2ZM5A 4MP8A 2JGLA 3TQHA 5A02A 4Y6GB 1KH2A 3PR3A 2BFWA 3G1UA 1PS8A 1K9VF 3C24A 4QOJA 1SKQA 2HRRA 1D8TA 2DUUA 2AH5A 5AJVB 1TYBE 3R0XA 3ROZA 5BPFA 3PXCX 1NKTA 1ULTA 2IUSA 1N0UA 4E2ZA 5A3VA 2W6JA 1NVGA 3CPJB 4YGYA 1FFXB 4BKOA 5JS1A 1J33A 3HXPA 2WTUA 1A1SA 1JQAA 1BU5A 1VCOA 1ATIA 1S8FA 4YJ2F 3TSZA 4WXHA 1HSOA 3HY3A 4QU0A 3V6MA 3LXXA 2LKDA 3A3NA 2WQ6A 4PHTA 1OZFA 3JZDA 3CH5A 5DM2A 4CFYA 1XK6A 5JNLA 4TTAA 2OMKA 2I78A 1P60A 1ZLYA 2B61A 1CT9A 2IXGA 4UHCA 4FVTA 3WL4A 1XZIA 2PSEA 5JXJA 3IEKA 5TVGA 3MINA 3TNFA 3OBBA 5KCZA 2KB0A 3MJVA 2GRAA 3FRHA 5FL7A 5IKXA 4EMTA 4JT2A 4N18A 1VHLA 3EVBA 4OI4A 3RVSA 4PNEA 5FI5A 1M66A 2VJNA 2A1TR 1M83A 1KOFA 4HEQA 1AQLA 3EOBI 3CVXA 3M5WA 1H22A 2P62A 4A92A 5GVRA 4BNFA 3QLVA 2FZEA 4ZREA 3U4GA 1RRKA 1XRNA 3TN7A 2J3MA 4E5KA 1P2BA 1QTRA 2PV7A 3D0OA 3HU2A 4WL0A 3WBFA 3QELB 4QDTA 3UWMA 1G7TA 3ZHRA 1PTJC 1E2LA 2GWHA 1CK4A 1JBEA 5HOQA 1R5BA 2F7SA 4R1NA 5THQA 2EFHB 1R9MA 1ZRSA 1RJ9A 4FZVA 1PW5A 4KVZA 2XUDA 3A1FA 5BQPA 3V7UA 4DT1B 4GPIB 4RVUA 3T9DA 3U9LA 1QO0D 5F3DA 5U4QA 5J4VA 1F8XA 1IPHA 3HV2A 3IGFA 4D4LA 4OI0A 3IE1A 3THWB 2FV8A 4FYHA 5D84A 3RUHA 3ZV3A 1SA0A 1ORDA 2P9CA 5KYUB 1N5KA 2IV2X 5D2CA 1ZQ9A 1PWZA 3RRYA 2BGNA 2EAUA 2R3SA 5DTEA 4E5PA 3A4YA 2C54A 1UL1X 4YAWA 3OJEA 3BH0A 3RBVA 4GR4A 3NORA 4JHLA 4LZZA 5KTSA 2JBWA 4TS1A 1UQUA 3K2QA 1QYRA 4RENA 4ND5A 3WK8A 4L7VA 1DAPA 4MUIA 3PC2A 1YMUA 3MHPA 1H6DA 3JR7A 5BNZA 2HCRA 1N7GA 3BHJA 2HMUA 4L8VA 1HKUA 4JROA 2WICA 3ZWXA 5KMGA 3QUSA 1R6DA 2GESA 1R9NA 4CKWA 4L5CA 4P3XA 1HG0A 1OLXA 4TL8A 4OQYA 1NVUQ 3TD9A 3VC3A 1W59A 2ZAYA 4EW2A 2QUKA 1WD7A 4GLFA 1GUBA 1BCSB 1RABA 2QZ9A 2W6MA 2J9YB 2G0TA 2XTJA 1SQ0A 1EVJA 1RVDA 3DNFA 1RLTA 3CUYA 1KFKB 2OBMA 5TDHA 5CFPA 3DP9A 4F06A 3QU2A 3M9WA 4H4CA 1L7OA 3DQQA 1YASA 1MC8A 2O0HA 4I4IA 5EJ5A 4YMWA 5K3EA 3HB9A 2JIPA 3ANMA 2QRGA 4KQ2A 3ZE7A 3GJQA 2WABA 1F7VA 1NHWA 1M2VA 1V1JA 1ZO8A 3IDFA 1TU3A 4MJXA 1QQ5A 2X5OA 1LDEA 1BKYA 4DDMA 4WUTA 4JLPA 1Q19A 3FTCA 1BOOA 3GW8A 3I01A 3SHQA 4CF5A 1E98A 5DYIA 4BP3A 4NJOA 1EUQA 3AUFA 5UKDA 4PXYA 2FG6C 2OXCA 1YMVA 4OQMA 3G8AA 3M9XA 1T0JB 4RV4A 5ALZA 2H4ZA 5ALYA 4QWWA 3W3ZB 3FPFA 2ZYDA 2RHCA 2HPHA 4JHXA 4X97A 5D51S 5FTJA 1NWCA 3AF6A 1N2ZA 1SELA 3E1SA 3KDPA 1FFBA 3MAJA 3PTLA 4PYKA 2OFXA 4B4KA 1W35A 1G41A 2FN7A 4KW7A 4A16A 4TN1A 1T6BY 4QQ8A 2XADA 1C80A 3PX3A 2I5PO 1FQWA 4MO2A 2RCYA 1TEXA 2I7DA 3C39A 3L7AA 3AU9A 4ICIA 1FB5A 3KXDA 1C7ZA 1X0XA 1Q0TA 3ZNNA 3Q72A 2H2IA 3T3IA 4QD3A 1JDBB 3A1VA 2Z2ZA 3DUFA 3N0XA 3KD2A 3ZGZA 3LUJA 1CVIA 3RK4A 5J2TB 4V0LA 4FCTA 2DFVA 4ZJZA 3NKFA 1U0BB 4NXMB 2BN4A 3ZS8A 2WYHA 2FEKA 1U7ZA 2OC9A 3WLIA 5BN4B 3A6JA 4HDCA 1C9MA 4DLUA 1I9GA 1LK5A 2RB5A 3OAAA 1GP2A 5AM3A 3ZNPA 2VK2A 3FZQA 3P9QA 4OB8A 1KZ7B 3KQOA 4GI5A 4NBLA 4HP8A 4QICA 5J9FA 2PXCA 2Q1WA 2VHJA 9LDBA 4L9AA 1GRRA 2ORWA 2E55A 2AEJA 1HFEL 5KKCA 2VUSA 3NHPA 3TVYA 3Q8LA 3GRZA 4LOIA 3C48A 2ZAGA 4KQKA 1WQ4A 4H9GA 1TM3E 4YR7A 1D5WA 4CKEA 5KNDA 5ILQA 2VLIA 1JAYA 2ZTUA 3B6MA 4QT4A 4EJ0A 4PBSA 3C8ZA 1W48A 3FBWA 1WBBA 4DILA 2HQRA 2CLLB 4QDJA 1MO4A 4EKIA 4BZWA 1GRVA 2B8NA 4FDAA 4IX1A 3SR4A 1YD7A 2QLMA 4HN2A 3EVCA 1UJ2A 1CD5A 3S8YA 4F3TA 1SBZA 1FXUA 1M1ZA 2YV3A 2V7VA 4RF3A 1VPWA 1FDUA 2E4WA 3HR7A 2JAOA 2GCOA 1QIIA 1UFKA 3IDAA 5LBTA 4Z0TA 4R8SA 1PL0A 1GL6A 1L7QA 3H2ZA 4PNPA 5CXXA 3REFA 3TLCA 4B3DA 1G3QA 4GSKA 5C8XA 4E2YA 3FGZA 1JR3D 1VBKA 2GFQA 1A9ZA 2GLTA 4PZUA 3UWKA 4BNWA 2DPHA 5EAIA 1RD4A 5LP1A 4TTJA 1O0CA 1JLLB 4CQNA 3C8HA 1GSIA 3LHDA 1YVPA 2XWSA 4HS9A 4UXHA 4UM5A 2J6IA 3H2HA 1A7KA 1TIBA 3F6BX 1Z0FA 4JP8A 2I6SA 1JDUA 1W9MA 4G8CA 1Z06A 2BD0A 1JHZA 1F3LA 1IJEA 1PWHA 4RSHA 2O8FB 5DLPA 3UYKA 4H7EA 5FYQA 3AJRA 2HJHA 1GKIA 2J59A 3L7NA 4Z0PA 3FPLA 4MDFA 4D0LB 2GNPA 3UMVA 1R5JA 2W2OA 4OJTA 1U7DA 1OXKB 1KPHA 1A7UA 2A4MA 2QGNA 3G89A 3G79A 3HEBA 4II7A 1HYEA 1HWYA 1P62B 1HC7A 4IYRA 4J0JA 3UATA 3L79A 1I94B 1DGQA 1A2BA 4DF3A 1Z5NA 3O75A 4TLAA 2IYVA 4HGQA 1N6OA 1HFJA 4JBXA 1OCEA 4PW0A 4QNMA 3REOA 4BFYA 2AYYA 3RSGA 3BUSA 4J90A 5AFSA 3VQTA 4YV7A 3NBXX 3I45A 2ROQA 3FE2A 2PUBA 1ULSA 4TXMA 1ZZEA 4MROA 5JMPA 3VR0A 4BZZA 2B3TA 2C98A 4CTKA 5LD2C 1LPPA 2UUAB 1L3IA 2QYSA 1N75A 1MABB 4ZCIA 3KALA 4OBBA 2GA8A 4UMFA 4K46A 3DE5X 2Q3FA 2V3WA 5COAA 1WPXA 3CLTD 1BN6A 1S2MA 3AJAA 1GPWB 3OHMA 4PS0A 1JVSA 4URWR 3S1AA 2QQGA 1XRQA 5G0VA 4F5EA 2H4WA 2YQZA 4TT3A 5AXCA 1LBSA 3F78A 1QPBA 4ML3A 1MB2A 3B1WA 3BE5A 4R98A 4RSRA 4ZPXA 1SXGA 3AM5A 4O2RA 4KN5A 3DA8A 1LI5A 4GC5A 4S12A 4EW6A 4PAQA 3EH1A 5AR1A 1FL9A 1Q1NA 1T2CA 1H0KA 4WOCA 1H4QA 4D3FA 3ICWA 3PUXA 3UHJA 3WWEA 1KR5A 1L3CA 4E3WA 4RFSA 4G0OA 1BWSA 4P4LA 3U3OA 1LFAA 5JBQA 3IA7A 5JWRA 5LB4A 1Y7IA 5AQEA 1VL1A 3SKXA 2IEIA 3JV7A 1VYVA 2DQ4A 1P7WA 1RXIA 1R00A 2PX0A 2SBTA 2C5AA 1OASA 3Q85A 3QKIA 3ANLA 3W3AA 4OBEA 3AGQA 3NVDA 3P2OA 4HMOA 4JKIA 4PINA 4RTOA 1IHOA 2J9FB 2WTMA 4O33A 4RYDA 4JQZA 4KPGA 4MW9A 5IH7A 1GLGA 4HNQA 4IOKA 2GCPA 4ZQFA 4J7CA 4OSOA 1MVNA 5TPZD 5IEJA 1YB2A 1T4BA 5CCEA 1F14A 3LVBA 4PHHA 1NDHA 4E5MA 2GCGA 2LTAA 3K9BA 3DQPA 3DL4A 1JA9A 4FMDF 3UT5A 4XDHA 1MQ8B 1M2WA 1Z75A 1P0FA 4W5WA 4C9BA 3V9AA 4X61A 4JT9A 3TO5A 4HNUA 1T6ZA 1GTMA 1FVFA 4U02A 1NASA 4QLOA 1IH8A 4R1OA 2HJSA 2NXJA 4V0RA 2X0EA 4DCJA 1ZR2A 1CF4A 3EDRA 4AUEA 4ZOLA 1Z15A 1NT4A 3GLHE 4YLGA 5BR1A 4UDXX 5HQ3B 1KO7A 1IM8A 3HDYA 3TPCA 2OPBA 2JATA 4LI0A 16PKA 1SB8A 3VV3A 4DA6A 5JRZA 1OXTA 2D5LA<