3L43A

Crystal structure of the dynamin 3 gtpase domain bound with gdp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
242
Chain Sequence
QIAVVGGQSAGKSSVLENFVGRDFLPRVTRRPLVLQLITSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynamin-3
publication title Crystal structure of the dynamin 3 GTPase domain bound with GDP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 242
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l43A00
4JL8A 3R9WA 4MGIR 4WVFA 2BCJQ 3MJHA 4LBZA 3UKDA 1OIVA 3I5YA 1OV4A 4MA4A 1AQYA 1DAEA 3NC1C 1KY2A 2JJ2A 1II8B 2D74A 3KKOA 5FTLA 1J2JA 1E32A 2CNWA 3KUDA 2R2AA 4RCZA 1SXJB 2IEYA 3OEHA 1G16A 4P0TA 3SYNA 4DUGA 3U6BA 3RS3A 1KAGA 2HDNB 1ZM2A 2DWOA 3ZYCA 1EFUA 2WBLC 3U3OA 2ZRNA 2PT7A 1KI2A 2GRJA 4QC2A 2O0JA 1F2TB 3E1SA 4KCGA 4TMVA 2PZFA 4HLQB 5F9HA 1BS1A 4B32A 4QJ5A 4NYJR 2PMKA 5A5GA 2EWWA 2G0NA 3I5XA 1CF4A 4CGZA 3BH6A 3ZS9A 2QQ0A 4B2LA 4JLMA 2CK3A 4DRZA 1WP9A 1KMQA 4CEIA 2X77A 2WKPA 4U7DA 4UXJA 3CX8A 4EPTA 3OE7A 4QM6A 4ON9A 1DG1G 1XD9A 1LFDB 3R8CA 4C0SA 3TSOA 1NVVQ 1JPNA 4BFZA 1VHTA 4GFDA 1G64A 1TF5A 3QY0A 2UKDA 5FOSA 1DBSA 1ZC3A 2F1RA 4LPSA 1G7RA 2ZRGA 3HDTA 3C41J 1KHTA 4US1R 2JJ1A 4F38A 1GKYA 2K5UA 2W83A 1J99A 4B34A 4RD2A 3DOFA 4I1SA 3WP0A 3CO5A 5KHOC 3A6PC 2HJVA 3ZGXA 3AVWA 3KQNA 1TF2A 5B2ZA 4ZCLA 3FOZA 1N5LA 3IHWA 4K46A 5AUPB 1KO7A 3M6AA 4E09A 3K70C 2AX4A 4F4IA 1RRFA 2OV2A 1DO0A 3DZ8A 1Q1QA 3TUJC 1VYUA 2CNWD 2WWYA 2QAGB 2VP5A 5FR2A 1Z22A 2W2TA 4JLPA 1K6MA 5FBQB 3SU8A 5DE3A 2JLVA 2P65A 4JVMA 2OAP1 3L2OB 3VHLB 1JJ7A 4A1FA 2C5LA 1FQKA 3F0TA 3TH5A 4GZMA 5TXGA 1KOFA 3AKEA 4R71A 4YMUA 3AEZA 2YOGA 2AFIE 4CEHB 1W0KA 1XCMA 2QGNA 2FU5C 4US2R 1GG2A 4Q47A 5A0FA 2OCPA 2GHIA 4LBYA 4MYUA 3SJZA 1XTIA 2FNAA 3ECCA 1NMXA 1UEJA 5J4VA 1NG9A 3SJBA 4TL8A 4DXAA 4PC1A 2C9OA 2P2LA 4A0GA 1X1RA 4M1WA 1KKMA 1U81A 4PXAA 1S3SA 4D4MA 3I4LA 1N6RA 2AD1A 4QRHA 2GVDC 3GFOA 1JQJC 2Q6TA 5TDHA 3O8BA 4MRSA 5UKDA 2QMEA 5KDLA 1FTNA 4V0MA 1IN7A 4HI0E 3REFA 4I1OA 1E0KA 2IL1A 2ZREA 4FMDF 3AVQA 1D5CA 4RFSB 3B82A 3ND8A 2GZDA 4PO8A 3QPVA 5HE8A 4HSEA 4X8LA 2CL7X 3KTAA 3PITA 3ASZA 1OH8A 5K8UA 4Z1MD 1A82A 1CS4C 2CJWA 3AVPA 1VMAA 5AUNB 3EPKA 1CULC 4H1VA 4ZKEA 3K0CC 2CMKA 3TW4A 3UMFA 4B2PA 4M4SA 5CJ2A 1MV5A 1PV4A 1KYIA 4CT5A 3QBTA 1GWNA 4NCIA 2DWPA 4V03A 4Z8YA 3ZS8A 4C0JA 3THYB 3QXSA 1FMJA 2VSXA 1LS1A 1GKIA 1NBMD 2QAGA 4LV8B 2IYXA 1GIAA 4GP6A 5IK2A 5JSZB 3VKGA 4Z1MA 1UKYA 2ANCA 1TUEA 1VPLA 4QBGB 5CDFE 3L82B 2HLDA 4FCVA 1OPXA 2J5XA 2JEOA 2W6JA 2ZYTX 2JGNA 3KB1A 4HATA 4QHYA 5JHGB 5DI9A 1AGPA 4BUJA 3X2SA 1ZUIA 1NVWQ 1E2IA 2F9LA 3KXIA 1M1YE 3IQXA 1DAMA 3EZ6A 5E4FA 4QOSA 3CNLA 1L4YA 1E4VA 4G0NA 1ESMA 1YZLA 1I4TD 3OAAA 3EC1A 3AP2A 3SOPA 3TQFA 2JLWA 5TARA 2PJZA 3GJ5A 2WJJA 1RPZA 5K8TA 2F6RA 4NCNA 2YKGA 4B3XA 2ODEA 2KE5A 5FBWB 1FPMA 5HCIA 3WBKA 1VTKA 3EPHA 1Z0AA 5G3ZA 4O3MA 5TMPA 4NP6A 5AUQA 2C04A 4TZ0A 4EQ6B 4RY2A 4MH0R 2JA1A 4TQUS 1G8PA 4PTLA 4B3CA 2D2FA 2ZRCA 3OIYA 1U90A 1UF9A 3AH8A 5BW8A 4DB4A 1G3IA 3ZD7A 2F7SA 1S3GA 3WRYC 4EPRA 1TAGA 4QGGA 2YC2C 1W47A 3W6NA 1FX0B 4C0AC 3R7WA 1CR2A 2ZI3A 3VHXA 4A2WA 1TNDA 2J0UA 3DMNA 3MWJA 2E9SA 3CB4A 2JJ2D 5JBQA 1C1YA 1HURA 5DYGA 3NEYA 4OI4A 4D0LB 1EGAA 5LD2C 4Q18A 4DEXA 4YONB 2GJKA 2ZRIA 4Q19A 3CNOA 2QZ4A 2ZTSA 4WW0A 5JJKA 1U9IA 1XJQA 3CW2A 5KDOA 4EAQA 3PUXA 2IEZA 3ONWA 4C9BA 1W36D 4M9QA 1NMZA 2FSFA 1EESA 1R8SA 1ZM7A 4Q1CA 4C2UA 1TU4A 1NKTA 3IBYA 4OQNA 4PAMA 4D4KA 4OJKA 5CB6A 2QE7D 1E2EA 2RAPA 4AG5A 3ZD6A 4URYR 4POAA 4U00A 2ZYVX 2A5JA 2CCKA 4EPYA 1CJUC 2X2FA 1E9DA 4DZZA 5L3VA 2QAGC 3GJ3A 1QVRA 1T4GA 1WMSA 3K53A 2WSSA 2ZUBA 4LUCA 4QJ4A 4TMXA 4Q48A 1OYYA 1E9AA 4MKIA 1LVGA 3GLGB 3I61A 5FH9A 3TSWA 1GNRA 4LJ9A 2ZRJA 4HUTA 3SE0A 3H84A 2OXCA 2WWHA 2ZAOA 3DO6A 3BB1A 1GNPA 4RCYA 1RYFA 3K0EA 2IYZA 5FUVA 1OE0A 2G3YA 6Q21A 4B35A 2QTFA 4Z54A 1DG3A 1W1WA 3KJIA 4P4SA 3RS0A 1Z2AA 2JLZA 4BFWA 1HT1E 3U5ZB 3KQKA 4XD7A 3AKDA 3FWYA 2R8RA 4DBLC 2ZSEA 4CEJA 1R10A 4KVAA 1KZ7B 2D7CA 1XXHE 5FOTA 2VSFA 4BEJA 1US8B 1DAGA 2FN4A 3EZ9A 2W2XA 3U7FB 3L0PA 1L7VC 4E5UA 4YMWA 2WMNB 4OQXA 2GESA 2ZETA 4MRPA 2H16A 2WSMA 1Z29A 1XD8A 3BIFA 2WJIA 1ETUA 3AVOA 3LBIA 2HXYA 4C0LA 1FP6A 2F43A 4M9XA 1QF9A 4MRVA 3JZAA 3NHBA 5C18A 4GNKA 3IBGA 3I72A 4KVGA 1E6CA 4K8OA 5FOVA 3SJAA 3OIWA 1GNQA 3KXLA 4LHVA 1AZTA 3ZVNA 1EWRA 1XJCA 4E03A 2C99A 3CIOA 1E79D 2FMXA 1G20E 4UJ3A 3NBYC 4DIDA 2IHBA 3SFVA 2GVZC 1DPFA 2FSIA 2V3CC 2VH5R 2A5YB 2XTMA 4V0KA 2Q3FA 3QNUA 2ERYA 2QY9A 3NEJA 3CUEF 3GLGE 2XAUA 4D4JA 2CK3D 5IT5A 4TTRA 4YMTA 4GBMA 1U8YA 1JQLB 1WDTA 5EP1A 4D0GA 4UXIA 2ZSBA 3L43A 4PAOA 4MQBA 3W8RA 3UG6A 2WVJA 2OM2A 3KQHA 1ZYUA 3AQ4A 1T0HB 3T5DA 1RYHA 3L0SA 3P1JA 5KU1A 1BO6A 1RRPA 4AKIA 2DFNA 1IAQA 1W0JA 3QXCA 1OB2A 2BEJA 1E0SA 3I1FA 1KI8A 1TUIA 2B8TA 1BYIA 1E1RA 1ZD8A 2WZQA 3AF2A 1NBMA 3EXAA 2EW1A 3K9NA 1CJKC 2V7QA 3LVQE 4QXAA 4WOPA 3MJRA 2GEDA 4BLOA 4C0QC 1JEEA 2RGAA 4DLVA 3BERA 3PV0A 2VL7A 2QPTA 4Q1BA 5JWHA 3Q5EA 2XEXA 4GP7A 1G4AE 2H5EA 1V43A 2QA5A 2W6IA 4KV9A 4IW3B 5HZKA 4M1MA 4BGDA 4WA7A 1YE8A 5CDFA 1P75A 1XX6A 1OB5A 4ZCMA 3GMTA 1P7CA 3LX8A 1XTKA 2TMKA 4YC7A 4G5OA 4F91B 1T6NA 4Z51A 1SVSA 4HAYA 2EFCB 1NVXQ 2BMEA 2D2EA 2OFXA 1Q1BA 3OIVA 1SVWA 4Q1EA 1GL7A 3VU9B 3THWA 4OKSA 4RD0A 1E9RA 3X1ZA 4IFEA 4Q7MB 3U7EB 4AG6A 4GOKA 2F1IA 5FPKA 2BC9A 3LX5A 3W3AA 4RD1A 3VR5A 2O8DA 2CXXA 2HEIA 3QI2A 5H1YA 3OFND 5HE9A 2GEVA 2VF8A 3ZLJA 3SHFA 1TMKA 5CYOA 4HLUA 4PAQA 2QNRA 3OESA 3CWQA 2XNSA 1OFUX 3E70C 3NBXX 5H68A 2RGBA 1FP7A 1E2GA 3I32A 1QHSA 4L5BA 4JJZA 1QG2A 1G21E 4PQFA 4QGAA 3TJZA 3IIJA 4HDCA 2OLKA 4JYBA 2IYSA 3PFIA 2VA8A 3P26A 3OIUA 4WXPA 1AA9A 2FF7A 1VCOA 5L3QB 2PT5A 1Y3AA 1VG0B 2ZJ5A 4PHFA 4MRNA 3FHTA 3QF4B 4HDQB 5M04A 1CRQA 4TYNA 2Q9BA 1AKYA 1NVUQ 4B74A 1XFAA 3BC1A 2ZUCA 2J1LA 2IYLD 1M7GA 1VCIA 4M2LA 3AP3A 1BIFA 3U61B 1G17A 1E2DA 5E7MA 1P5ZB 2V8OA 4CRWB 4BFUA 2DBYA 4IOKA 4O2LA 1G4UR 1H8ED 1KSFX 3ETLA 5HCNA 5B57C 5TV2A 5FR1A 5TB5A 2GJ9A 2FGKA 2Z83A 2IWRA 4Q4JB 4TLAA 1RZ3A 1ZIOA 4XVUA 4BFYA 1G3UA 2CBZA 2PZEA 3ASYA 3EC2A 3SC3A 1JB1A 4M1YA 4NONA 3MCAA 2BM1A 1W44A 2YZ2A 3AKCA 3A1TA 1E99A 1NP6A 2KSQA 4MDFA 2BM0A 5JRJA 1IHUA 4Q66C 4XWAA 1P2TA 4P4TA 1FOEB 4LJYA 1IY1A 2IS1A 2HUPA 2GCNA 3BORA 4LJ7A 3CPHA 4KHZA 3D6TB 5LDDC 2OAQ1 4EKDA 2JLRA 4XIGS 3U7HB 2P3SA 1CEEA 2R6FA 3BGWA 4NL4H 3ZH9B 3KJGA 3CRMA 1RJ9A 4IDNA 5DIFA 2Q3MA 2QM8A 3DVLA 3QJYA 2V6JA 3LRPA 3PG5A 4PZLA 5GJWC 1G7CA 4NYMR 1TPZA 3MUFA 4IFBA 2A30A 4AIIA 1COWD 3WNCA 4E22A 3ZZTA 3EARA 1H65A 4TSFD 4D80A 4TYPA 4GOJA 2BKEA 5E7IA 2QQEA 4F4CA 4OHYA 3TQCA 4RD6A 4DLTA 421PA 2E1RA 2J0VA 5J4HA 2VP4A 1MOZA 2GZAA 1UM8A 1GRRA 2PX0A 3EIHA 4CEIB 2ZJBA 5P21A 4DJTA 1WBDA 1SHZA 1AQUA 1M7BA 1CBUA 3Q85A 2XXAB 1WQ1R 4Q9LA 1Q21A 4U02A 3GEEA 1QHYA 1MRSA 4S35A 1AS0A 3MMPA 4JVNA 3KXKA 3QOFA 2R9VA 5KSOA 4YXWA 2BJWA 1MABA 1YRAA 2ZRFA 4IVRA 4NYIQ 1VECA 4JKIA 4FINA 2ZXUA 1NLYA 4IRUB 4AYTA 1AS2A 2EWVA 3K70D 3N2IA 1G8FA 1ZC4A 4BPBA 4DB2A 2VO1A 4G5SA 3KZ1E 3PXGA 2FDCA 3OHMA 4B33A 1K5GA 2J3EA 4GOXA 4MGZR 1KI6A 1KI9A 4YXWD 2ZJYA 1R6BX 5JSZA 2AWOA 4R2HA 5KTYA 1YU9A 1I4DD 1B0UA 3IHLA 3UWOA 2EVWX 1P3JA 1W49A 1LV7A 3T34A 3LXXA 4QNMA 1JAHA 2BV3A 1XEXB 1HEIA 2QT1A 4XVRA 1Z0KA 3LFUA 3MG9A 4Z8XA 5DI3B 2XNDD 4FXPA 4A92A 2HCJB 2HYDA 4PO9A 5BN3A 4ZDKA 1COWA 2ZS7A 1SXJD 3GLIA 4LBWA 3VX3A 2BMJA 5CLLA 1QRAA 4BFXA 2G1JA 1NRJB 1KIMA 4QM7A 5JCPA 3DZDA 4TSFA 5IDVA 1G291 4UNPA 3EPLA 2IXFA 1LY1A 4B3FX 4PSAA 3DOEA 4ARZA 3TMKA 3W5JA 121PA 2WTUA 1E9BA 3LD9A 4KBGA 2OBLA 3MSXA 4DDVA 3SYKA 4ZDWA 3N5CA 2VHUA 1WF3A 3U4QA 4A2QA 1U99A 5LBIA 2MSEB 4TYWA 5L3SA 5BQ5A 2GCOA 3C15C 2JLYA 1N6LA 2WKQA 4K81B 4URXR 2NPFA 2VP0A 1JR3A 2REXB 2VHJA 1OW3B 3PVSA 3N70A 3EA0A 2RGNA 4D2IA 1WB9A 2BBTA 3CRW1 1I2DA 1FNMA 2OCBA 2R6CA 3T1OA 1YR9A 1N6OA 3VAAA 5L3RA 2ZPTX 5KUTA 3MFYA 2I3BA 4B44A 4PX9A 2VP9A 1X86B 1AN0A 4B47A 4EUNA 1EFRD 2ATXA 2BCGY 2DY1A 3P20A 4NE2A 4B6FA 4LCBA 3RS7A 2RHDA 3K70B 1E69A 1P2SA 2WSSD 2Z4SA 1XP8A 3HWSA 2IUSA 3BWDD 5JI3E 5DSZA 3SS8A 1SGWA 4FMCB 5KNBA 3IILA 1X8LA 3FHOA 2ANBA 2B6HA 4NZYA 1GFIA 1DELA 1OFIA 1S1CA 2H18A 2W58A 2FV8A 2ZS8A 1A1VA 3QF4A 3QG1A 4U5XA 5AJYA 3GFTA 4URZR 4FWTA 3WRXC 2E87A 1E2JA 1MKYA 3M1IA 3EAQA 2JJ1D 2G0TA 2ZITA 4OHWA 2A5GA 1W4BA 1Z06A 2WWGA 1HQYE 3LV8A 3CF2A 3LWNA 1UKZA 2GA8A 5IK2D 2W0MA 3OEHD 4DUGD 4GL2A 4FMBB 2OESA 2IUUA 3CRQA 2O8DB 2J7PD 4FWIB 4C7OB 3WMGA 1IY0A 3IQWA 1ZM9A 1ZUHA 1YZKA 2RKOA 4Q4LA 4M0LA 1J8MF 3P4YA 4RKEA 1HY3A 2ZRAA 3WMFA 2CE7A 4M1SA 4D81A 1Q20A 3NTUA 3OZXA 4DCSA 3CONA 3TBKA 3B60A 4NU0A 2Q0HA 4P3YA 5KSPA 5KNDA 2QBYA 3A4LA 1PUJA 4TN1A 1U0LA 1YZTA 2QRZA 2J41A 3UIEA 2I1QA 2Q9AA 1AM4D 1BMFA 1CJMA 3GPLA 1KMHB 3FGNA 3AV0B 3GLFA 1HTWA 1Z6YA 5EE5B 2QL6A 4QBHA 1E2LA 3SBDA 1VIAA 2KJQA 2MSDB 1JECA 1ZIPA 2DWQA 2V1XA 3RLFA 4PQYA 4AKEA 3MGCA 3KJHA 4WAUA 3AB3A 4M1OA 4PC6A 3A37A 2R44A 4TYQA 1II0A 2IF0A 3I8SA 1AZSC 2FA9A 2OUKA 3H86A 1X8KA 2VP6A 2IXEA 2NO9A 1M8PA 5ELXA 1Z0DA 2ZROA 1XMSA 4R2IA 5GJVC 1QHIA 2PEZA 4F7WA 4BFSA 3UMSA 3QPWA 2QN6A 1XPOA 3OFNA 1KZGB 2GJSA 4LV5B 1XCPA 1UBEA 2OILA 2J59A 1QDEA 2V1UA 4AWXA 2PX3A 3K8YA 1VG9B 1X8JA 1SZPA 2FSGA 3SQWA 4X8OA 3P27A 2Y8EA 3EG5A 2AXNA 1Z83A 3RS4A 3TIFA 1Q3HA 3FKSA 3V4RA 2XJ9A 1SKQA 1GSIA 1SXJC 1E94E 2P6UA 2AK2A 3LXRA 3B1ZA 4NMMA 3WBJA 1E3MA 2O52A 4R98A 5J40A 2RGCA 3QEOA 4XWKA 1IJEA 4MKGA 2ZM5A 1XPRA 1XMVA 1VKJA 2CLSA 4NPHA 3L8ZA 3RVBA 4ASUD 3WY9A 4DCUA 3HU3A 3T5GA 4NCJA 3BFXA 5EZ5A 1NI3A 3T15A 2QMHA 1UBFA 2O8CA 2ZRPA 4YDHB 2QAJA 3VR6A 3OF5A 4IOLA 3FMPB 3W9YA 4YLGA 1EFCA 4DLXA 1QHNA 2R65A 1JI0A 4RZ3A 1AK2A 1XZPA 1D9XA 3U3JA 1P6XA 2VSOA 5JJLA 2FZLA 4HUQB 2WKRA 3R7WB 4UKDA 1KJZA 3JVVA 5AJWA 2HF8A 2X19A 4LSGA 1G19A 4B73A 4BFVA 1JJVA 4OI0A 3D3QA 4XD7D 2C78A 1J8YF 3CBQA 3MRSA 3NH6A 1K8RA 2CLCX 2JLQA 3I92A 4O25A 1HE1C 1F3OA 3AGQA 5B30A 2JAQA 1CR0A 2ZSAA 1Z6GA 3GCGA 3GJ7A 1NLZA 1BYUA 2GK6A 1UFQA 1M2OB 3QKSA 4I4LA 5DI3A 1S8FA 1YR7A 1DEKA 1FTSA 3ICQB 4PHGA 4ZIRA 3GJ4A 2NPIA 1YQTA 4DC9A 1R0XA 1GITA 3QKRA 4TT3A 1EK0A 3BFVA 4Q4HB 4F92B 3IDQA 1ZBDA 4C30A 4TTQA 4CZ2A 1OYWA 4HAWA 2AK3A 3LAWA 4EFMA 2YOFA 5CM9C 1XCGB 5EUMA 1Q22A 3KQUA 4NYIR 1DO2A 4L9SA 5F2EA 4QGFA 3QBVA 2ZUDA 5E7JA 4I1UA 4A9AA 3SJCA 2Z5FA 3S1AA 3EASA 3QXJA 4WXRA 2IW3A 2XGJA 4I99A 2J9RA 1UKVY 1P61B 4LRWA 4PC2A 5C1BA 3C14C 5EXPA 3RWMB 4BFTA 2DFLA 2O5VA 4QKQA 1QZXA 4RD4A 4JBXA 4AK9A 2YWGA 4BLRA 1N5KA 1O3YA 2P5TB 4YDSA 1TQ6A 1ZCBA 2P6RA 4IXNA 4ZDIA 5EZ6B 3CH4B 3NDBB 5TY0A 4TMZA 2FE4A 4OHVA 4II7A 3G82C 5KYKA 2IC5A 1IY2A 1W4CA 3OEEA 1E9SA 4KLZA 4FI3C 2G1KA 3G0HA 3B2EA 5LB2A 3KKQA 2ZI9A 1W2GA 2ZR7A 1AS3A 5IF9A 3RHFA 3UPUA 2XNDA 3B9PA 3IPXA 2FEMA 2KBFA 1RJ9B 4DCNA 2J0SA 5KSZA 1NSTA 3VTKA 3ZDQA 5FTMA 2PCJA 2ZU6A 3CM0A 3IUYA 4B71A 2WJHA 4KFTA 5K8LA 4CDGA 1NKSA 3SEAA 3THOA 1KK3A 3MAAC 2NO1A 4FD2A 4M8NE 4ACAA 4ZI3A 3AVVA 4IDPA 1ZU4A 4D82A 4ZCIA 1CRPA 2FEOA 5GVSA 1G1MA 2V55B 1R7RA 2RCNA 2ZE5A 4G5GA 3QE0A 1NIJA 4PHHA 3RNLA 3LVRE 4L15A 2XSZA 4ITRC 4KFSA 4KSBA 3E2IA 2IYRA 3Q5DA 4EPXA 1VCNA 2HF9A 2B8WA 2CJWB 2IWHA 1YJ5A 2AN9A 1OFTA 3ZIAD 3GLIB 1QHHB 2GILA 3JVUA 5HPYB 1T5IA 4IXMA 3W34A 4BLSA 2HT1A 1CKEA 2OCYC 4JL5A 3TRFA 1F2TA 1W48A 3K9HA 3IO3A 4GSYA 4HEJA 3U3KA 3W5IA 3W6OA 4BLPA 5JJIA 1EXMA 2ZE7A 2IYYA 3TNFA 2VTKA 2QROA 4OHXA 5KPDA 3BRWD 2CHVA 3NDPA 3C7KA 2WJYA 1Z0JA 4B3BA 3UK6A 2O0KA 2QI9C 2VRWA 1ESNA 4XSHA 3BH0A 5FUXA 1X1SA 2JDID 1V5WA 3OE7D 1EFRA 4HLDA 5DNYB 3EA5A 1UADA 3SR0A 1CJTC 2OZEA 3FMFA 3HJNA 1G5PA 1MH1A 3LY5A 4QHTA 5EXSA 2FPMA 2A78A 4B75A 2FOLA 4IKEA 1J90A 4P31A 3C16C 2A7QA 3AVUA 1UBGA 5DGXA 4JLVA 1KSJA 3TK1A 2XB2A 3SFZA 4MYTA 5CITA 2IS4A 3K09A 2QRNA 5KOYA 1BOFA 1TEVA 3K0SA 1G8HA 2MSCB 3E5HA 2O8EB 1XDBA 3RRZA 4TMTA 3BXZA 1Z47A 4KAXA 1YZUA 4LBVA 3RSOA 4OJQA 2SHKA 1SVLA 2IS2A 1M6NA 4RFVA 2VIIA 2GXAA 5L8VA 2BKUA 1E1RD 2JLUA 1Z28A 1KO1A 4KLNA 1OIXA 3JZMA 3RRYA 2AR7A 3K0CA 4TLEA 1Y63A 2WPDD 2ATVA 3KL4A 3AUXA 4OBEA 4TL9A 3GJ6A 2GETA 3U44B 3Q8XB 1DARA 2GJAA 4PPFA 1YKSA 1Q44A 3NH9A 1OXTA 1ZD9A 5EE9A 1T3LA 2NOAA 2OCAA 4Q1AA 5J5CA 4NH0A 1A2BA 4DKXA 1KAOA 2Q21A 1E9CA 1Z6XA 2REBA 3FHCB 4I81A 2IYTA 3T1TA 2PJRA 3THYA 1HT2E 1NBME 1YR8A 2XB4A 4KSCA 4Q9HA 2Q9CA 521PA 3B1WA 5BN5A 1ZJ6A 4JVSB 2R62A 4BQSA 2OEPA 2IF2A 4W5JA 2CDNA 1FNNA 2GNOA 3UG7A 2CHGA 5KPJA 3V4FA 2CEAA 3VU9A 1R5BA 3THWB 3A58B 4LDJA 4XH9B 4PC7A 4DHEA 2QEQA 2RGNC 2W00A 1E2FA 4MGYR 3AM1A 1R4AA 3SYLA 4Y0AA 1W0JD 2B7BA 5DYIA 5JEDA 3WNBA 1PUIA 5KDDA 1E0JA 2KI5A 1CIPA 3RABA 4MKFA 4MGKR 4Q02A 1KSGA 1G8GA 1KJWA 2ONKA 1EX7A 1II8A 4TMKA 4KYUA 4TT3D 1A7JA 1FFHA 3CRRA 1KI3A 2QP9X 4ZKDA 2YV5A 4X8MA 3DM9B 3LW7A 1P2UA 5FPTA 2P5SA 3NIBA 2YOHA 1ZNZA 2H92A 3FDIA 3ZQ6A 1RC8A 1KI4A 2RHMA 4MITA 5SZJA 1U98A 2WJGA 4TTPA 5FPHA 1QHHA 4ABYA 2WM9B 2X1VA 5JRZA 2BBSA 2FFBA 3R20A 1RKBA 4EJSB 1G7SA 3FKQA 1KGDA 1ZNXA 5FTNA 2ORWA 1KNQA 2XJ4A 4HZIA 4AYWA 3K9LA 4EDHA 1N0WA 2NGRA 1U9IC 4DSTA 3DMDA 4N1AA 1J7KA 4V02A 2LCFA 4X8HA 5CK5A 2BMFA 5DISB 4Q1FA 2JLXA 1M74A 3I3SR 4LJ8A 4TLBA 3KFXA 2IYQA 2H1LA 4P33A 2AWNA 4LHWA 4NYMQ 2YWEA 5H8WA 2BWJA 4B43A 2ZJZA 3VMFA 1T3HA 5DO9A 3AGPA 4IEIA 4JYCA 2YWHA 4DSNA 1DVRA 1N6NA 1VIYA 4KODA 1CLUA 1N3BA 3MWKA 3K0AA 1D2NA 4JLOA 2P0EA 4XTCS 3R9XA 4IHQA 1E98A 4XWOA 1I4LD 1G8YA 2R6GA 2RGGA 4PPQA 1KDTA 2B92A 3BS4A 1XNJA 4A4DA 4ILEA 2QPOA 4Q4JA 4D6PA 8OHMA 4LX0A 2XOKD 1SVKA 1F2UA 3VR2A 4G5QA 3HYTA 4DSUA 3PEYA 2HLDD 3PUZA 4JZKA 2GAOA 3GP8A 3F8TA 4BZQA 3CF6R 1T0JB 3A4NA 4JIMA 4LHXA 3R9IA 3WNDA 4DLUA 2IBMA 1P9NA 3B7GA 4W5HA 2C95A 3K0FA 4OQMA 4QL3A 4C0HA 2O8BB 2WOOA 3L8YA 5H70A 4HUQA 4MUAA 3TW8B 2OFOA 3TE6A 5BN4A 5D3QA 1R0YA 2ZSDA 1T5LA 1TQDA 1XBTA 4KFUA 1ODFA 3W6PA 2IS6A 1WA5A 4RJLA 3NC0C 1F60A 4CIDA 3EPJA 5SZKB 5JS7A 1QHGA 2V6IA 1VG8A 3O47A 3CR8A 2JIZA 5BYJA 2ZAMA 4BEBA 3T1VA 1S4QA 1CR1A 3VX4A 3CR7A 1G41A 3H2YA 1U8AA 3CNNA 4UNQA 3CKLA 1JR3E 2QTVB 4JVLA 3FB4A 1E1QD 2JDIA 4ZDJA 4HB4A 2JCSA 2VPPA 4RZUA 5KNCA 4HAXA 2FSHA 1GRQA 1OH6A 1P9WA 3MWYW 1E4YA 2EQBA 2F3RA 3SNHA 1ZCAA 1DTSA 1FX0A 1RRGA 2LWIA 2ZS9A 2YYZA 5AJZA 1IONA 1KMHA 1H8HD 2P6NA 3VR4A 2IXGA 4KYIB 1II9A 3X1DA 1Q3TA 2F1JA 4HZUB 2JASA 4L8GA 3HR7A 3BE4A 4CT4B 3DDCA 4B3GA 4Y0VA 2XOKA 1EFHA 5GJCA 4TLCA 2BMDA 4EQ6A 2GXUA 4RZ2A 1GM5A 1NN5A 1M34E 2EYUA 1N2CE 2BEKA 4MKHA 3BJIC 1G5RA 1VG1A 3PIRA 1MO6A 1NLFA 2X8AA 4L16A 4UQOA 4W9MC 1FMLA 4XOIA 4TWZA 4M21A 1BKDR 1UDWA 2O8FA 3C8UA 1KTVA 1U8ZA 5FTJA 4HB2A 1MR3F 1ZU5A 2N1BA 2H57A 5AK0A 2JJ8A 2ZRBA 3EWSA 4A36A 3QIAA 3NBZC 4IJMA 4RKFA 2QTHA 2PLRA 5F3WB 5L3QA 5FUWA 3A36A 1B23P 2ZR9A 2A5FA 2RGXA 3LQRA 5AR1A 2ASEA 3EIQA 1XTRA 2FX3A 1Q57A 4BASA 1LS6A 1Z08A 2HXSA 3REGA 4PFSA 2JIZD 4DSOA 5IRCD 5FBLB 1NNEA 2W0SA 2DB3A 3ZVLA 4BE7B 1OXVA 3EZ7A 4OI2A 4LC1A 2H7VA 3RAPR 3W90A 4UNRA 3U3MA 3UANA 4IVPA 3GLGA 1JPJA 1KKLA 4JLDA 3RANA 2C9YA 1GL9B 3NBFA 4XVQA 4PPNA 1CTQA 1I2MA 2N42A 1GKUB 4M9ZA 3RRNA 2G88A 3IO5A 4WBSA 3GLFE 4CF7A 2C77A 4PSVA 1Z0FA 4OK3A 5G41A 2UZ3A 3FE2A 4URUR 3F3YA 1G7TA 1W4RA 5C46F 2Z0MA 5FL7D 2ZYWX 3DEFA 2FH5B 4H9GA 4YMSA 1O87A 1Q1ZA 2ODNA 2PH1A 1TTTA 4B2IA 1JBKA 1JEDA 1S2MA 4R7ZA 3IEVA 1KK0A 3EIEA 1E2KA 2RB4A 4UJ5A 3N2EA 3NKVA 4HLCA 3QKSB 4LY6A 1GOTA 1RFLA 1A5TA 2J87A 3KX2A 2BDTA 2PCLA 3UMRA 1IXSB 3HU1A 1FUKA 2VHCA 3AF1A 3FTQA 1FL9A 1E2QA 2BOVA 2OXRA 2W6JD 3T06B 3WYFA 3CWZA 2WICA 5FI1B 2AXPA 2F55A 1TU3A 2AL7A 3QENA 4M1TA 2D06A 1ZNWA 3C5CA 4TL7A 4Q7JB 3TVDA 3THXA 4JKYA 1KK1A 5BWMA 4A6XA 4Q4AB 3A1VA 5FPSA 2KB0A 1ZAKA 3EZ2A 4NBSA 1HUQA 3AF3A 1XTQA 2AKAB 3WHLA 1E1QA 1N0UA 2ZI6A 3NWJA 1W0KD 2ORIA 4CEJB 2WAXA 3LQQA 2HV8A 3X1XA 2O8CB 1FZQA 2GCPA 3WYAA 3GFPA 5SZHB 3QXXA 1KY3A 5FOWA 3VNUA 1Z63A 2WWFA 4LJ6A 1XTJA 1XTSA 3K0AB 1LW7A 5LPNA 2GAAA 5L3SB 2J0UB 3LA6A 1LF5A 4YQFA 2G9NA 1LB1B 1TQ4A 5D3MB 1Z6TA 4EFNA 3HP1A 4B48A 1PJRA 3A1WA 3BD9A 4ERNA 2RGDA 2DPXA 2YINC 1JAIA 3P32A 4Q9JA 2OBNA 3GLFB 2JLSA 4KJZA 4PZZA 1DE0A 1D9ZA 1HA3A 2F3TA 4A15A 4TMWA 3VKHA 1D8TA 1SVMA 2A9KA 4PQRA 4G5RA 2ZI5A 4IDOA 1A2KC 2ODWA 4JLAA 2ZJAA 5DN6D 4DIEA 4G01B 3EW9A 4AY2A 1JR6A 1R5OA 2ZSFA 1U2RA 4JS0A 3QSYA 1C9KA 1XJ0A 1WCV1 1GVNB 3B1YA 3QG5A 2WIAA 2QT0A 3TLXA 2QENA 3CH5A 3TAUA 2ERXA 4E07A 4C7OA 1DADA 3KB2A 3PCRB 2GWHA 2GKSA 1RVDA 3IIMA 4WIAA 1NF3A 2QG6A 2QE7A 3X1YA 3ZVMA 4LJ5A 3WYGA 4MYHA 4Q01A 3I62A 5TVKA 3CPEA 3CX6A 4ZIRB 2JATA 4Q5IA 1TEXA 4CW7A 5J4KA 4OI1A 1E2PA 3TSZA 4EPWA 3AF0A 4KBFA 2R6AA 3QKTA 2ZVQX 1YZNA 3A8TA 3HR8A 4OL0A 1G9XA 4P4UA 5FI0B 2EFGA 4KO8A 3FFAA 3TAHA 5B64A 2OHFA 3MLEA 1XF9A 4TQAA 1N5IA 3PQCA 3PJRA 1NIPA 2FG5A 4PC3A 1W5SA 2PLFA 2W6ID 2CE2X 5FPYA 4Q7KA 2FZ4A 4NYJQ 1OXXK 2QP4A 1DS6A 5C4MA 2C8VA 4Q4AA 5E95A 3H4MA 3DKVA 2CCGA 5JECA 1ZM3A 3T61A 4C3ZA 4JBYA 2ONJA 3TGPA 5JWRA 5BXQC 4ARZB 5BYKA 1XMJA 1LNZA 5KSYA 1IM2A 4ZO4A 5EQTA 3L0OA 4HB0A 3RC3A 3EWAA 5JS8A 3FYHA 3AVXA 1W36C 1W5TA 1ZRHA 2DCUA 3QUSA 4LWZA 4M1KA 3SI7A 1JALA 4HB3A 4B76A 1W36B 3DPUA 2KBEA 4Q9KA 2VHTA 1CR4A 1MO4A 1JXMA 3KJEA 1GRNA 2W2VA 4CVNA 4P4SB 4A6PA 5HKKA 4LOAA 1DOAA 4BRUA 1G6OA 1T8TA 3LBNA 2CVFA 1H8EA 3AUYA 1W7AA 2D7DA 1N6KA 2OG2A 1NN1A 1Z0IA 2FWRA 2GCOB 2KWIA 1QHXA 4EPVA 4KFRA 1GAJA 4OK6A 4OK5A 2DFKB 3GLHE 3M0EA 1N6PA 2OFWA 3LO5A 4MYCA 5LD2B 1DAIA 3B85A 5JI2E 2ORVA 1E79A 2FFAA 2R6DA 1AGRA 1OKKA 2DHRA 3QVUA 2ZRLA 4PANA 1WXQA 5JLJA 2VHQA 2BBOA 3WXMA 3LBHA 3V00A 1L4UA 4LYFA 4B6EA 4JJKA 4FCWA 2QPAA 3A1UA 2G6BA 2F1HA 1D2EA 4ESHA 5K8IA 3PENA 1RIFA 1KI1A 3IKJA 3VR3A 1F5NA 3SQXA 1EG7A 2UZIR 3SHWA 3C4JA 4RFSA 1E0AA 5A4JA 1XXHA 2EFDB 4NHOA 3U3RA 2WWIA 4BECA 2HCBA 4PHTA 2WHXA 3QEJA 4O0MA 4WZ6A 3I73A 4LV6A 4JLKA 2EFEB 1N0VC 3NXSA 1NY6A 3PUWA 4DCTA 1VDZA 2GEUA 5JEEA 2PZGA 1PZNA 1GZSA 5GVRA 1XD2B 3CZQA 1RRCA 1KNXA 1VCMA 4FW9A 4D25A 1IJFA 2MMGA 4DEYA 2RH5A 2NO6A 821PA 2BIFA 3NHAA 1MABB 5FBVB 2FFQA 3RS2A 4A0RA 1H8HA 2NO0A 1HE8B 1T8UA 2ZU0C 4DT1B 1SXJE 5LB4A 4EFLA 1UKEA 1KJYA 2IX3A 2QMOA 2L0XA 3B9QA 1XB2A 3B8HA 4KXFB 4MRRA 4BRWA 2WPDA 3TUIC 4ZV4A 4V0LA 3QXHA 5C4GB 2CL6X 2REOA 4GT1A 3K1JA 3R8FA 1AJEA 3FPAA 1WRBA 1XXHB 4G1UC 2GF9A 2CL0X 4A2PA 1PVOA 1TADA 4CYMA 2G77B 2OO7A 3L0IB 3AKYA 2WJVA 4AD8A 4QNRA 2DR3A 4R9UC 4G3XA 3EX7C 3LNCA 2GDJA 3VFDA 1KK2A 4F93B 1YHNA 3KUCA 4UNNA 2NO7A 4C0BA 3D7MA 3D8BA 1OHHD 2X2EA 3VKWA 1XD2A 3NVAA 4W5WA 2J7KA 1RE0A 4DLYA 4MDEA 4V0NA 3RC8A 4UXHA 1KI7A 4LC0A 3HYRA 2B7CA 1IBRA 2D4HA 4DLRA 2OLJA 5AJVB 4GRAA 1GDDA 1BH2A 5FTKA 5JCZA 4BZXA 2C03A 2XXAA 2ZE6A 2P67A 3GLHA 3IGFA 1OH5A 2O8BA 4AURA 2NTYC 2N46A 1QVAA 4A8JA 1NMYA 5CIWA 1GILA 4H1UA 4TLDA 4DDUA 1G3MA 1Q0UA 2GJ8A 2GTPA 4ACBA 3SZRA 2IHYA 3IEUA 5DHFA 5EXXA 1VHLA 2YVUA 3PR1A 4US0R 4J0QA 1HH4A 4WZBE 2QP3A 3SN6A 5AWFC 3AF4A 3D31A 1YZGA 1MO3A 1L8QA 3EZFA 5DN6A 1S9HA 4AKHA 1P60A 2WV9A 4LYHA 3J81k 3B78A 2NG1A 2GXQA 3O8DA 1XEXA 5KO2A 4JL6A 4QJ3A 4PZYA 2WIBA 2G83A 4IDQA 3GJ8A 221PA 3M4YA 3U4QB 3KDSE 2BHRA 1UEIA 4PR0A 2XTNA 2ZR0A 1T3SA 2VEDA 4QFMA 3TVTA 2QM7A 3X1WA 5JZVA 1OT3A 1QG4A 4AC9A 5FUYA 1N25A 2GXSA 2ZRMA 2BBWA 3TKLA 1Z5ZA 4LYJA 2J45A 4M9SA 3UATA 2C96A 1IXZA 1M7HA 2FFHA 1IQPA 3O8RA 1QBKC 1OIWA 4JBWA 3VQTA 3GQBA 4DCVA 3DL0A 4V0OA 3HPQA 3KKNA 3AVTA 1OJLA 4N0DA 4TQ9A 2ZJ8A 3FKSD 4HLUC 5J4YA 2FPKA 1U0JA 4AI6A 3ZJYA 1XEWY 3RRMA 1S96A 1XU4A 4JT4A 4QBIA 5JHHB 1KO8A 2C98A 2IUTA 4A8JB 1T91A 2H17A 3ADKA 1NSFA 1T9HA 5B58C 3TUZC 3FVQA 3VR1A 3Q7QA 3GLHB 5EE3A 3RSLA 1R2QA 5AJXA 1P2VA 3T12A 1IN5A 3S1AB 4A0HA 1GUAA 3MWLA 4MUBA 4IDHA 1US8A 2OBMA 3GJXC 3B1XA 3DM5A 4HAVA 3SBEA 5G53C 4JLJA 3KKPA 2LKCA 5J4LA 2Z43A 2QSYA 3U44A 2PEYA 2GF0A 1MO5A 1VYVA 3BBPA 4EJSC 1SQ5A 5CIQA 2IYVA 5EP3A 2V54A 1GL6A 2O0HA 4GDFA 1G18A 1SVIA 4Q4HA 4YMVA 4TZ6A 2AFHE 3UWKA 2AHOA 4RVCA 3PUVA 4V0ME 3DHWC 1Z2CA 4RZXA 5FBRB 1TX4B 2VBCA 2XZPA 621PA 2GBLC 1P4SA 3Q9LA 1GTVA 4GI7A 4KI0A 1S9DA 1SULA 4UNSA 1IOZA 3KKMA 1FW6A 1NN3A 4WZAE 2ZJ2A 5JMTA 3B5JA 1R0WA 4NKRA 1OXSC 2ZRHA 1E2NA 1ZD1A 2ZRKA 1UBCA 1C4OA 4P32A 2F43B 4ASUA 3IPYA 2QSZA 3DKPA 2C9CA 3GD7A 2ZE8A 2YWFA 3O8CA 3PUYA 2V9PA 3QPUA 1Z3IX 4TL6A 1MT0A 4A0FA 5HZHA 4KU4A 2D3WA 1UAAA 3BK7A 1E96A 4Q9IA 2A5DA 1LTQA 1CXZA 5SZIA 4JMPA 4D26A 2HJGA 3QKRB 3ADCA 1UDXA 2QGZA 3NG1A 4URWR 1UJ2A 4B3DA 1U0HC 1S1MA 3C5HA 1EWQA 3FMOB 3U2QA 4RSGA 1NVVR 1F48A 2CHQA 1IN6A 2ZVPX 4LI0A 1D6JA 4A82A 1U94A 2FGJA 2PMDA 2VQSA 3QF7A 3W3ZB 1P62B 2HT6A 1G5TA 1OSNA 2ODBA 2WAYA 2YC4C 4GPTA 2QMUA 1ZW6A 1E2MA 4Q21A 3A4MA 2ZQ5A 3MD0A 4LPKA 4D4LA 1JR3D 1TF7A 1ZINA 2Q3HA 4TYYA 4HZUA 2DFTA 2IT1A 2OT3B 2XITA 3GJ0A 1OF1A 5F98A 2MMCA 3ICEA 3KFVA 1F6BA 2GZHA 4Q7LA 3QVVA 1W4AA 4BWYA 3ADBA 4I1VA 1NJFA 4IVQA 4Q00A 3TR0A 4GMXA 1NN0A 5FFMA 3QKUA 4GMDA 1XEWX 4IEEA 2EFHB 2ZI4A 1KDRA 1IN8A 2AD5A 1UPTA 2WMOB 1HQCA 1X6VA 1OXUA 3H0KA 4N3NA 3U60B 3KQLA 3K09C 2C2HA 2VF7A 3ZQJA 3H1TA 3LW8A 3WP1B 2IA5A 2NMVA 5E3HA 1R5NA 1ZUNB 2RGEA 1DAKA 4NCHA 1ONBA 2ZANA 5EP2A 3CLVA 4XTRA 1EX6A 1G6HA 2LKDA 4F4JA 2YNMA 3CPJB 5FL7A 2ZIAA 4XJXA 1HYQA 2D62A 5CYPA 3IIKA 4JLBA 1XZQA 2VP2A 4Q03A 4URVR 4OQLA 3B13B 2GBLA 5FL3A 4AKGA 5GJBA 3THXB 3CZPA 1ELOA 3FFBA 4D0NA 4DVGA 5DLQC 5EE0A 5EP4A 4M53A 2ZYUX 2NZ8A 3B1VA 2J7PA 1XEFA 4LHZA 2B21A 1EFTA 2BJVA 4BLQA 4XSGA 1OFHA 5ANRB 4BLTA 4DLZA 3RYTC 1Q1EA 1E2HA 3OEED 4FCTA 1OH7A 1TQ2A 3GEIA 2NZJA 5FOXA 2QU8A 1JNYA 2OSBA 1MRNA 1YRBA 1PLLA 4FMDB 4FN5A 1R0ZA 4EIWA 2GK7A 1LF0A 3LDAA 5D3MA 1ZM4A 2Z6VA 1CU1A 2QUZA 3BOSA 3CF0A 1S0UA 1OLOA 1L2TA 3I8XA 3PEVA 2Z4RA 4LZZA 3F5FA 1SHKA 4DDTA 4A8JC 2CLDX 3TR5A 1KI6B 4C4PA 1KO5A 4NDZA 4Q1DA 1AKEA 1KDPA 1VYTA 5CLQA 2V4ZA 3FMIA 1Z8FA 2O8FB 3Q7PA 2ZRDA 3UXMA 1FQJA 5HR5A 4JLNA 2V7QD 2I1VB 3AVYA 1NG1A 2IYWA 1WE2A 1YZQA 4PSKA 4KITB 721PA 4HAZA 1X3SA 4AYXA 3AP1A 3LLUA 4LJAA 3ZIAA 2PBRA 2ZEJA 2QBYB 3GLIE 5F9FA 2PL3A 2BVNA 4QBFA 5HTKA 5AUOB 1XMIA 5CB8A 2YJTD 4ESVA 4OYHA 1KDOA 1NY5A 4FIDA 4L4UA 3HPRA 4DWJA 1N6IA 3PEWA 2ZI7A 1DAHA 4IOJA 4QGHA 3B6EA 3A1SA 5CJPA 4DLSA 4QHSA 1IN4A 4L9WA 1CP2A 1XRJA 2NIPA 3BH7A 3P4XA 2VYFA 3W8NA 1HV8A 4N0EA 1A4RA 3LH5A 2AKYA 1G3RA 3G5UA 4DT1A 2FPLA 4M22A 4NTZA 3K9GA 3U7GA 5JWOA 3RDPA 4PO1A 5EE1A 4DDWA 1YVDA 3GEHA 3VNVA 2ECKA 3T35A 1Z07A 2XTZA 4OHZA 2OE2A 2CVHA 2I4IA 4ZPXA 1DAFA 2F9MA 1TL7C 5J47A 1CJVC 1YR6A 4FMCF 2WWXA 4DLWA 4LYAA 5C2JB 3ZZUA 1NJGA 2HYIC 1SXJA 2NQ2C 2WWWA 4JSYA 1GP2A 1SKYE 3BB4A 5DHAA 4HDOB 5EJEA 3ZVRA 1SVOA 1E9FA 2IYUA 1ZVQA 4HYYA 1N6HA 1SKYB 3BFKA 3ND9A 1KO4A 4LHYA 1Q12A 1W46A 2FJUA 3WMEA 3SDZA 3T1QA 2XZLA 1JXOA 3BAFA 4QG7A 1E9EA 1G3QA 2UVQA 1F2UB 1ZNYA 1W2HA 4GZLA 4C2TA 5IHPA 2VLIA 3U6KA 3RS5A 4EJSA 2J0QA 2EYQA 1D2MA 1OHHA 2EU8A 3V9PA 1K5DA 5JFGA 1PLJA 1BMFD 4RD3A 1OKKD 3ADDA 3LLMA 3Q72A 4LGMA 1KSHA 1XWIA 1AIPA 3QQ5A 2QORA 2IK8A 4BZPA 2XSZD 3RWOA 1NL3A 1N5JA 2DYKA 5CM8B 4O2RA 1XPUA 3OAAD 1FUUA 4NCKA 1Z6AA 4PPGA 1P73A 4JSTA 4ZI2A 5G40A 4LJ4A 4LK2A 3CX7A 3CRVA 3K0FB 1RW4A 4HAUA 5HKKD 1ZMXA 1WBBA 3BB3A 1P72A 3ZZ0A 2A2ZA 1IXRC 4OQFA 5EUQB 5CK4A 2O8EA 2J46A 1J70A 2H8KA 2CCJA 1P9RA 2YHSA 4JT2A 3HU2A 4S2EA 2ZJOA 5FOUA 2XX3A 3Q3JB 5G3YA 4C0KA 2RMKA 5DH9A 1R8QA 4IOMA 1ZP6A 3KTAB 5GADl 4CEHA 2A3RA 5EXTA 2WOJA 4W7SA 2XZOA 1ANKA 1PLKA 3WHKA 3PEUA
chains in the Genus database with same CATH superfamily
4P5PA 4HWPA 4MGIR 2BCJQ 1SQFA 2IGBA 4LBZA 1OIVA 1SO8A 1IN1A 2QTVA 1KY2A 1BCRB 1II8B 2QRMA 4RS4A 5FTLA 1RR6A 1Z5NA 2CNWA 2VDWB 1BQ3A 1GTRA 4RCZA 1G16A 2RK6A 4P0TA 1J23A 3RS3A 1RHMA 1GTZA 1SHUX 3PHGA 1C9JA 1KYQA 1TAHA 3IDFA 2ADFA 4HGYA 2NO4A 3U3OA 5AHXA 3ZYCA 1ACLA 3ZHVA 3LFTA 3R5TA 2GFHA 3LFHA 3TQHA 1YFLA 1M34A 1U3UA 4HLQB 4YJHA 4B32A 4QJ5A 4TXJA 2NQTA 1H6DA 2R4QA 2PMKA 2ZDGA 5A5GA 1PL0A 3ILYA 4FHDA 4KZPA 4NFHA 2C2BA 4XM1A 1NC1A 4XUGB 4Y0NA 2I2FA 3LQ4A 4PCAA 1V3QE 1Q7EA 3NEAA 4JLMA 1WP9A 1Z4QA 3EHEA 3IQZA 3NHFA 4K9MA 3UAOA 2PGJA 4JI4B 1K4MA 4MR9B 4TVSA 2GSDA 1XD9A 3ENVA 4HDMA 3R8CA 1U28C 4C0SA 1BHJA 3PE6A 1GPAA 5C8YB 1INLA 1NKVA 5BY2A 5AVTA 2YJGA 3CTPA 4HWOA 4TRRA 1TF5A 2PGDA 5I4IA 4S12A 1XHFA 1UBJS 4D3YA 2HMUA 4HWSA 1FFDA 1X74A 1ZLXA 2XLCA 2XUDA 4XYGA 5LDGA 2WYHA 3DQPA 3IX7A 4COKA 2ZIXB 4K9OA 1DBQA 3L7AA 2EFJA 4D9NA 3ZBPA 4F38A 1E5XA 3AY0A 3G13A 2BFOA 4RD2A 4DCVA 1MX9A 4QWWA 5CA1F 4I1SA 5KHOC 3CO5A 3KSZO 2LCIA 1L5FA 3ZGXA 2FWAA 2COUA 3PHJA 4YRDA 5I6DA 5KTRA 1JHUA 4RE5A 4ZCLA 3UQZA 3FOZA 4K46A 4X0EA 5AUPB 2VAPA 4R8RA 1KO7A 5I8PA 3VNAA 2GS9A 4O4LB 3JAKB 4DCMA 5KYGA 2XCTB 3L7OA 3K70C 5DM4A 2VDLB 2XW6A 3V7FA 3WIEA 3UEOA 1VYUA 3L8HA 3HRKA 2EX4A 4M86A 3VNQA 2XDWA 3SEFA 4F8EA 3OQHA 4WY5A 5DBOA 2W2TA 3DMTA 1K6MA 4JLPA 4OATA 1C3XA 3G68A 3PI7A 2A94A 4MROA 4W8HA 3L2OB 3OLXA 3TD2A 1WQ3A 1Z62A 2BFFA 1AQLA 2H48A 3F0TA 3KS9A 4FOOA 1ISMA 4UVIA 3HA3A 5JD3A 5TXGA 1HOTA 3NOOA 2AUNA 3SBOA 5KTNA 1IH8A 5IM5A 2CFIA 3EJWA 5LUAA 3C87A 4MVJD 4YJKA 4UM9D 4ZRDA 5LZ2A 4RHEA 4WGGA 1V9LA 1X7HA 6PFKA 4F04A 3G23A 1A5AB 3IOYA 3QELA 1XTIA 2FNAA 4I08A 4NV1A 3HRIA 4RH0A 3HGMA 1R6TA 5J4VA 2AQ8A 1Z0SA 1W35A 1R3UA 3KSBC 3H11A 2DETA 2C9OA 4QYIB 3U09A 2Q2OA 3I23A 4NOLA 1MGOA 3NHYA 5KYVA 1K08A 1QZZA 1VLZA 3DBRA 1GQSA 1QKKA 1U81A 2ZXFA 5BR1A 4WJZA 1RP7A 3EG9B 2Y68A 3DT9A 4QRHA 3A9RA 1CF9A 2GVDC 3SLKA 1JQJC 4HTFA 3RFTA 3SPXA 4EELA 1T4CB 2FLVA 2W70A 4O4HF 1EP3B 4RTPA 5CBPB 4CMEC 4X97A 1MOPA 3M6LA 3ESAA 5IKOA 1IN7A 3AWDA 3MTBA 3MWDA 1UWCA 3LUJA 4WESB 5EHNA 2P9HA 4EMTA 3OQ1A 2HMYB 2BF7A 4RFSB 5IT0A 3R9KA 3WQSB 2GZDA 3QPVA 2JFZA 5HE8A 4X8LA 4DLSA 3KTAA 4UEOA 1T8PA 1XTUA 4KRGA 4F60A 1UWLA 1IHOA 2DUMA 2JIOA 3KUXA 3Q0TA 4BRZA 4Z1MD 1CS4C 2Y6VA 2CJWA 2A9QA 3LQYA 3EPKA 4H1VA 3H7IA 3JXEA 3P0RA 1R00A 3BX1A 4K9DA 5DWVA 5E7QA 4ZKEA 3UMFA 1YRQA 4A0QA 1UEXC 3RU3A 3ITNA 1PV4A 1E1YA 1TJ3A 1E6LA 2GK3A 1GWNA 1P9LA 3G9UA 3R5HA 3A14A 2ZJ6A 4HS9A 3T4UA 1DWUA 4F7DA 3OO0A 3NIDB 4YMLA 1GIAA 1UJBA 4W6QA 1NNLA 1SC4A 1L5RA 1UKYA 2ANCA 4JFRA 2ZSUA 1IVYA 4NI5A 2OYCA 3TLMA 4IMJB 3F3KA 3E03A 2HLDA 3WZLA 2J5XA 5BWCA 2JEOA 1GGJA 3BXEA 3KB1A 4P58A 4B9EA 4MJXA 3SZMA 3WB2A 1AGPA 2PKQO 3C7AA 4YLEA 3WGLA 1CY7A 4AJNA 4F4FA 4EVQA 3X2SA 1NVWQ 1UPUA 2ONYA 3TTVA 5E1BA 1ZGHA 2J48A 4K6FA 1M1YE 4K9LA 5CW2A 2N3ZA 1A77A 1A69A 1K1EA 5JS6A 3MYYA 3EZ6A 2GYWA 1B6GA 2LBPA 3CNLA 3JQFA 1POWA 4QOSA 2X2PA 1AKVA 4Q6BA 2FY8A 3UHFA 3HN7A 2ILTA 4G0NA 1ESMA 1YZLA 1YVEI 4HNSA 4OLFA 4CM9A 2JLWA 5K1ZA 3K2IA 2PSHA 5B3AA 4BB0A 2PVCA 3QUBA 1CCWA 2WJJA 4KRXA 1G8MA 3V5NA 1R0KA 2ZAGA 4HADA 4B3XA 5FBWB 5JXWA 3WGVA 2A0KA 4G0PA 4R6XA 1KEZA 1MJNA 4ENWA 3DMFA 4DANA 5TMPA 3I9OA 4TZ0A 4IDCA 2QZPA 4EQ6B 4ZQEA 2YASA 1BJRE 1V8DA 4TQUS 3ZVKA 3O94A 4P7KA 5KKNB 1Q16A 2P40A 4I1RA 3OIYA 1U90A 3SG0A 3G6WA 1ONNA 5ARCA 3W5BA 1K7YA 1RS0A 3CLKA 4J6EA 1OPRA 4RBNA 3RF7A 3GP3A 1DU4A 1XAIA 2F59A 4CDMA 1EA7A 3DL4A 3OPXA 4NEHB 5BP7A 3E18A 5ECDA 1FBNA 1VBMA 2GPYA 2HD4A 4C0AC 1DSSG 1CR2A 1HDGO 3VHXA 2ISSD 1QV6A 1VRCA 3SC4A 3UY4A 2RJOA 4UTRA 3DMNA 3MWJA 3NR2A 4J9UE 1JDZA 4YAWA 3F7OA 1P4JA 4D0LB 1XQXA 1Z7GA 1N5DA 5DFAA 4Q18A 3PDWA 3OWOA 2DFDA 5D5QA 1XNHA 4FFNA 1QTRA 1XLVA 3WR5A 2FTKE 2V5AA 1J6UA 2ZRIA 4Q19A 2O2CA 3JD4A 2ZTSA 3KCQA 1EZZA 1U9IA 1XJQA 3ANMA 3CW2A 4MVWA 1N8SA 1WXDA 3ONWA 3U4CA 4WZBB 3SMVA 1NA5A 1W36D 1AG9A 1NMZA 2DTDA 4CCAA 4EI7A 4Q1CA 4UCWA 3MLBA 2PMWB 5JSKA 1VSVA 4WH0A 5HA5A 5B53A 4F9FA 4PAMA 2V59A 2BN4A 3IERA 1PWZA 5D1NA 2YYYA 1E2EA 2WJPA 2RAPA 3DNPA 4AG5A 4POAA 2Z5VA 4LXYA 2OHOA 2G4CA 3TQTA 1JFRA 3C6QA 2CCKA 3GFFA 4EPYA 2ADOA 4FQ5A 5EJ2A 1N0HA 5A5FA 5BO5A 3RUFA 1EVEA 4NOMA 3GJ3A 2R1TB 1WMSA 4PLVA 3SKXA 3QVKA 2VKTA 3DVRX 5ITWA 1BCSA 5KC8A 5AKHA 4X65B 4MKIA 1LVGA 4NG4A 4WTOA 1RKUA 3IR6A 1FSPA 5GOZA 3KBOA 1D5WA 1C30B 4WCFB 4D8VA 1FDRA 5I5GA 1RM0A 1GPLA 3DO6A 3ZU2A 2HW8A 2RHOA 3LL4A 1R4MB 5FUVA 4CHTA 4DY6A 4R54A 3HB9A 3BJMA 1QO0A 3D6UA 4GUDA 1G20B 1VKOA 4TKUA 1W1WA 2J6BA 1L7QA 2H4HA 5ICGA 3U16A 1M5RA 3FWYA 1Y4AE 4WUTA 4NYMR 1H94A 1R10A 4YO8A 1VHWA 2LIVA 1YK0A 1B3BA 2PYDA 3MOIA 3OEWA 4I36A 4L95C 4DLLA 3UNXA 4ER5A 4BX2A 4UTXA 1US8B 3HCDA 5AVZA 1YD7A 1GDHA 2FN7A 1EB9A 3FDJA 5F2KA 1L7VC 2Q5HA 4YMWA 4E5UA 2WMNB 3D2BA 3I0MA 5IDWA 1AT1A 4C03A 4JHLA 3A4IA 3MT8A 2Q5IA 4OQXA 4XX0B 1ISHA 5A4DA 2X0NA 3FOFC 1SBCA 1KJJA 2R8EA 4DLKA 2WSMA 4LNUA 1HE4A 3E9ZA 4J3FA 1RHUA 1HT0A 4DXHA 1Y3IA 2ET6A 3MFQA 2HXYA 2F43A 3W4KA 4BNNA 4MRVA 1HG0A 3JZAA 3NHBA 4KUGA 4GNKA 3VPXA 3B7WA 2W42A 4UTOA 3G7SA 1GT6A 2BELA 4YRMA 3L9WA 4XB2A 4P3PA 1YFKA 4DM7A 4X44A 5LP6F 2VJNA 1JILA 1EWRA 2O2JA 4FFDA 4E03A 2FXIA 1OBHA 3WGKA 2ZBRA 3ZVNA 3F90A 4GQBA 2RBEA 4ZT2A 2FMXA 2NUPB 4UJ3A 1W29A 3OZBA 2PGAA 1KIFA 1T36B 2NADA 2VHYA 5JNSA 1YJAA 4N5IX 3HB4X 2YW9A 1KP9A 2QRLA 2A5YB 2XTMA 4D57A 3VMMA 4V0KA 2Q3FA 3D3EA 2IIVA 1NM5A 1OROA 1SHTX 3OZAA 1YVPA 5BSMA 1XRPA 2BZSA 3NEJA 1KJQA 4KPUB 2I8AA 3H0EA 4R3WA 1GZ3A 1KZ4A 4RETA 4D4JA 4YJ2A 3KEMA 2BP7B 4WADA 5DM0A 4JAVC 2IJGX 4PS1A 4YMTA 2UVPB 2Q2NA 1U8YA 1K86A 4KIUA 3IAAA 5EP1A 1VXRA 3KVYA 3WG9A 4LA4A 1SKAA 3L43A 5IVIA 4MQBA 4RGVA 3VSEA 3W8RA 4JB8A 3UG6A 4EYGA 2CDCA 3A9UA 3F71A 3T5DA 2Q0XA 2QJFA 1M6YA 5JMWA 4DV6B 4XDYA 1JEQA 2HFJA 4U6QA 1RRPA 4OXQA 2YRXA 1I2AA 2XA2A 1MNAA 1EIZA 1MX5A 2ZUSA 1SEVA 4YCJA 5A4IS 2WF5A 3QXCA 1OB2A 1O9BA 4D8UA 1TUIA 2WIGA 3U7EB 1BYIA 1E3LA 1E1RA 4AMUA 3K9NA 4KQ6A 4QGBA 4EO9A 4F9TA 3MMZA 2FE1A 3OU7A 2GEDA 3ACCA 2OYRA 1JEEA 2CNDA 5EIHA 2QHXA 5GGXA 3PV0A 4AZWA 2VL7A 1A8UA 5JXHA 2AN5A 1P81A 1Y8CA 1SG0A 4DJFC 2ZIEA 1WKCA 1X1EA 4OP2A 2XD4A 3R7LA 4UDNA 1DLIA 1EJBA 3AFMA 2VP3A 4DPLA 2FWIA 2HJSA 5AW2A 1BW9A 4BGDA 1ZL0A 1ZS9A 1QOZA 2HWYA 3GUUA 5CDFA 4EG0A 1NI4A 3LPDA 1H1LA 1OB5A 5J2TF 4XYBA 4ZTZB 1EQUA 3ZDYB 2I2WA 3AEKA 5T3UA 1MQSA 3I9JA 2DHEA 3LX8A 5K01A 1RMYA 2XQVA 3FM9A 5IAAA 10MHA 4JMLA 5HDBB 1FK8A 1T6NA 3ZDXB 1QRUA 4ZK2A 1ZO8A 1SCDA 4OXKA 2EFCB 2BMEA 3QU9A 4ZMBA 5ES3A 4N9WA 1KQFA 1GL7A 3NVDA 3VU9B 4W5TA 1CDDA 4OO3A 1I10A 1XHEA 5CGQB 3T3DA 3NDRA 2WTBA 3X1ZA 1PGJA 1PGOA 4Q7MB 1B74A 1N7IA 3R1IA 1CZUA 4UARA 4RD1A 4XLZA 3VR5A 5LVAA 5I7EA 1BXRB 1K6EA 2B5OA 3N0XA 3OFND 5H1YA 5SYMA 5TRTA 1MOQA 4P3OA 4KIGA 3OESA 3NBXX 1OFUX 3E70C 3PRHA 5H68A 2RGBA 5SICE 1I7DA 2FMTA 4N3BA 5TE9A 4BCDA 1C1HA 4RIEA 1N7GA 5KQLA 4ES6A 3WQRA 4PWZA 1RZUA 3WV5A 3OT1B 4MIYA 3GOHA 2OLKA 3CLUD 4IPTA 3OIUA 3ROGA 2FF7A 1NR7A 3WJ7A 2ZJ5A 4PHFA 1Y6ZA 4MRNA 4U2BA 2J4FA 2EP8A 4HDQB 5A3QA 5M04A 1JV2B 3VNSA 1XRMA 3X44A 1TUBA 4M49A 4HMOA 2WJ3A 4Z0TA 3ZLVA 4AZSA 1Y81A 4B8ZA 3AM3A 3P71T 1K97A 2J1LA 5DRTA 4C08A 1M7GA 3RAFC 2QZJA 1YZFA 1M10A 1WCXA 3LT1A 4W9NA 1GHTA 3WLRA 4MWEA 4NK5A 4ENQA 3IVAA 1P5ZB 2Z1MA 4A6DA 4CRWB 4BFUA 2BZ1A 3QPAA 2WFLA 3DTVB 4DCOA 3CE6A 1QHFA 1K8YB 1G4UR 2R8YA 3H11B 4BZZA 3FFTA 2H7CA 3FYDA 5HCNA 4WHMA 4CNQA 5B57C 4K7JA 5MN4A 4RM2A 1CUCA 5FQOA 3VR0A 4G24A 2V5UA 2YQ4A 4ZRNA 4Q4JB 4TLAA 1JAXA 4XVUA 3RARA 4GRDA 3CLUC 3EPRA 2CBZA 2PZEA 3ASYA 4MVCA 3ZXXA 1IMJA 4BVJA 4ZTUB 2L42A 3FX2A 3CEJA 2BTEA 3MCAA 2PTGA 1SPXA 4TZKA 3NYQA 3H17A 4MVJI 3VPCA 5IZ4A 3AR7A 3A1TA 4EMBA 4MWSA 4B7XA 4F6RB 4WBXC 2KSQA 4H2DA 3WGYA 5KOJB 3DOJA 5C9ZA 1FOEB 3KHTA 1HC7A 4LJYA 5AI0A 4ZD6A 2BR3A 5I4CA 1A9ZA 1W8DA 1L5HB 1U6IA 3L0BA 3KQPA 3GRAA 2FPIB 2JVJA 2Q5FA 3MS2A 1VLJA 4N6NA 2ZYIA 4W1QA 4XIGS 4YI5A 4EKDA 3QHAA 3U7HB 3GAZA 1BA3A 2C7GA 3WE7A 1AH2A 4NL4H 3A0UA 2X42A 3E22A 5JCJA 5JSUA 2QM8A 4DMHA 3IT3A 3A1EA 1RE1A 4PZLA 1KFJB 4MUKA 4NU6A 1VRVA 2F3QA 2BEVB 4P36A 2NSLA 1THGA 2VUTA 1OCEA 3N8HA 4E22A 1ZN2A 3BGOS 2ZT8A 3ZZTA 5ELLA 4TYPA 2BKEA 2Q27A 4J0HA 2OUIA 3AT1A 5DLYA 4EMSA 3PC8C 1LGYA 2MINA 4IQGA 4C4TA 1JZTA 1SK9A 2J0VA 3H1GA 4E5VA 2C5HA 3B9RA 3V8PA 4F21A 5J4HA 2VP4A 1OX6A 1JLRA 1SA0A 1TMYA 1GRRA 2FVYA 2IZ1A 2XE8A 3EIHA 2D54A 2ZJBA 5EINA 2WU8A 5HTOA 4DJTA 3PPXA 1Z0ZA 3GUCA 3K6RA 1M7BA 5CNJA 1WBDA 3SEZA 4Q9LA 2BHSA 4YJ3B 2V74B 3GEEA 1HYEA 4QPJC 3VPBA 5KSOA 2R9VA 1V8ZA 3N0RA 2FPPB 3IJEB 5DN9A 2NVBA 1TYBE 1OI3A 3ECSA 4IVRA 5LYJF 1CQXA 4BV3A 1NLYA 4AYTA 1AS2A 4QBKA 2EWVA 3VJMA 5FF9A 1X7ZB 2OK8A 1G8FA 3S8MA 1ZC4A 4MI6A 1XYVA 1JWAB 4LFBB 4JBNA 1SHLA 2ZBDA 3BDVA 3JATB 4MPTA 4DOMA 1K5GA 2J3EA 3OQIA 4IIBA 3AUSA 2Q3EA 1CEYA 1L8AA 3GEPA 5BN4B 5CLHA 3RVJA 2GEBA 3DHEA 3ZE1B 2ZVDA 3IHLA 1I4DD 1B0UA 4DR1B 3PZRA 2EVWX 3UWOA 4RE6A 5DYWA 3AXSA 1XEXB 2QT1A 5CX1A 3LFUA 3OQPA 2J3HA 3JQ8B 4FXPA 4AULA 2HCJB 3MCTA 5ALOA 3U9TA 2HYDA 3Q88A 4F5YA 1NWCA 4PO9A 4ODIA 4QFBA 4UCXA 2OXEA 2ZS7A 2YNMC 2BGLA 4HDKA 4LBWA 3VX3A 5J58A 5E6UB 2BMJA 3Q0IA 3ZBUA 4MP3A 4BFXA 4ER0A 4QYMA 3DZDA 4WSOA 3TGWA 3TRIA 4MEJA 3EPLA 4QE3A 4J7XA 2W22A 4B3FX 2E4AA 4PSAA 4C4OA 1W96A 1XIVA 4H7PA 4ZT6A 4Z3DA 1G59A 121PA 2WTUA 1Y7PA 3DC2A 4KBGA 2X5OA 4CM6A 3SXPA 4HX9A 1ORIA 3T1HB 2B83A 3OTWA 4KWEA 2BP7A 3VZCA 1FSFA 3SYKA 3N5CA 4E0BA 2I9KA 1LQTA 5I51A 3LJKA 2DUUA 4NHEA 1YT5A 3TZ6A 3MC1A 3AFOA 3JX9A 3PU6A 5LBIA 5IX8A 1GZ5A 1V1RA 2EQAA 2GCOA 3C15C 2MR6A 4WOKA 5TX7A 3TN7A 2G5CA 1QB7A 3E9RA 2VP0A 4HOYA 2P2NA 2ZIVB 2VHJA 2VYNA 2WWRA 3PVSA 1QXSA 5DM60 1UDAA 3QVTA 3TSAA 1J00A 3E9MA 3LUDA 4HXFB 3CV3A 4BQQA 2BF4A 3AI7A 2BBTA 3REQB 1I2DA 2R6CA 1X7YB 1N6OA 1JDJA 5IC5A 4YJ3A 2I3BA 2YIJA 4WGFA 4EITA 1AN0A 4YRCA 4B47A 4EUNA 1E3DA 1KWGA 2JD2A 2DY1A 4NE2A 4LCBA 3TCNA 3PXEA 2RHDA 1YHYA 1ISGA 3P9KA 1LH0A 1XP8A 3HWSA 3WL6A 3H83A 1XZHA 3R4CA 2IUSA 3GT3A 3BWDD 4MHSA 2FN8A 3DKIA 1SQGA 2W8BA 4I4IA 5AI6A 2PFSA 3SS8A 4E2WA 3MBOA 3NHPA 3S2SA 5KNBA 1RHKA 1D1SA 2VYQA 3QWHA 4ZVSA 2ANBA 2C54A 2I7CA 4MQLA 4NZYA 2H18A 2OCLA 2MSLA 2W58A 2FV8A 2ZS8A 1AA6A 4GX2A 3OLVA 2WDPA 4UEQA 5AJYA 4LZPA 3R5JA 4URZR 3LUGA 2A6PA 2W98A 4PVDA 3W3AH 1NVAA 4MVJH 1XTBA 3WRXC 4F2HA 3HN2A 4EZIA 2JJ1D 2WNIA 1CQJB 2YXDA 4KUEA 1ZXBA 4K9RA 1BW9B 2A5GA 3SJ7A 2V3VA 2WWGA 1JKIA 4JJ8A 2DPLA 3ILSA 2XCQA 3NYWA 5J2UF 4GL2A 1SU7A 2DBQA 3VV2A 2H1IA 3BIXA 2O54A 3GELA 1DX6A 1CWUA 1XV5A 2B37A 3WMGA 1VDMA 5IT9A 3SFTA 1ZUHA 1YZKA 1BJKA 2RKOA 3DXZA 2TS1A 4OBBA 5KINB 5LP1A 2HJHA 1W34A 1J8MF 3GR6A 3OSUA 5SY9A 3RGGA 1HY3A 1WZCA 2P4UA 2WQZA 4TXMA 4YMIA 3TSCA 5ENDA 3WMFA 3W5AA 1DC8A 2XYPA 5JVDF 3GJRA 3TBKA 1QH1A 1U3WA 3AL3A 3JZFA 3K8ZA 3TS1A 2BFPA 5G0VA 5HUQA 3S29A 5HIMA 4I0WB 4D9HA 3HGTA 3MMXA 1U0LA 2J41A 4YASA 2ERCA 2RKWA 1OOEA 3WLJA 4IZIA 1D6NA 1N2ZA 2YWRA 4HUJA 1GN9A 3F6CA 1NVTA 1XAJA 3FGNA 3RO7A 1PG0A 4RJIA 4XDZA 4D3XA 3JS5A 4U7JA 3OJ0A 4BKRA 5EE5B 4BMZA 1Y9AA 2WUWE 3CE9A 4QBHA 3SBDA 4B6RA 4RPGA 5EJ9A 1C9EA 2KJQA 3KV1A 1ZIPA 1Z6QA 2V1XA 4X92A 5D6OA 3RLFA 4A6EA 4DJAA 5BMVA 4PQYA 1QDUA 4AKEA 1GCOA 3MGCA 1M2NA 4YCLA 1A9RA 4DN6A 1WKBA 4WAUA 2A0FA 3HACA 1LPBB 3A37A 3N07A 3GJZA 1A3CA 3GL9A 4QQRA 2I2XB 1XU7A 2VWQA 3KOOA 3LT5A 2E7ZA 1FYFA 1TECE 2IXEA 2VP6A 4A3SA 4BQNA 2B1RA 3BKXA 3SF8B 3ANXA 4OL9A 1M8PA 5ELXA 4ZC1A 1XMSA 2DP4E 1BXKA 3PBKA 5IANA 2PEZA 4MOWA 3QVSA 2G8NA 2QN6A 4EQZA 2NNWB 2GJSA 1PWXA 3L1VA 4V39A 3G0DA 4G5FA 4EKEA 1WOYA 3MD9A 4FYHA 1XCPA 2JB9A 3Q2IA 1UBEA 2OILA 1QDEA 1RQXA 4J7UA 3CS3A 5F1OA 2JHAA 1VG9B 2O4UX 3W2HA 1H4QA 3PHCA 4X8OA 3SQWA 4YN3A 4JC0A 4NPAA 7REQA 3EZYA 4JK3A 1NM5C 3D2LA 3EG5A 1P17A 4OSEA 4QDTA 1Z83A 4C7KA 2A67A 3PKJA 4YAJA 4NESA 1Y9EA 5H7XA 3WKDA 4UDXX 5F4ZA 1QP4A 1UXHA 1FJ2A 3E1GA 2PQ0A 1YBFA 2YNMD 1E94E 2H08A 2AK2A 3LXRA 3B1ZA 5DIZA 3WB9A 5J40A 2ID7A 4GGPA 4AJIA 3G7NA 3RTGA 2G09A 3SS9X 1KORA 4BJ1A 5ITSA 5JRDS 5JCOC 3DOHA 3FCCA 3HU3A 3BFXA 3A26A 1IJBA 3RK4A 5EZ5A 1NI3A 5BXYA 3HJRA 3BRCA 3AZQA 1TW2A 2FPGB 4YDHB 3TZBA 4IOLA 1RC1A 1WNFA 2VHZA 3NT2A 4MV1A 1QHNA 3ROEA 5E0KB 4BKMA 2C31A 1ZW1A 1TVKB 1F6WA 1CUGA 3U3JA 2JIQA 4AL4A 4HH1A 1TJ4A 5FJJA 2C4TA 3OUTA 3X1MA 1FA9A 1Z2DA 1S4MA 1ZKDA 4HUQB 3UN1A 1SCKA 4LOJA 4RF5A 2FMFA 4ADSG 4EHLA 5LA6A 4YV7A 4LSGA 1TTQB 5AVSA 4B73A 3OA0A 3LYHA 1QRDA 4X6YA 2EW2A 4FHGA 3RROA 2PWYA 1KARA 1Q0SA 3PNQA 5REQA 1MAAA 4BQIA 4YRBA 1PEKE 2ZSAA 4MP6A 1Z6GA 4RLHA 4Y2RA 4ECAA 1JQKA 2GZRA 2QTBA 4CF4A 3IESA 2W2LA 5DI3A 3TMAA 2P4HX 2AEEA 4PVCA 2V7WA 4ZVOA 4DUPA 2Q29A 3P9YA 5C8YF 3LS2A 4PLGA 3KTFA 2ZWVA 4R51A 4YCDA 4AXXA 2ODQA 5FTWA 1X7DA 1GITA 3AUTA 3T3IA 2H1WA 4U7HA 4BKPA 3BCSA 3S40A 5CBPA 1PI3A 4I9HA 3USCS 3VHXB 3LP6A 5A6SA 3G0GA 2C0QA 1MVNA 1VLQA 4HAWA 2AK3A 4M88A 2VDKB 1WMBA 3PJFA 5CH3A 2YOFA 1XCGB 3TCXB 2JAWA 1IMOA 3PCXA 1EGQA 5AVWA 1ATIA 2AJTA 1CZHA 2I6GA 2IKSA 1CUFA 5KI6A 5IM4F 4QGFA 2RHGB 3IP7A 1YL5A 2XHEA 4DAOA 3OJFA 4IIUA 1NZFA 1E5QA 1BGXT 3IOEA 1QQBA 3GRKA 2NU9B 3SQMA 2X9VA 5FEMA 4HK4A 4FC6A 1WTCA 3VZRA 1MAWA 3HLKA 4LNUB 5KJ6A 4E30A 3BXPA 3FRJA 3EASA 2Q3BA 1Z7YA 5AICA 5HEKA 3KLOA 3V4OA 1AHPA 4LRWA 4EVRA 4TKZA 4A8HA 3R23A 4AZTA 3C14C 4BFTA 2DFLA 2QNBA 2H06A 3I9MA 5GV8A 4K9KA 1FIUA 2FJ0A 2YWGA 1U7TA 1U4NA 1ZCBA 5AVYA 2P6RA 4NCXA 4EHFA 1EFKA 4HPXB 3FWHA 4TMZA 5DULA 1VE3A 3SR4A 1XQ1A 4XM0A 2ID9A 2JIMA 3G82C 2AG5A 3PCTA 3M2TA 3QEBZ 1J2TA 1G20A 4TKUB 1QE3A 4FI3C 3CGGA 4LTDA 4BNHA 5IBQA 5CXXA 3G8DA 4N0PA 5HRAA 4AQ7A 1XYGA 4MV6A 3FR8A 1VI2A 1QO0D 4QOGA 4RPHA 3L3BA 3RHFA 3SNKA 2J6HA 2AQHA 2WG0A 3WX0A 3ZXUB 4LJSA 1RJ9B 4UCFA 3N8GA 3QX3A 4BVAA 3JQBA 2JF0A 1MX3A 1OFVA 3VTKA 2XPCA 1BDMA 1QFYA 5FTMA 2ZU6A 3CM0A 2HSEA 3T95A 3UFXB 1EB8A 2P4EA 1QAMA 2HF7A 1EBBA 1TKCA 4L8VA 3UT5B 1ZJJA 3JWGA 1VKHA 3IRUA 1XFDA 4D82A 4ZCIA 3EXFB 1CRPA 2FEOA 5GVSA 2V55B 1R7RA 5JTUA 1RJWA 4JEUA 5JTTA 4MDHA 3LVRE 4F4UA 4PYNA 2XVYA 4E4YA 1FZTA 1JHYA 4KSBA 1KR5A 5CA0B 5TPZA 1SG9A 1HR0B 4YRNA 3QUTA 1RPTA 2F3PA 2ZQZA 4Z2YA 3UMCA 1SRQA 2G17A 3AK4A 3HY3A 4FS8A 1CUUA 3V1UA 1ODIA 3KQOA 5IS2A 2AN9A 5D51S 3ZIAD 3JVUA 2OMKA 2BKLA 1MXFA 4BLSA 4F1JA 1LSJA 3KALA 4OY3A 2AYXA 2OCYC 2FK7A 3GLQA 3TRFA 4HEA1 2EZUA 1W48A 3IQIX 4GSYA 4HEJA 5KYWA 4AS1A 4CMIA 1EXMA 2ZE7A 4WERA 5HYVA 1SWVA 3I12A 3L77A 3MUOA 3RLIA 3HCRA 3A31A 3ETEA 4UFNA 1YC5A 2CHVA 3NDPA 2I7TA 3ZJ5A 2WJYA 5K8UA 3E05A 2O0KA 4H7IA 1ESNA 5FUXA 1Z4KA 4M6WA 1ZONA 4YJ3F 1X1SA 4WEQA 5A05A 4MDYA 4HLDA 1MJGM 2YWJA 3D4OA 2HHJA 1UADA 5ALYA 2C7QA 1MH1A 3DTNA 2FPMA 3I39X 4K40A 1J90A 1TJYA 4P31A 3C16C 3FWZA 4O29A 4EY5A 4Z5XA 2A1TS 4NOJA 1K5HA 3QH4A 4OLBA 1R27A 3DTTA 1NFQA 4PCLA 2IQIA 3SFZA 4A8PA 4PLCA 1UJ6A 3HJUA 4TQGA 4CMEA 1KE2A 5EEGA 4P7BA 4BYGA 3K0SA 1FYVA 2EKBA 1I3NA 1W25A 3FYUB 4OA8A 4XYMA 3GN1A 4CKBB 1XDBA 2CXSA 4GW3A 1JXAA 1IPEA 1YZUA 4RMIA 3LQ1A 4XIYA 1XMQB 2H3EA 2SHKA 3AZPA 3LLCA 4RFVA 5A9SB 2PZBA 3P9IA 2VT6A 3BMQA 1KO1A 3MWEB 4GYJA 1P0IA 4DEVA 1O0BA 1E5LA 2WKSA 1O94C 3WGGA 3OLYA 4KR0A 4NAVA 4TLEA 1Y63A 2CD9A 1HDRA 2ATVA 3CNEA 4HJXA 3Q0EA 5H4HA 3TNLA 2R8XA 1V8OA 3EULA 3GJ6A 3M70A 4TL9A 5DX1A 2GETA 3G8CA 5BRJA 3LUCA 4KWCA 4QREA 2DTXA 3DV0B 2GJAA 4X20A 2OV8A 4XR9A 1ZJWA 2UU9B 3NKFA 4JQSA 1OXTA 5BV1A 5FXMA 4REMA 1N1DA 4Q1AA 2OCAA 2XQJA 3FGPA 3G7UA 3MMNA 4K2HA 4B35A 4NH0A 1A2BA 1VIVA 3WSWA 5H82A 4A16A 4EB8A 1R9GA 1CERA 3GYBA 3IP6A 3JQEA 1Z6XA 4L9AA 3FHCB 4I8XA 1OAKA 4Q3BA 4R83A 1H4VB 4U9IS 4C07A 5CVTA 3QYPA 3I5MA 2A59A 2AC4A 3RR2A 1LRLA 3ZIDA 4D44A 4DLPA 5B5SA 5JISA 2CVOA 1MB4A 2HL6A 3P8ZA 4RWZA 2XB4A 5BSKA 3L7KA 4M83A 2G04A 3WYDA 2Q9CA 4E2XA 5I7FA 4DV2B 3WK7A 1C7EA 2QQFA 3CEPB 3OZFA 5T6BA 5KNCH 3PXCX 3L1IA 2OEPA 1Q84A 1E7SA 4UBOA 1FNNA 2B2XA 1U2DC 2CHGA 3M5CA 1U7ZA 1E3WB 2AF4C 3MTQA 3HBAA 4HXYA 3ESCA 5KPJA 3THWB 3K05A 4HNRA 2WFAA 1NT4A 1W8IA 4PC7A 3R7NA 2W00A 4FEGA 2JH8A 4C21A 4Y0AA 2FN9A 2B7BA 4TM7A 3WNBA 3TCKA 4EJ0A 8AT1A 2X3UA 3K8OE 4WKPA 1T10A 4TRJA 1V4VA 4BEVA 2DKOA 4HDRB 3RABA 1XA0A 3DE6X 3HUFA 3RU9A 3C98A 1X7XB 2VCYA 3C6ZA 4ILKA 1II8A 5EYPB 4U2DA 3CLRD 2CJXA 5D2CA 3CRRA 3WHPA 3ER6A 1KI3A 3K72B 1N75A 1FP1D 1NZJA 1ENYA 3HKCB 1EG2A 4M8IA 4MUEA 5KHAA 1MW8X 1QG6A 1SWWA 4IV5A 3ROZA 2BGIA 4OYHA 7MDHA 2H2DA 2UYGA 4F86A 5TGZA 4IDGA 2XUIA 4OLAA 3BSWA 4MWBA 3FDIA 2AC2A 3S7ZA 2QV0A 2PRIA 1VQ1A 4TKMA 5I3CA 4Q37A 2HV9A 1JT9A 1SIWA 4O02B 4UFPA 4PN3A 1MBZA 1V3TA 1ILWA 5CFOA 4DQVA 5JRZA 4K9NA 1MB9A 1G7SA 1CUHA 1ZNXA 4TN5A 1KNQA 4GLLA 3RV4A 4ZCRA 1PJTA 1BXRA 2M32A 1PYDA 4MUGA 4RHTA 2IY8A 3ER9A 3PSHA 1OXKB 2FW9A 1J7KA 4EY4A 1CVLA 4X8HA 4DUYB 1L7AA 2E0IA 4AWBA 2R8OA 1JDVA 1E1KA 4Q1FA 2QVLA 3ZQKA 5F76A 3BJRA 4YHHB 4LJ8A 1I3MA 1JR2A 1UMBB 4EB6B 2VTDA 2AWNA 2RHRA 2XYQA 4NYMQ 1Z39A 5LU8A 1Z45A 1ZFNA 2G82A 4UEKA 4B43A 2PTHA 3BDAA 3CPSA 3L1KA 3C6KA 1PN3A 3JASB 3AGPA 3ZY2A 2XY4A 1OTHA 1DVRA 3LQFA 2Q3LA 3MWKA 4JLOA 4C3VA 3R9XA 1FS6A 5B12A 2PH3A 1I2ZA 1PQWA 1ZGJA 2DH6A 1I4LD 2RGGA 3PB3A 4YLYA 1KDTA 4GR4A 2NZXA 4WD3A 1XNJA 3LUPA 1CW2B 4FFVA 4K6MA 3NVKI 4WL0A 2QLFA 2XUQA 4WZAA 1WHSB 2IE8A 2PM8A 3T0GA 1X9GA 3OKPA 4LAFA 8OHMA 2A9VA 3IMKA 1C41A 1OLXB 1NQUA 3MAJA 3OZGA 1F2UA 4LQDA 1JF8A 3NHJA 4QYSA 4UUAA 4DLBA 3OUZA 2PG3A 2G7MC 3PEYA 3H9EO 5AHOA 5BN1A 3PUZA 4FKMA 1T3GA 4FDAA 1ORWA 1XLWA 2GAJA 4BZQA 4JIMA 3A4NA 3WNDA 3AERA 4YCSA 2ZKLA 3MYRA 4F85A 2P5YA 5I3ZA 4W5HA 4OQMA 4QL3A 5IJ9B 3SLGA 4WN3A 1XG5A 5H70A 5AK4A 4GC5A 4WVLA 4KXMA 4IJ5A 5BN4A 4LW8A 2AFRA 2V8BA 2B69A 2BJHA 1T5LA 1TQDA 3H87A 4PFQA 5ADUS 4KFUA 5KWJA 4EATA 3Q3GE 1UBTS 4H59A 4ZVPA 5M34A 2J85A 1PZMA 5F3DA 4S1VA 4WXYB 2FN3A 1WA5A 3EGDB 3V4VB 5ITZB 4RJLA 1F60A 1DFGA 3G2PA 3LF2A 3LXMA 4E12A 5JS7A 3HTXA 2H5JA 2V6IA 1N8NA 2JIZA 4BEBA 3BG5A 3T1VA 1UPBA 1GA4A 1L7RA 2Q2WA 4XSVA 5I9BA 3ELDA 5SY4A 3FMGA 2H9AA 3VGJA 3OPYI 1G41A 3H2YA 5JJ5A 1E4EB 5KNBD 3OKCA 5GZ6A 3AY3A 1DBRA 5DBFA 1TC1A 3CKLA 1JR3E 1ZG3A 2QTVB 3M6XA 4UU1A 4QYXA 1RRKA 2C5FA 4H16A 1SBYA 1E1QD 1A96A 5CLGA 1HI9A 1Q7RA 4ZDJA 4UBMA 3RYHB 4LWPA 3I6YA 3EK2A 3K5WA 3EEQA 1P9WA 2VUSA 3DBLA 1E4YA 3MWYW 4Y1GA 2EQBA 5DP2A 1UT6A