3LW8A

Shigella ipgb2 in complex with human rhoa, gdp and mg2+ (complex a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
GPLGSAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein RhoA
publication title Structure of Shigella IPGB2 in complex with human RhoA: Implications for the mechanism of bacterial GEF-mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rhoa-binding protein
total genus 62
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3lw8A00
4Q02A 1E0KA 2WJIA 4Q5IA 4YMWA 2VP0A 2HYDA 4QBIA 2C78A 2F1IA 4Z1MA 3W6OA 2VL7A 5EQTA 4KFTA 2MSEB 1DAIA 1N0VC 1W5TA 4B3XA 1P62B 2QPTA 4D25A 2XB2A 1GNQA 2B7CA 3EX7C 1FW6A 2ZI3A 5F2EA 3CW2A 3DPUA 3THXA 1W48A 1XEXB 2AFHE 2OSBA 1E2MA 2ZI5A 3THWB 2FJUA 2PJZA 4NYIR 4GP6A 1KDRA 1R5BA 3MGCA 3SJZA 2OAQ1 3D8BA 3GJ6A 4LHVA 3E5HA 6Q21A 2HCJB 1AKEA 3QVUA 1N6IA 3B85A 1KSGA 1FNMA 4LHZA 4QC2A 2P0EA 2BMFA 2LKCA 4RFSA 5HPYB 3L8YA 4GZLA 4QXAA 2ZPTX 3EPHA 3E1SA 4MYTA 3AVTA 2VP6A 4ZCIA 3I4LA 1PLKA 5DHFA 2DB3A 1U0HC 2ZANA 3QG1A 3B1XA 3B1WA 3MJRA 3X1WA 2NO7A 1KMHB 4TL6A 5IRCD 4QGGA 4M9QA 4UNRA 1CRPA 5EZ5A 1N6LA 3HYTA 1G8PA 3RRZA 2WJJA 4EPYA 4EKDA 2L0XA 1DS6A 2FSGA 2HF9A 2ZR0A 1D6JA 2WSSA 4DBLC 3D31A 4TL9A 1SVKA 4B71A 3RC8A 4QG7A 2QA5A 4DCVA 3KJGA 4BEBA 5EUMA 4PR0A 4Y0VA 1LF5A 3R8FA 2RH5A 4W5JA 4ABYA 2GBLA 2O8CB 4FCTA 3UG7A 3THYA 2EFHB 5AK0A 3DDCA 3P27A 1DO2A 3AVUA 1Q1ZA 3B1YA 1G3RA 4DLWA 3C8UA 3KQNA 3H4MA 2BBOA 3MSXA 3VKWA 4QM6A 4LHYA 1Q57A 1TUIA 1W4CA 1E99A 2GXQA 1YZLA 3DEFA 3MWJA 1OIXA 2BM0A 3C7KA 4Q00A 2XJ9A 2ZRJA 5EXSA 5EP1A 3TK1A 4XWKA 5FOUA 1UEJA 3UMSA 2FEMA 3N70A 3Q7QA 5HE8A 4IW3B 4TL7A 1VG8A 4P4SB 1CR0A 1U90A 3I32A 4BPBA 2ASEA 4MKHA 3DOFA 3RC3A 2XJ4A 1D8TA 1ETUA 4HB2A 2CCGA 1F5NA 4TMXA 2UVQA 1HURA 4MRSA 4AWXA 4OJQA 3LDAA 1GNPA 4KSBA 3FHCB 4A8JB 4ESVA 3NH6A 3ICQB 1MRSA 3T34A 1E2DA 1VPLA 1R4AA 221PA 1N5IA 2TMKA 4X8LA 1UPTA 2IL1A 5K8LA 2WM9B 3JZAA 1QHYA 2ZYWX 4C0HA 1XTSA 1NMXA 4GOJA 2PH1A 3U6KA 2R6AA 2CLSA 1Z0KA 2OUKA 2LKDA 3VQTA 4XWOA 4CEHA 4QFMA 1YR7A 5GJBA 3MJHA 4A1FA 4D81A 2CLCX 2OAP1 2VHTA 5KSZA 4A8JA 2ZAMA 1YZKA 2B7BA 1W46A 2YWFA 1TU4A 1L4UA 2WKRA 2JLQA 3BXZA 4M9SA 2O52A 2W2VA 1S3SA 2ZRAA 4NL4H 4UNSA 4M4SA 2RGNA 3FKSA 4OK3A 4TLDA 4C0AC 5JFGA 1Q1QA 2W2XA 4Q1BA 4JL5A 2GJ8A 4KSCA 3TUIC 2FFBA 2AKAB 1O3YA 4PTLA 2CVFA 2OEPA 1PUJA 1IN6A 2CK3D 4QJ4A 2R6CA 4HB3A 4URVR 2AX4A 2WWIA 1FTSA 4LC1A 1DOAA 4LSGA 1ZM7A 2W00A 4EFNA 1SHKA 2WOJA 3KJIA 4QHSA 4ZKDA 2I3BA 2V1UA 2OCAA 2QE7A 3NVAA 5P21A 1RKBA 3K0FA 5HTKA 2ODEA 4KVAA 4M22A 5L3VA 1N3BA 4NBSA 1ZU5A 621PA 2H16A 3MFYA 4MYUA 1QDEA 4NYMR 3T5GA 4JBXA 4HZUA 4D82A 4TMTA 4ZDWA 2QY9A 2Z5FA 1PZNA 2JJ2D 1OH6A 2ZVPX 2R9VA 3PQCA 1CF4A 3MRSA 1XBTA 2ZJBA 3A36A 3GEIA 2C96A 4ZKEA 1GDDA 2IUTA 3AP3A 4A9AA 3KB2A 4IOLA 1SVIA 1ZUNB 1UDWA 4IDOA 1CEEA 4M9XA 3TAHA 2QBYB 2A30A 2W83A 1L7VC 1XXHB 2ZUCA 4G1UC 2JASA 1W2GA 2C03A 4PSVA 2GJ9A 5EP2A 3OIUA 2RB4A 2XEXA 5BXQC 1YRBA 2P3SA 4ZIRB 4BECA 4DLTA 1CRQA 2GCOB 4B76A 4N0EA 4F38A 5TVKA 1OB5A 4RZ2A 4G0NA 3ZD6A 4URZR 3H86A 3OESA 1KNXA 1OXXK 2F6RA 3TW4A 4M0LA 4GT1A 1MO6A 4IOKA 5CK4A 2FG5A 2HDNB 3CRVA 1NL3A 1XCGB 4RD0A 4Q9LA 5JMTA 1JQJC 3EZ9A 1OHHD 3RWMB 4D4MA 2YHSA 5K8TA 1M74A 3P26A 1Z3IX 4QL3A 2GXAA 3C41J 2IUUA 5H8WA 1G6OA 2J0UB 3D3QA 3CPJB 3TNFA 3VTKA 4DCSA 4NU0A 1N6KA 4O0MA 1WQ1R 2GZAA 4EUNA 2CNWA 4N0DA 1XWIA 5KSOA 1E2NA 2QAGA 4TYPA 2EYQA 3B9PA 3KDSE 1Z6GA 4NCNA 2ZRNA 4DJTA 5HCIA 1KK0A 5FR2A 1KO5A 3WYFA 2AKYA 1G16A 4FN5A 1M7BA 1SVLA 4PZZA 4S2EA 1E1RA 4DLUA 4ZPXA 4M1MA 3SN6A 5JHGB 3GLIE 3ZIAA 5IT5A 1J7KA 5A0FA 5AJVB 4OHYA 4PPQA 1D9ZA 1B0UA 1N6RA 2E87A 3GJXC 2IX3A 1KNQA 2BVNA 3DOEA 3DL0A 3O47A 1YR9A 1XD8A 4LJ5A 1IY2A 3KKNA 1R2QA 2XITA 5CITA 4NKRA 3FMPB 1OH8A 5FTMA 2WV9A 1MT0A 4DDUA 4PO1A 1VIYA 5JJLA 3TVDA 2KWIA 1WP9A 1RIFA 1NG9A 4BFXA 4US2R 2GNOA 1JNYA 5F98A 2WWXA 1J99A 3W3ZB 4LJ8A 2XTMA 3B60A 1ZNYA 4O3MA 2PLFA 1TADA 2FH5B 1XEWY 4Q9IA 1GOTA 5JCPA 1E4VA 3P1JA 1RPZA 1BS1A 1LY1A 3QI2A 4CW7A 2PX3A 3CR7A 4DWJA 3EA5A 5JBQA 1GNRA 5D3MA 3SOPA 3AH8A 3L8ZA 2HJGA 1W4RA 3GEEA 2VLIA 2PCLA 2PEYA 3THYB 3S1AB 3PENA 4BZXA 2YKGA 3A1TA 1KIMA 1W5SA 3BC1A 3CB4A 1F2TA 3QJYA 4DSUA 1EWQA 1H8HA 1TU3A 1G3UA 5F9HA 4IXMA 1KY3A 1DG3A 1XEWX 3UIEA 2IWRA 1XMVA 2IYYA 4TSFA 3T15A 4XVRA 4B32A 3U6BA 2GZHA 4II7A 1IY1A 1M7HA 1WF3A 3MG9A 4M1KA 4BLTA 4UXJA 1NVVR 4LDJA 1ZP6A 2PMDA 2QP9X 2RKOA 4QGAA 4Q9JA 1Z0JA 4LBZA 1GSIA 4GMDA 2FFAA 2NO1A 1C1YA 3R7WA 721PA 5B58C 2N46A 1HUQA 2GF9A 1KY2A 4L5BA 2KE5A 3PG5A 4QRHA 4U5XA 2G83A 2H8KA 3WYAA 1PLLA 2K5UA 2OCBA 1N5KA 1G3QA 2VF8A 4JIMA 4R2HA 3T35A 4EPVA 3ADDA 1Q3TA 1VHTA 1ZYUA 3G0HA 3RWOA 1TL7C 4OI4A 4KBGA 5BYJA 3RS2A 2GEUA 3LLMA 1Q22A 2G3YA 4CDGA 2QM8A 1OLOA 2FV8A 3KKQA 4EAQA 3AKYA 1E96A 2XTNA 3FGNA 3THWA 4QHYA 1G21E 1OFIA 4DLYA 2KSQA 5BN4A 4BLPA 1LFDB 2GILA 4CEHB 3CR8A 2WWWA 3OIYA 1OB2A 2BBSA 4MA4A 3TH5A 5FL7D 1F2TB 2CCKA 5KSYA 1E4YA 4DLVA 1W36D 5EP3A 2ZYVX 4PPGA 3I1FA 3AVQA 2E9SA 1KI2A 3PUZA 4EPWA 2F3RA 4P4UA 3REFA 1HT2E 2R2AA 4JLBA 2JGNA 4G5OA 2PZGA 4RD1A 5JHHB 4DKXA 3B6EA 3LA6A 4HAUA 3FMFA 3QXJA 1VYTA 1TF5A 1YR8A 3WNBA 1XMJA 1KKMA 1U98A 1VMAA 2C9OA 3KKMA 5FTJA 4ASUA 2C2HA 5KDOA 1N0UA 3H84A 5BYKA 2FA9A 4HDCA 5H68A 3DM5A 2GJSA 4E09A 4P32A 3AV0B 1JAHA 3L0SA 1WXQA 1D9XA 1OFTA 1U2RA 3IEUA 2VIIA 2CEAA 4Q01A 1G7SA 1II0A 2YV5A 3LVQE 4OJKA 3LY5A 1NIJA 3L0OA 4G01B 1RE0A 2PMKA 2Q3FA 1NVVQ 1LV7A 1W44A 2I1QA 4HZUB 2ZSDA 3ZZ0A 4DLZA 4IEEA 4TLBA 1CJKC 2J87A 1II8B 5CIQA 3KUDA 4IXNA 5HKKD 3SQWA 2GAOA 2VSOA 4IRUB 2V7QD 4Q1EA 2YOGA 4CEIA 4A0GA 2EWVA 1QRAA 2H57A 3EASA 4M2LA 3WHKA 1VCOA 1IXRC 1LNZA 1SVSA 4LJ9A 2G1JA 3THOA 3QKTA 2QP3A 2ZRMA 2QGNA 1KYIA 3QKRA 5C4GB 1EFHA 1MO4A 1A5TA 2IF0A 3UWOA 5GADl 4DCNA 5FPKA 1A2KC 4FW9A 1Z29A 4LV8B 4Q9KA 4TQ9A 1GUAA 4DT1A 1WRBA 2JJ1A 1P60A 1ZIOA 2NPIA 5KTYA 3M0EA 1FX0A 2FPKA 3CNNA 3KUCA 3QEJA 4KLNA 1P3JA 2OT3B 4HLCA 5LD2B 3BE4A 4WXPA 3KKPA 4KV9A 1E9EA 2ORWA 1KI8A 3SU8A 4BRUA 5JSZB 4P3YA 3RRYA 4Q1AA 4P4SA 3LBNA 3OE7A 3GLIA 1OYWA 1Z0FA 1JEEA 4EJSB 2C99A 4WAUA 2QU8A 1N0WA 3GEHA 2HYIC 2GXUA 3ZYCA 4F4CA 4JS0A 3T06B 3CNOA 2W6JA 1HQCA 4MQBA 3ZZTA 3TSWA 1GRNA 2I1VB 1AGPA 3A37A 3DMDA 3BFXA 1W36C 3QEOA 4HEJA 2BV3A 3MAAC 4D0LB 4ZO4A 4C0SA 1GITA 1T3HA 2CE7A 2G1KA 3FKQA 1E98A 1T8UA 3MMPA 3Q3JB 4JLDA 3SZRA 1BH2A 2ZS7A 3FVQA 1KAOA 1CBUA 2IYUA 1N2CE 3CWQA 5J4VA 1IN5A 1N6OA 2IS6A 2PT7A 3QG5A 1R0WA 2IXEA 1AQYA 1W49A 4XTRA 5L3QB 3SYKA 3W5IA 1NY6A 1OJLA 2R6GA 1DADA 4UNPA 2IYSA 1XRJA 2PX0A 1G3MA 2ZRIA 2OM2A 3KB1A 4LRWA 2C04A 5G3YA 5FFMA 4AKIA 5CK5A 4DLRA 5JSZA 3WMGA 2QEQA 4E07A 1XU4A 1Y3AA 5EE1A 4NTZA 1ZVQA 1XXHE 1KI1A 4HAYA 2QORA 3CUEF 1U81A 1N6NA 2R6DA 4TQAA 2F43B 5HZKA 3K9NA 3L43A 2X77A 4HUQB 2XOKD 3QBTA 5EZ6B 4B43A 4B48A 2O0HA 5EE3A 4GSYA 4D0NA 2IYRA 3ND9A 1G291 4Q1FA 1ZD8A 3FB4A 3VR6A 2GA8A 1OPXA 2FU5C 2ZI4A 4V03A 2VO1A 1P2VA 4JL6A 4LYHA 3RS3A 2VP4A 5DH9A 1G5TA 2J7PA 1ZINA 1AZSC 1TMKA 1HE1C 4PO8A 2IK8A 4YQFA 4DB4A 2H7VA 2GDJA 2QBYA 5FOWA 1AS2A 3VNVA 4HATA 1BKDR 2VQSA 2VF7A 1SKQA 1P4SA 3IPXA 4FXPA 2EQBA 4IVQA 2HT1A 5HE9A 2OBMA 4JMPA 5FUVA 2RHDA 3EZ6A 4QHTA 1HYQA 1XTIA 1XD2B 4Z8YA 2GCOA 2BMDA 3JVVA 4RZUA 2FSHA 3CH5A 1E32A 2REXB 4LBWA 3U5ZB 1JI0A 2BCJQ 1FUUA 2VA8A 3WP1B 1S0UA 4NCKA 3X1XA 2ZRPA 3T1TA 2WZQA 3HR8A 1GWNA 5J5CA 4B47A 1UBEA 1RYHA 3EW9A 2KBFA 3CPEA 2O8BB 2R44A 2OCYC 2VSXA 1Z6XA 2V9PA 3X1YA 3FOZA 1JR3D 1Z0AA 2F1RA 3FKSD 3TR5A 1VG0B 1R0ZA 1TQ4A 5D3QA 4F4IA 5UKDA 4OHXA 1K5DA 4X8MA 4TMKA 2W0SA 3MCAA 4EDHA 3LX5A 2VEDA 2ZXUA 1XMIA 2A78A 1KAGA 5JLJA 2KI5A 3GJ5A 1G8FA 1XDBA 2QE7D 3L0PA 2RGNC 5FUWA 2G6BA 3LBHA 4C7OB 3GP8A 3JVUA 2D74A 5K8IA 1E2PA 1DPFA 2OXRA 3E2IA 2RGCA 4AG6A 4RVCA 3HDTA 3LLUA 4XH9B 5HCNA 4I1OA 2FSFA 4QBGB 5GVRA 3ZS8A 5KNBA 1XEFA 2FZ4A 3AF1A 4A0FA 3FDIA 4CZ2A 4A4DA 1IOZA 1WBDA 3U3MA 2ZS9A 3ZDQA 2WPDD 3QENA 1Z07A 2CL0X 3FYHA 4JT4A 2ZJ5A 3BH0A 1RYFA 3FFAA 4Q1DA 3EZ7A 3NG1A 4ZCMA 1YZUA 2HUPA 2J3EA 2WVJA 4UNQA 4AIIA 2YINC 3EZ2A 2G88A 1NRJB 2QG6A 3IEVA 1ZD9A 5JRJA 1OYYA 1XTJA 4RKFA 2CHVA 2SHKA 1UAAA 4B6FA 4YDHB 4CVNA 4QGHA 3SYNA 2VYFA 2CJWA 1IY0A 2C77A 3NC0C 1QG2A 4LHXA 2OFOA 2O5VA 3TKLA 3EXAA 4CRWB 5KU1A 2DWOA 1CJMA 2DFLA 5CM8B 4ZIRA 4ZCLA 2YOHA 1JXOA 1U0JA 1OF1A 1NN3A 5M04A 3RSLA 4BFSA 2ZYUX 1OHHA 4NE2A 5DI3B 1OE0A 2QENA 2RGDA 1E94E 2ZRDA 1MKYA 3OEHD 4PZLA 1GL6A 2YWHA 3QPUA 1JQLB 1NY5A 1CXZA 2GK6A 1X8JA 1US8B 4KHZA 4JLKA 3OEEA 5BW8A 1A7JA 3GLHB 5DISB 4OBEA 1EFCA 5DYIA 1QHIA 2V6JA 4C4PA 2C8VA 2H1LA 3AVVA 4YONB 1F3OA 2JIZA 1RJ9B 3QIAA 1Z6TA 2IYTA 4I99A 4KU4A 2Z43A 2ZTSA 2J0QA 3TUZC 2GESA 3HP1A 2ODNA 2A9KA 4MUBA 2V4ZA 4B34A 4B3FX 1ZJ6A 2C9YA 5KO2A 2ZM5A 4GZMA 1NBMD 1E9CA 2JDID 3KQKA 2D62A 4L16A 4TMWA 4KYUA 5E4FA 1OH5A 1NLYA 1DTSA 2C5LA 2FEOA 4LUCA 2NO6A 4V0OA 3VR2A 2IXFA 2PCJA 3RS7A 4JVSB 2V8OA 1R5NA 4Q19A 1Z6YA 2GCNA 5FOVA 4JYCA 2XNDD 1T6NA 5JECA 1IQPA 2OZEA 5EE5B 3EC1A 3UANA 4Q7MB 2D7DA 3H0KA 3LBIA 4I1VA 3MD0A 1OFUX 1R10A 3AKCA 4Q4AA 2OFWA 3U3OA 3EAQA 5B30A 4J0QA 2J9RA 3NEJA 4OHWA 4B75A 2XZOA 4Q7JB 1U9IA 1VECA 1DARA 1ZIPA 1A2BA 2HJVA 1U99A 3K70D 1KO1A 2QRZA 5FPYA 3BWDD 4TT3D 4DCTA 3WXMA 1EX6A 3A6PC 3ZS9A 1FUKA 4TMVA 1H8HD 2OBNA 3HPQA 2O8DA 4KO8A 3HYRA 5KDDA 3K70B 4YMUA 3L2OB 2FDCA 3Q7PA 4TSFD 1IHUA 1EESA 3I72A 3U4QA 2BCGY 4TLEA 5SZIA 1NLZA 4CEIB 2B6HA 5DN6A 2D06A 2IT1A 2AHOA 4MKFA 2XB4A 2IEYA 5AJXA 3T1QA 3NDPA 1D5CA 3AGPA 4PC1A 4QM7A 1Z63A 3KXKA 3AVWA 4LBVA 2F9LA 3D6TB 3K0AB 1GL9B 4DIEA 5DIFA 5CJ2A 3ZQJA 3CONA 4UXHA 3P4YA 4JLPA 1EXMA 4Q4JB 4JVLA 3RRMA 4JJKA 4IFEA 3SEAA 2HXYA 1CJUC 2RGGA 3SR0A 1E79A 3VFDA 4CEJB 1JR6A 2FPMA 1NVXQ 2RGXA 2YWGA 2RCNA 4GNKA 4URUR 5LPNA 4QBFA 1E2KA 1G8GA 1X3SA 2W6ID 4Q7LA 3V4RA 3MWKA 1W0JA 3AB3A 1RRCA 1GG2A 3NH9A 5BQ5A 1IN8A 1G7TA 4YLGA 4MH0R 5E7IA 3V9PA 3RS0A 3AEZA 4Z1MD 3TR0A 3KXIA 2JAQA 3P20A 3BS4A 4L4UA 1G9XA 2P5TB 2ZS8A 4EJSA 3KTAB 1T5IA 4MGKR 4WXRA 5E7JA 2F3TA 2QZ4A 4LCBA 3QSYA 4WOPA 4TYWA 2N1BA 3Q85A 4OKSA 1E9RA 3UK6A 3VR4A 4ON9A 4NHOA 3BERA 4DLXA 1COWA 4OQXA 3QKUA 4FMCF 3T61A 1UFQA 1AQUA 2KBEA 3GJ8A 3NIBA 3X2SA 4PHTA 4MGYR 1BIFA 3KTAA 4LX0A 1ZM4A 3IKJA 2YC2C 4HAXA 1NF3A 2ZUBA 3AVYA 4B3GA 2F43A 1FTNA 3BB1A 5HZHA 2UZIR 2ZYTX 4BFYA 2ZI7A 3CRMA 1AJEA 1ANKA 3X1DA 1G5PA 4PSKA 2YYZA 4HI0E 2PEZA 2QAJA 4B44A 1MOZA 4LI0A 4Q03A 4B73A 1QG4A 5AJWA 1GZSA 4TLCA 1T5LA 3RS5A 2EYUA 3GPLA 1KJWA 3D7MA 5CYOA 1DAGA 1DAFA 1BOFA 4RD4A 1Q1BA 2DR3A 1DBSA 2Y8EA 4GBMA 2ZRCA 5JJIA 1VHLA 3R8CA 2JJ1D 2BOVA 2A5YB 5ANRB 1XB2A 5E7MA 5FPSA 4A92A 4R7ZA 3UMRA 1N6PA 2GEDA 4Y0AA 5G3ZA 4OQNA 2FNAA 4W9MC 3BORA 4M1YA 2BJWA 2W0MA 3SJBA 4BUJA 3N2EA 1P61B 3NBYC 4OHVA 4PO9A 4M1TA 3KJHA 3U3KA 3ZH9B 1S9HA 4KFSA 4PSAA 3K53A 4B2IA 1FZQA 4XD7D 4G5RA 2ZJZA 4HLQB 4IOJA 3GQBA 2DYKA 4IDHA 4JLVA 1OW3B 5EXPA 1UKZA 2AD1A 4GFDA 4MRPA 1X1SA 2VHJA 4Q18A 4BZPA 2ECKA 4V0ME 5JI3E 3M4YA 3CLVA 5L3SB 3CBQA 4RCZA 5JZVA 2ZRBA 4DCUA 5CDFA 4AYTA 3GLFE 1Q21A 2JLUA 3AF3A 2QQ0A 4QNRA 3LH5A 2H92A 5DSZA 1P9NA 3A4MA 4C0QC 3BFKA 2Z6VA 4GRAA 2QMOA 4YXWD 4LK2A 5FI1B 3J81k 4A6XA 1CLUA 4F91B 2GVZC 4K46A 2G9NA 1Q0UA 4BRWA 4UXIA 2J0SA 4W5WA 2QMHA 4XSGA 2QM7A 2BKEA 1PUIA 2YOFA 4LV6A 2V6IA 3SJAA 1G3IA 4QNMA 4MRNA 4D6PA 3FFBA 1Q20A 1E2HA 5G53C 4FMDB 1DAMA 3B2EA 1NJFA 1KMHA 1Q12A 5LBIA 1Y63A 1OXTA 2EVWX 1UF9A 1AA9A 3OF5A 5J4LA 1HA3A 2A5FA 1E2GA 1NSFA 2F7SA 4P0TA 2WJYA 2VHUA 1TTTA 2ATXA 3LV8A 2AR7A 2QP4A 3QBVA 4AK9A 2EFDB 2QAGC 4JLOA 1CR1A 2IYXA 2OBLA 5TARA 1SULA 1ESMA 1SZPA 1T3SA 2XOKA 2ZR7A 3PXGA 3WY9A 2G0TA 1MV5A 1XJQA 1W36B 3BJIC 4LWZA 3B5JA 3AF4A 1DO0A 1SVOA 2CBZA 2OG2A 1UKVY 1JALA 2DFNA 3BIFA 2BMJA 1XCMA 1LS6A 3DMNA 1SVWA 1K8RA 3IILA 3VKHA 421PA 2J7PD 2QT1A 4BLOA 2ZRGA 1T8TA 1UBCA 3AP1A 2A5GA 1GILA 1A82A 2JCSA 3QXHA 5CDFE 2C95A 3OAAA 2UZ3A 2ODBA 4ZI3A 4AKEA 1SKYB 121PA 1F2UB 3HPRA 3VHXA 1E9BA 5JS7A 4DEXA 2JJ2A 5TDHA 3K0AA 4BFVA 5J4YA 1OH7A 5IF9A 4EJSC 2CXXA 1LB1B 3KL4A 2NGRA 1E2FA 1T0HB 1SXJC 3MLEA 3OFND 2F1HA 1IJEA 2FMXA 1XJ0A 3QF4B 4C0JA 5CLQA 1GKIA 4DLSA 3GLIB 2O8BA 1NJGA 4LY6A 5L3RA 1TX4B 2FN4A 4HB4A 4EPTA 2RGBA 4GP7A 3ASZA 2BIFA 3F5FA 4FMCB 3T1OA 4L15A 821PA 2O8FB 1G6HA 5FOSA 2UKDA 1JB1A 3JZMA 4EFMA 4C2UA 2LCFA 1NMZA 1Z22A 5BN5A 2GJKA 2IA5A 4ERNA 3GLFB 1XMSA 3A1VA 4FCVA 2CJWB 1EG7A 4PQYA 3KQLA 4YMVA 3SS8A 1TEXA 1KO8A 1G19A 4KLZA 2CHGA 2WIBA 1XNJA 2LWIA 5B57C 2BJVA 2FGJA 1XTQA 3WHLA 3P4XA 1KTVA 3A1WA 3GLHE 4IDPA 3G5UA 1EFUA 1E69A 1P2UA 1P75A 4OI0A 4RD3A 2OE2A 4NZYA 5DHAA 4UKDA 1E9DA 4Q4AB 4MGIR 5FL3A 3DKPA 5KOYA 4H1VA 2WJGA 1W7AA 1YU9A 3K9HA 3UXMA 4A0RA 4DT1B 2CNWD 3CRW1 5EXTA 5L8VA 1GRRA 2C9CA 4RJLA 3M6AA 1WMSA 2P6RA 1GFIA 3BAFA 1G4AE 2C98A 2IEZA 2WPDA 2QSZA 3K70C 1GTVA 2R6FA 1MABB 4E03A 1GRQA 3PUYA 5TV2A 1S3GA 5FPTA 4Q48A 3ZIAD 1K5GA 1S96A 2Q0HA 2HLDA 4EIWA 5D3MB 4XIGS 3CNLA 4A2WA 4ITRC 4BLQA 3REGA 3C14C 2X19A 3UPUA 1UJ2A 1YRAA 2ZU0C 1YZQA 1VCIA 1Z06A 2WWGA 4K8OA 3IO5A 1KO7A 1U0LA 4WW0A 2WMNB 5DI3A 1DAKA 1KKLA 2JLYA 4FWIB 1R8SA 3PEVA 2ZJOA 3I8XA 2ZVQX 1M2OB 2CMKA 2EWWA 1QZXA 2FZLA 2X8AA 3AKDA 3LD9A 4TL8A 5GJCA 3RDPA 4ZV4A 1W0KA 4PHFA 3KXLA 1L2TA 1KHTA 3GLHA 3N2IA 2P2LA 1JAIA 3GLGE 4L8GA 1KK1A 4WZ6A 3CZQA 4Q7KA 2IYZA 4POAA 2YJTD 3ZQ6A 4CT4B 4MYCA 3OEHA 3TVTA 3GCGA 3W8RA 4B3BA 4C9BA 5DO9A 2ORIA 3Q9LA 5FPHA 3V00A 4AD8A 2NO9A 4A82A 2AK3A 4AG5A 4OQLA 3UMFA 1KI7A 4IEIA 1GP2A 5IK2A 4C0BA 1YVDA 2XNSA 4FWTA 1ZNXA 2A7QA 2CDNA 4FMBB 4PX9A 3PUVA 4NONA 3RVBA 1XD9A 1AS0A 4JT2A 1FQJA 4A2PA 1A4RA 1BYIA 1Z6AA 2QROA 4B3CA 2VP5A 2IWHA 3H2YA 1AIPA 1TQDA 4PPNA 5C18A 2OO7A 4TTPA 4LJ6A 3T5DA 3LWNA 5DE3A 1G8HA 1NBMA 3RRNA 2JDIA 4LBYA 2O0KA 5IDVA 1B23P 4AC9A 1P72A 3NC1C 1E2QA 3U7GA 1KZ7B 1Q44A 4IVRA 1H8EA 2ERXA 3HU2A 4RD2A 4AYXA 1LTQA 3IIKA 2Q3HA 5DNYB 4M8NE 4DUGD 1MO5A 2DY1A 4D4JA 3SQXA 1I2MA 1OIWA 1SXJE 3NBZC 2NIPA 3W3AA 5JWHA 2BEKA 4XTCS 1Z5ZA 3T1VA 5JEEA 1XPUA 1G41A 3TRFA 2VHQA 1QHSA 1OXSC 3A4LA 2AFIE 4F92B 1S1MA 1EFRA 3ASYA 1GKYA 3W9YA 3ADCA 2Q9CA 4KODA 5KPDA 2QMUA 4DIDA 2CCJA 3SHFA 1N5JA 1NG1A 1SVMA 2ZUDA 3THXB 2BC9A 3MWYW 1LF0A 4MITA 2VRWA 2AWNA 5AJYA 1X1RA 1XD2A 2CLDX 3TIFA 4D4KA 1ELOA 2ERYA 1IM2A 4A15A 1XPOA 2Z83A 4R71A 5FR1A 5EE9A 3BRWD 3VX4A 1IBRA 2J5XA 3L82B 2HV8A 2ORVA 4Q1CA 5FBVB 5K8UA 3GFPA 3AGQA 4Q4LA 1ZW6A 4LV5B 3O8DA 2RGAA 1OV4A 2ZREA 4X8OA 5EJEA 1VYUA 1VIAA 5CB8A 3PFIA 2XZPA 4E5UA 2R8RA 2DCUA 3B1ZA 1G7RA 1SXJA 3K0CC 2NG1A 3SFZA 3PEYA 4U00A 2QGZA 4JLAA 4ESHA 2J41A 3B78A 4M1WA 1E9FA 4KYIB 4C2TA 2R62A 4HAWA 2DFTA 4H1UA 2QI9C 2JEOA 2F55A 2WWYA 5DYGA 2IS2A 1SGWA 1VYVA 4GOKA 1SHZA 1FNNA 3FMOB 3WRYC 1G5RA 5KHOC 3O8BA 1T9HA 3NXSA 2GK7A 3QKSA 4JSTA 5CB6A 1G64A 4ARZB 2QTFA 4O2LA 4I4LA 1ZUHA 4A8JC 2HEIA 4FIDA 1AN0A 4KVGA 5CM9C 4NYJR 2ONJA 2PBRA 1EWRA 1G17A 5JJKA 4XVQA 2W6IA 1G7CA 1OKKA 3CM0A 5AJZA 1TNDA 3SFVA 4BFWA 1EK0A 3OZXA 4M21A 1W0JD 3WMFA 1M6NA 2MMGA 2X2EA 4OI1A 2BBTA 3HJNA 5A4JA 1UBGA 4URWR 4MDFA 1N6HA 1ZAKA 1Q3HA 2XAUA 3HWSA 3EWAA 4P33A 2ZRFA 3TBKA 1TEVA 1X8KA 2ZU6A 3FTQA 4M9ZA 4TTQA 1R0XA 2XSZA 3HU1A 4EFLA 1G4UR 1ZNWA 3I8SA 1G20E 1R5OA 1QVRA 2ONKA 4BWYA 1YQTA 1EGAA 1GKUB 2N42A 1FP7A 3ZVMA 2DHRA 1L8QA 2ZI9A 4MDEA 2IXGA 4D0GA 5L3SA 2MMCA 3OE7D 3R9XA 5EXXA 2J7KA 2HCBA 4CT5A 4CGZA 3FHTA 4TYYA 3VKGA 4JBYA 1BMFD 1DEKA 2REBA 3R20A 4RFVA 1QHHA 1BO6A 3VU9A 3AP2A 1FL9A 4BZQA 4DDWA 1WB9A 3FMIA 4DC9A 1J90A 5FOTA 2ATVA 3UATA 4RY2A 2P65A 1US8A 1UKEA 3QXSA 1KI6B 3QOFA 2WMOB 1I4DD 3QPVA 4Q66C 2PZEA 3GFTA 4JL8A 3AUYA 2GBLC 4LJYA 1P73A 4PHGA 1D2MA 4TZ0A 1KDPA 2JATA 1P9WA 3K0FB 1G18A 1KK2A 1V43A 4UJ3A 1VTKA 3LW8A 1T91A 2CE2X 2NO0A 4NCJA 4AY2A 2VPPA 2J59A 4B35A 1KMQA 5KUTA 4DRZA 3A58B 3EPLA 1YZTA 2EW1A 4US1R 3CRRA 3TSOA 4RZXA 4BASA 1R6BX 2FF7A 1UADA 3U2QA 5KNCA 4Z8XA 4V0NA 3NBFA 4AI6A 4WIAA 4JKIA 2WTUA 1R8QA 2J0UA 4PAOA 3LQQA 5CIWA 3U3JA 4B2LA 3NHBA 4PC2A 4B74A 1NLFA 2RMKA 3RANA 3IBYA 5SZJA 5KPJA 4AURA 1E6CA 2GKSA 3M1IA 2PL3A 4KXFB 1E3MA 2CK3A 5C1BA 1OT3A 1QHGA 2FGKA 4JKYA 4CYMA 4IDNA 5KYKA 4KCGA 2J45A 4PC6A 3LO5A 1PJRA 3CX7A 5E95A 1VCNA 3OIVA 1YE8A 4RSGA 1AK2A 2IHBA 4OK5A 2NZJA 1X8LA 1ZM9A 1KDTA 1YZNA 1MR3F 3K09A 3PVSA 1R0YA 5KSPA 3QQ5A 2QUZA 4JLMA 4YXWA 5IHPA 3CZPA 3QF4A 4DSNA 2NTYC 3BH6A 4QKQA 2IUSA 1KSFX 2P6UA 3GLFA 3BK7A 1IN7A 2ZIAA 1E2EA 3GJ4A 3CF6R 1HE8B 1JXMA 2FX3A 4ACBA 4YC7A 4MKGA 2NOAA 3UWKA 1JBKA 3C15C 4MGZR 1U8AA 4Q4HB 5DI9A 3W6PA 3QXCA 1L4YA 2FWRA 2A2ZA 2GVDC 4NCIA 2X2FA 3K9GA 1CJVC 3AM1A 2AXPA 4BFTA 3W5JA 3BH7A 3DHWC 3VNUA 2ZSFA 4C30A 1QF9A 1CULC 2QNRA 1DAHA 1M1YE 2AXNA 2GCPA 2KB0A 3QE0A 1Z2CA 3CPHA 2WOOA 5E3HA 3LX8A 5AUOB 4L9SA 2ZEJA 4KJZA 1E0SA 2V54A 2OESA 3Q5DA 4FMDF 3ZD7A 2CL6X 4TYNA 2VH5R 2ZSAA 2BMEA 3CH4B 2ZE5A 3SC3A 4JYBA 2B8TA 3PCRB 3Q8XB 2GAAA 1MABA 4UQOA 3OHMA 2H17A 1NN1A 3Q5EA 1RFLA 4M1OA 4F4JA 3CO5A 4JZKA 2Q9AA 4BEJA 4OYHA 3LFUA 2WAYA 3GLGA 3TGPA 4JSYA 2XXAB 2ZJ2A 4XJXA 1D2EA 4BLRA 1NN0A 3PITA 1HTWA 4M1SA 2IYWA 3BFVA 1QHXA 1EFTA 3OAAD 4PZYA 4B6EA 4KI0A 4I81A 5DGXA 4DDTA 1CJTC 2D2EA 4LGMA 4NH0A 5CJPA 3I73A 2R65A 4OK6A 4QJ3A 4Q21A 2FE4A 3NWJA 3NTUA 1AZTA 4A0HA 3OIWA 3CIOA 3W8NA 5EUQB 2OCPA 1RRFA 2Z4RA 5CYPA 2WBLC 3K0EA 2JLRA 2NMVA 4HAZA 1P2SA 3OFNA 2VP2A 3TAUA 5FUXA 2O8FA 1S4QA 2G77B 3ICEA 2GXSA 3E70C 1XP8A 2ZRKA 4BLSA 2YZ2A 5JRZA 1JJVA 5EP4A 1J8MF 5GJVC 2PJRA 3P32A 4ARZA 1XEXA 4JVNA 5JWRA 2CL7X 2DBYA 1AS3A 1YHNA 2ZETA 2ZR9A 1E0JA 1FMJA 4JBWA 4HUQA 2F9MA 4BE7B 2Z0MA 3MUFA 3QXXA 4HDQB 5FBWB 5FTNA 1ZCBA 4PFSA 4BGDA 4RCYA 4DDVA 3EWSA 1P9RA 3LQRA 2FOLA 3IBGA 2QQEA 1PLJA 4Z54A 2ANBA 3QF7A 2ZJYA 5LDDC 1KI6A 3NHAA 1FQKA 1NSTA 3ZZUA 3U3RA 2Q21A 5JEDA 1CR4A 5FTKA 3ZLJA 2BDTA 3SBEA 2Q6TA 1QHHB 3VU9B 1LVGA 1RJ9A 4KAXA 2JIZD 1ONBA 1XCPA 3H1TA 3ZGXA 4F7WA 3ZVNA 3U7EB 1M34E 3TQCA 4G5GA 2W2TA 8OHMA 1XZPA 1Z08A 1E1QD 2YWEA 5TB5A 1S9DA 2J1LA 3PIRA 3RHFA 1I4TD 4W5HA 1F6BA 4UNNA 3F8TA 2XGJA 4URXR 2VP9A 2HXSA 2ZRLA 3SDZA 3O8CA 3C16C 4I1SA 1E2LA 1S1CA 2GJAA 2D7CA 4A2QA 1IXSB 1ZCAA 2JJ8A 3B7GA 1CS4C 1W47A 3B8HA 3GJ7A 3LVRE 4WA7A 1W0KD 2V55B 4G3XA 2BM1A 3F0TA 5FBRB 3HU3A 2JLZA 2AD5A 3U44A 2BBWA 2P5SA 4MKIA 4ZDJA 3ZVLA 4GOXA 3NEYA 1XTRA 4TMZA 2E1RA 5KNDA 3GD7A 1CTQA 4OHZA 4A6PA 4CF7A 3FE2A 3GJ3A 1QHNA 3SBDA 4GPTA 4LHWA 5FUYA 3ADKA 3A1SA 4B33A 1G1MA 1SXJB 3GJ0A 2J0VA 2WKQA 4US0R 4RD6A 5F9FA 1ZRHA 4AKGA 3QNUA 1YJ5A 3V4FA 4GL2A 4TT3A 5IK2D 3CKLA 1YR6A 4L9WA 2FFQA 1WE2A 1A1VA 2B8WA 1KK3A 3NBXX 4GI7A 4R2IA 4WVFA 2KJQA 2NQ2C 3ECCA 4FINA 4PQFA 1W4BA 4U7DA 3NKVA 1KI3A 4R9UC 1RC8A 4KFUA 2QTHA 1EX7A 2H5EA 4HYYA 1PV4A 3DZDA 3I62A 1WCV1 1W2HA 3VR3A 3RS4A 3W90A 1NI3A 3DO6A 3PEUA 2YNMA 1II8A 4ASUD 5GVSA 3DZ8A 2ZSBA 1E0AA 1KI9A 1H8ED 1RW4A 2ZITA 4LJ4A 3RNLA 2IYVA 1Z0IA 2I4IA 2EFEB 1E2IA 2ZROA 2X1VA 3IHWA 4PXAA 3I61A 4URYR 3AF2A 3U60B 4EQ6A 3IO3A 4DSTA 4XSHA 4HLUA 3WBKA 1HQYE 1NKTA 1F2UA 5HKKA 5TXGA 1X6VA 2IBMA 4B2PA 1P2TA 5AWFC 2QTVB 4D2IA 2IS4A 4G5QA 4D26A 1KDOA 4D4LA 1FX0B 3I92A 4D80A 1F60A 4KITB 1GM5A 2IHYA 2OHFA 2WSSD 4MRVA 2QRNA 1RRPA 1TQ6A 5FBQB 2O8DB 1DVRA 2BWJA 2ZI6A 1TAGA 2OXCA 1J8YF 2WSMA 4R98A 1NVUQ 3CRQA 2DWQA 1XFAA 3EPJA 2A5JA 2RHMA 4TLAA 4TWZA 1XX6A 3EPKA 2GF0A 4PPFA 2VTKA 4HUTA 1N5LA 1CR2A 3EARA 2JLSA 2VSFA 4DB2A 1SXJD 4YMTA 2GWHA 1COWD 1FPMA 2OFXA 2MSDB 3PJRA 2IC5A 1DELA 1VCMA 4TZ6A 4C0LA 5FI0B 3WNDA 5B64A 5TMPA 1IXZA 2DPXA 3VMFA 3K0SA 4PHHA 4EPRA 5H1YA 3B82A 1KJZA 2XX3A 3BB3A 1WBBA 2W6JD 2QPAA 1WDTA 5DLQC 2EU8A 2ZAOA 5J4KA 3QKRB 2ZRHA 2IF2A 1IONA 1ZU4A 2GRJA 2ZE7A 4BQSA 4PANA 1T0JB 5J4HA 1UKYA 4U02A 1KOFA 3QUSA 3I3SR 2ZSEA 4O2RA 1KSHA 1YZGA 3KFXA 5FTLA 1W1WA 1OKKD 4C7OA 2AK2A 3TW8B 2GHIA 1GVNB 3KJEA 4OQFA 2H18A 4YMSA 5ELXA 4NP6A 2O0JA 3CF2A 3BBPA 1VG9B 1ZNZA 1KZGB 3C4JA 2QPOA 2GETA 2NZ8A 1U94A 1KGDA 4V0KA 4V0LA 3WNCA 1MO3A 1UM8A 3A8TA 5FH9A 2XSZD 4I1UA 4IVPA 4IHQA 3T12A 1IJFA 2WHXA 4LJ7A 3X1ZA 2O8EB 4PAQA 1HEIA 4ZI2A 3NDBB 1MH1A 4MRRA 5HR5A 3TMKA 3DVLA 5A5GA 2D3WA 4XOIA 3EC2A 1RZ3A 4RZ3A 1U9IC 2PLRA 3RYTC 4MYHA 3KQUA 3O8RA 3Q72A 4GMXA 1E9SA 1BMFA 1I2DA 1XJCA 2O8CA 1Z28A 4HSEA 4XD7A 1HT1E 1JECA 2WAXA 1Z83A 2WICA 4V02A 3BD9A 3EG5A 3FWYA 1Z8FA 2ANCA 1VDZA 2W58A 1UBFA 1O87A 4LYFA 3ND8A 1TF2A 3N5CA 1P6XA 4ZDKA 1M8PA 1UEIA 3IQWA 4Q9HA 4BFZA 4DVGA 2ODWA 2REOA 4Z51A 5F3WB 4LJAA 2GZDA 4YDSA 4PQRA 4X8HA 1JPNA 1J70A 2XXAA 1AGRA 1KI4A 3QKSB 4HZIA 4ZDIA 3WRXC 4DHEA 4G5SA 3VAAA 3IPYA 1H65A 5G40A 1CU1A 3LXXA 1QVAA 1BYUA 4M53A 2RAPA 1XF9A 3UG6A 3U44B 2WJVA 3S1AA 1NIPA 2HT6A 1DE0A 1SKYE 1ZC4A 3EIEA 3K09C 4NDZA 1R7RA 3PV0A 2Q9BA 521PA 4AKHA 4OQMA 1G8YA 2GEVA 2D2FA 2IYLD 3KX2A 4LOAA 1NBME 4IOMA 5AUPB 2CHQA 2NPFA 3WYGA 3QVVA 1S2MA 1J2JA 4WBSA 4NYIQ 1XXHA 4UJ5A 2P6NA 2JA1A 4P4TA 4FI3C 4EPXA 1JR3A 1C4OA 3SHWA 5BWMA 4Q4HA 4DXAA 1FP6A 2FSIA 3LXRA 4XVUA 1XZQA 4WZBE 1KJYA 4GDFA 2WWHA 3AKEA 4WZAE 4LPSA 1E2JA 3EIHA 3K0CA 2FPLA 3LW7A 2WWFA 2ZJAA 2J46A 1NNEA 3SE0A 2Q3MA 1P7CA 5C46F 2VHCA 3IQXA 1XTKA 3ETLA 1DG1G 2RGEA 1IAQA 3LAWA 3K1JA 3AQ4A 3HR7A 1HH4A 3TSZA 3GFOA 2P67A 4NPHA 1F48A 1JPJA 4IFBA 5JI2E 3U61B 1GL7A 2A5DA 1LS1A 1NMYA 2A3RA 3C5CA 2QAGB 3SYLA 4PAMA 4N3NA 1E1RD 3AUXA 3K9LA 3LRPA 3TE6A 3ADBA 5LB4A 3IIJA 1RRGA 1U8YA 3CX8A 1ZBDA 4HDOB 5C4MA 4PC7A 3BGWA 2BHRA 2JLXA 2PZFA 3RSOA 3TUJC 3VR5A 5TY0A 2BEJA 1CIPA 5J40A 5SZHB 4C0KA 3U4QB 3AVOA 3F3YA 4CIDA 4XWAA 3BOSA 2B21A 3I5YA 1NVWQ 4LPKA 1JJ7A 3QY0A 3GLGB 3KFVA 1U8ZA 5BN3A 1DAEA 2EFCB 4IJMA 3CWZA 4NMMA 1ZM2A 1JEDA 2WKPA 3RLFA 4AYWA 2YVUA 5B2ZA 3KZ1E 3AVPA 2QN6A 3B13B 3ONWA 2YC4C 3FPAA 4RFSB 4DEYA 1TUEA 1V5WA 2AL7A 3SNHA 4TYQA 1D2NA 2OLKA 4HLDA 5JS8A 3B9QA 3AF0A 3VR1A 1YKSA 3W6NA 2V3CC 2JLWA 4KBFA 2VBCA 3CF0A 3UKDA 4C3ZA 4F93B 4FD2A 3TQFA 5JCZA 2Z4SA 1HY3A 4CEJA 4FCWA 5AUQA 3OEED 4LZZA 3B1VA 2IYQA 3BB4A 5L3QA 1OSNA 2HF8A 4H9GA 4LC0A 2JLVA 1W4AA 4JLNA 1T4GA 4N1AA 5C2JB 1QBKC 1VG1A 2FFHA 5FOXA 1I4LD 4E22A 2AWOA 3VHLB 2ZJ8A 4B3DA 3U7HB 1OXUA 1S8FA 4QBHA 1LW7A 2HLDD 3SI7A 3LNCA 1FMLA 5EE0A 4BFUA 1XPRA 1PVOA 4ACAA 3A4NA 1X86B 3GMTA 1Z2AA 3W34A 1IN4A 2AN9A 5FBLB 5KDLA 1HV8A 3A1UA 1VKJA 4ILEA 1ZMXA 4K81B 4TN1A 2O8EA 1ZM3A 1OFHA 3EZFA 3K8YA 2MSCB 1C9KA 3ZVRA 4TTRA 2BKUA 2ZE6A 1TF7A 1Z0DA 2XNDA 3PR1A 1OXVA 5SZKB 3TJZA 3PEWA 3VX3A 1AKYA 4A36A 3IHLA 2OILA 3IDQA 1KSJA 1II9A 3RAPR 3ZJYA 4NYJQ 4MUAA 2XZLA 1E9AA 3TLXA 1FFHA 1N25A 3G82C 2OLJA 4HAVA 1UDXA 3IUYA 4JJZA 3R7WB 1MRNA 4NYMQ 3IGFA 3SJCA 2WJHA 1NN5A 1TPZA 2PT5A 3DKVA 4JLJA 3AVXA 1CKEA 1RVDA 2G0NA 3MWLA 2XTZA 4LYJA 3QPWA 4IKEA 5FL7A 2QT0A 4HLUC 2IW3A 4P31A 4IDQA 3PUWA 3KKOA 5GJWC 3KQHA 4HB0A 2B92A 2WIAA 4DSOA 2GTPA 1E1QA 2V1XA 4S35A 4OI2A 3R9IA 2CVHA 5LB2A 1OIVA 1GAJA 1AM4D 1CP2A 2IS1A 1GIAA 1P5ZB 1SQ5A 2QMEA 5AUNB 5DN6D 4DZZA 5LD2C 1Z47A 1WA5A 3IIMA 3C5HA 3CX6A 1M7GA 4Q47A 2QL6A 4QOSA 2F1JA 3R9WA 4O25A 1ZC3A 4PC3A 4QGFA 4DUGA 4LYAA 1FOEB 2ZE8A 1TQ2A 1K6MA 2DFKB 3EA0A 3EIQA 1ZD1A 3L0IB 4JVMA 1T3LA 2QSYA 4TQUS 5H70A 5JWOA 3WBJA 1JR3E 4W7SA 2DWPA 1KO4A 3PUXA 1EFRD 1ESNA 2D4HA 4QJ5A 3WMEA 3U7FB 1E79D 2V7QA 1ODFA 3FHOA 3DM9B 5CLLA 1NP6A 3RABA 4KFRA 4V0MA 3I5XA 4EQ6B 5G41A 5J47A 1Q1EA 4RKEA 1NKSA 2EFGA 4NCHA 4OL0A 2OV2A 4Q4JA 5AR1A 2ZQ5A 1ZUIA 3WP0A
chains in the Genus database with same CATH superfamily
4Q02A 3KUUA 4AJKA 4B3JA 4QBIA 4EY8A 3PIIA 5H5JA 1W4ZA 2P1RA 2XGGA 1IUOA 2Y2VA 4OFWA 1IPFA 4HRXA 5EQTA 3BRWA 3JQDA 1UIRA 1MX5A 3BMQB 1W5TA 4DBVO 4QUIA 2Z5GA 4B3XA 2GPSA 2WMYA 3EOZA 1RJWA 4JITA 4D25A 1MB4A 3UYKA 2CDBA 5F2EA 3CW2A 3DPUA 5JD4A 2BFPA 3MCUA 1JEJA 1W48A 2AFHE 3THXA 4HADA 1AC5A 2DR2A 2NW6A 2FJUA 2QD1A 2RJNA 2VPTA 4GP6A 4DC1A 4IEFB 1DT3A 3D8BA 3GJ6A 3PTLA 4LHVA 3SQOA 3OMWA 2A6PA 1DJQA 2MYNA 3DGFC 3E5HA 3O90A 3UV7A 4ARUA 2QTAA 3N0WA 1N6IA 1YZYA 5ALTA 1KSGA 3IVXA 1JZTA 1IBLB 1XZHA 1C7FA 2P0EA 1Y81A 4RFSA 1U6JA 4BX9A 7ABPA 4P7JA 4OSPA 3UCFA 1PGNA 3ZWPA 2VJAA 3WQRA 4IH9A 5IEBA 3EC7A 3RSQA 3I4LA 3BMNA 3V1LA 4CKBA 5DM2A 2ZCUA 2OA0A 4AZ0A 3BHNA 3MJ4A 1N9GA 4AMZA 3B1XA 3MJRA 5JO0A 1TD9A 3EFHA 1H3EA 1GNLA 2NO7A 4RMIA 1A9PA 2B4QA 3WFZA 5C7OO 5JYDA 1YNSA 1L5FA 4M9QA 4X3OA 2XIQA 1BS2A 5CU7A 2UXDB 1VL6A 2LUOA 1CJBA 3DWIA 5TMBA 4DUPA 1DWUA 1EFDN 1ODKA 3GD5A 4EG4A 4IX1A 5I5GA 4KP7A 4W9NA 1XO1A 1E1KA 3T5PA 1K1EA 1QIFA 1F4LA 1QGED 1XLUA 1Y98A 2JLBA 3F5SA 3LDGA 3NTXA 4KN5A 3LPCA 2HF9A 4HN2A 4KWEA 2NT3A 5T41A 3F96A 1E6EA 1K63A 1AX9A 1ND5A 1VP9A 2VC2B 2V4MA 4MIYA 4JGBA 5G0SA 5JSKA 2OFPA 2YBDA 3Q98A 2FWMX 2V98A 1RJFA 4HCJA 4PR0A 5KQLA 1DX9A 1T1EA 2GBLA 3KVRA 3NIFB 4PYMA 4DPMA 3G8BA 4QFBA 4WKNA 5AK0A 5KAPA 2FK8A 2HF7A 4YCLA 4DLWA 3ORFA 4IYRA 2EJCA 2HDHA 4EVQA 4HVTA 3H4MA 2VPIA 3FPCA 3I9KA 5T67A 3K35A 1QH0A 3FN4A 1DC4A 4PR3A 3R5XA 4HGQA 4LHYA 3OIDA 2GXQA 4U9HS 4D92A 1VFPA 1YZLA 2H7YA 1EKXA 3ANSA 4FLEA 2YR0A 4IQFA 4MQ5A 3IQEA 2C61A 2PZLA 4S24A 4TROA 2ID7A 3D2CA 5BSMA 2QVLA 5EP1A 1SCNE 4YJ2F 1N7HA 5JYBA 5T3YA 4TQGA 4X1IA 3N70A 2I1WA 5THKA 1LUAA 5D00A 3OCJA 4P4SB 4L78A 3ZJ4A 1U90A 2ZKIA 3H6KA 1LPMA 4ZOLF 1LSSA 3N0RA 4N3AA 5DTMA 3OZBA 1D8TA 2MSNA 5REQA 5L9AA 4AJPA 4CDRA 2QIOA 4X90A 1SBHA 1LVHA 1ZD5A 2MR6A 2UVQA 5KINB 4C43A 4OJQA 3LDAA 1GNPA 2WIKA 4MUXA 4A8JB 3ICQB 5D84A 1YI8A 3T34A 1E2DA 3I01A 1R4AA 1RHJA 1BWQA 1N5IA 1PF7E 3IIIA 4FDTA 4K6MA 4MEAA 4UTVA 1MEEA 1QX3A 2IL1A 1IZ0A 1F12A 2OM6A 2VJCA 3HVIA 4X45A 1WVGA 1ZCFA 1X80B 3ORRA 4GOJA 1JG3A 5CXUA 2KPOA 5CFPA 1SPBS 3OLQA 3VQTA 4ID3A 2J30A 3QK7A 4QFMA 2JNWA 4KYTA 3TLCA 1X9GA 2O1EA 5GJBA 4E51A 4A1FA 3KR9A 4OOEA 3J81A 2PWYA 2XMZA 1C8BA 2B35A 2Q4RA 3ZCXA 1MUUA 4RXTA 2PWAA 3EBOA 4JIGA 5T7BA 3OJEA 4JBGA 3L1IA 5FLEX 4G4IA 4ND6A 4OHUA 1MJNA 2Q3JA 1TU4A 2WKRA 5ALKA 1FFSA 4HD8A 5KYXB 4CU5A 4GR9A 2VF5X 4D0RA 1VL8A 3DMGA 1N5MA 3G3EA 4AUEA 3QU2A 5LZ5A 1D1PA 1C3JA 2AKAB 2Q41A 4TZTA 2CVFA 1PUJA 1IN6A 1YL7A 2K6GA 4Q3KA 4TM7A 2QVGA 1D4ZA 1YXMA 3HXLA 5IMSA 3IT0A 1GUDA 4HB3A 2YL2A 4LC1A 4LSZA 1FTSA 3PFNA 3V32A 1JHAA 4QHSA 2WOJA 4ZKDA 1W1IA 2ZJ0A 4G67A 1RD4A 5G0UA 2ZJFA 3BGIA 621PA 2H16A 1V8BA 3QTTA 3HYSA 3GELA 4ENPA 3FSEA 1BJRE 1U0NA 4HZUA 4I19A 3K0BA 4ZDWA 3WWPA 4D82A 1K27A 2Z5FA 2XUDA 1B6GA 1E2UA 1PZNA 4JUIA 4EK9A 2BFBA 2I3AA 2R9VA 1YA8A 2XTJA 1USWA 1ESCA 2ZJBA 1ORRA 3GN2A 3ZWMA 4NEQA 3OKPA 2IZ5A 1E7WA 1H6CA 2RH9B 2FVXA 3FW1A 3IJ5A 4IJWA 4DRYA 1IBMB 1PJ4A 4A9AA 2IYAA 1M3SA 1CRLA 4JFAA 4M9XA 3CUUA 3MF4A 4FNAA 2A30A 5EJFA 4G1UC 2Z98A 4HJXA 5GGYA 5MFZA 4MW5A 4MIKA 2CKMA 4FR5A 5BUQA 3H16A 1YDEA 1UXJA 1P7PA 5I4IA 2RB4A 2X9NA 3HB5X 4EO4A 1ZISA 1O4VA 5CEJA 5BR8B 1A88A 2B0CA 2D6FA 4CKYA 4PFJA 5I8PA 1Y3BE 1FYVA 1CRQA 2GCOB 4J4BA 3ENWA 3ITEA 2HF2A 4CDNA 4XA8A 4K9LA 4N0PA 2VUSA 1A2QA 4URZR 5TX7A 2H0QA 5A4AA 3HXKA 1EUQA 2DXIA 5I51A 4IOKA 4I50F 1NVEA 2HDNB 5MN4A 5I9IA 2WRZA 4BS9A 3LBFA 2ZXFA 3CRVA 2GRUA 4YJ3B 1YK0A 1UC9A 1W59A 2HDOA 2YCBA 4OHRA 4UHDA 5DK4A 5JMTA 3E61A 1JQJC 2W2NA 1OHHD 3SX0A 2YHSA 1Z3IX 3LE8A 4QL3A 4GXRA 4MUNA 3VO8A 3A04A 5TR9A 2IUUA 4BVKA 5ER9A 3TNFA 4BTLA 1FTYA 1WCWA 3NANA 3W6UA 5H8WA 1OZAA 3DL7A 4YPVA 3WLHA 1GCAA 3FYUC 4PX3A 2OG1A 1N2EA 4O0MA 3SKXA 5CBPB 3AUUA 3B9PA 1R0SA 1M2KA 1PYGA 2XMSA 5MHTA 2ZRNA 2DEUA 5FR2A 4TMFA 1CS0B 1PW7A 2GAFA 4E30A 1RU3A 4PZZA 4D8YA 2XMCA 3ETDA 5LMCA 4JZYA 4KK3A 5T4FA 5JHGB 1C1XB 4OLFA 4A3SA 2Q2OA 2R7MA 2HC9A 3FCEA 4BO1A 4BYMA 1NZJA 3UJDA 3WL6A 3RB8A 4DA8A 2A4MA 4OHYA 3F6PA 5C7LO 4K3UA 3CEAA 2INGX 2H0RA 4FGWA 2E87A 5EHGA 3GJXC 3I6ZA 5FYDA 4CM7A 3FCYA 4DZRA 1KH2A 1SKMA 2YS7A 5REQB 3T3MB 2BTQB 1T2VA 3DL0A 3O47A 4MW0A 5TQ0B 3Q41A 5KKAA 5CCEA 3KKNA 4V2UA 4FDLA 4NKRA 3OH8A 4K7JA 3UJ6A 3VR2D 3WGGA 1XWWA 2DJ5A 2ZWVA 4Q7EA 4E6EA 1X7HA 3N9IA 2HBZA 2O5CA 1L5LA 4BMCA 1PG5A 1WP9A 1A4UA 1YNOA 4KQFA 4EECA 4H7KA 3IP1A 2GAJA 4F5ZA 1ZCJA 2OMKA 5F98A 1IDOA 1J99A 1OXBB 3I2JA 4N5HX 1ZNYA 2PLFA 4Q9IA 1E64A 1X0VA 1RPZA 1E4VA 8ADHA 3DFFA 4HR7A 4FYJA 4TTSA 5T57A 4YPFA 3UMJA 1ULAA 3ZE7A 4B6RA 4P54A 2HNKA 1DRJA 3PQ4A 3BD8A 3OC0A 4K6GA 5JBNA 2JRLA 4IX9A 1J2EA 3KJQA 2DQSA 1E3LA 3RVMA 1XZNA 2PCLA 1T36B 2PEYA 1Q0QA 1NZDA 1LTKA 4NAUA 4MKXA 2YKGA 2P2SA 3UK1A 4CKCA 4WK4B 3TTYA 1EA7A 3I2GA 4YMGA 4MYDA 1H8HA 2AFIA 1TU3A 5F5XA 2IBSA 1GQYA 5ADWA 1J6UA 1KY3A 3MZ0A 3L84A 1O5OA 1YRLA 4MUIA 3EK2A 3PKIA 4MUJA 3JQ8B 2O07A 4TKMA 2IWRA 2C5FA 4A10A 4C87A 2EKDA 1PJZA 4RGQA 4QYSA 1GQ2A 1YD7A 4Z4EA 1M7HA 1WF3A 2OKGA 2R5WA 3RBAA 4UXJA 4BLTA 1ZJYA 1ZVKA 3DTNA 2PMDA 2QP9X 4LDJA 3ZHXA 4PLCA 3WLFA 3R5SA 5BN1A 2AV6A 3WLNA 3AZPA 4QTZA 3UAWA 3EQZA 3T3OA 2RIRA 3ZBPA 1W30A 1T3GA 3AYZB 1BDIA 2FF5A 3R7WA 1LPSA 2ESRA 2G09A 1LBQA 2N46A 5COQA 1PFUA 3HCEA 2X13A 4L5BA 3LLSA 2G83A 2H8KA 3TLAA 4BYGA 5DDIP 5BVHB 1GQFA 1MB3A 4O4HA 4RZSA 2Y1CA 3QVGB 3TL6A 1G3QA 4S3MA 4JGIA 3W2IA 5KWVA 2VFAA 3T35A 3ADDA 1JUDA 1MC8A 1T8WA 1ZYUA 2D0IA 1KYWA 1QGYA 2X2PA 3CEPB 3VPCA 1SD1A 5BO5A 3G6WA 1F7UA 3RS2A 2HPHA 5ENVA 1P45A 1U2SA 5DCUA 1P3Y1 1UZMA 3H11A 1T2NA 1OLOA 2O2SA 3KKQA 4EAQA 3AKYA 2XTNA 3FGNA 5IJXA 3ZCSA 4BXOB 1G21E 4DBLE 4TXLA 1WZEA 5GM1A 2KSQA 4BLPA 4EGFA 2GILA 3C6YA 3A9VA 3OJFA 2WWWA 3OIYA 2QJRA 1XYVA 2BBSA 1CP3A 4JR1A 2JFUA 4BGEA 4EEZA 1RWOA 3SSNA 3VJKA 5KSYA 1E4YA 3PHJA 1CB7A 4QO7A 4REOA 1KI2A 4UVGA 1HOXA 4EPWA 1Z0SA 3F3KA 1TRHA 3REFA 1GY8A 1HT2E 1GRCA 1KJNA 2R2AA 4MS1A 2BMAA 2WA1A 1N2SA 3EQ2A 4N0QA 5LYJF 3FMFA 1K7XB 2PV0A 2PZMA 2HN9A 4HZGA 2C2ZA 1JFLA 3PBKA 3W4JA 1XMJA 4J76A 2AZ4A 4NATA 1U98A 1EVLA 1UBSB 1VMAA 2C9OA 3PXXA 4HYEA 2Z6QA 2XA9A 3KKMA 5DB4A 5FTJA 4ASUA 1XCBA 1C29B 2F62A 3ETHA 1N0UA 4G07A 5B37A 2QL5A 1B4DA 1FDSA 4WZZA 3KU1A 4ZN6A 4HDCA 1AKRA 3DM5A 2R7KA 3Q0TA 4UMVA 2GM5A 1RMYA 4AFNA 5WRFA 1U1CA 3AV0B 5I4BA 4KE6A 4WLUA 3GWZA 2WM2A 4Z6KA 4F45A 1TZ2A 4MWBA 1XZKA 4XM1A 1F8GA 1H9CA 1II0A 2X76A 4FGJA 3B53X 5IDXA 1L7RA 1RE0A 2PMKA 2BTOA 1NVVQ 3KDPA 4G01B 4HZUB 4MMYB 5AQEA 5GGXA 4HN9A 4IEEA 1II8B 2XCOA 4UM7A 4IXNA 5CYGA 2DERA 2J0EA 1SR8A 2XKJE 4FYYA 2V7QD 1QM5A 4AP6A 2H4HA 3RQSA 4CEIA 1E1MA 2EWVA 1QRAA 2H57A 3R0ZA 5IU6A 1VCOA 1LNZA 2FRVA 2G36A 4LJ9A 2IUEA 3E5RA 5U4XA 4C5AA 5CDYA 3QKTA 1QJ4A 2QP3A 4LY9A 4J0EA 1T4DA 2Y9MB 1WHSB 1XHFA 5C4GB 1KXZA 5H02A 4L74A 4BFCA 1A5TA 2WTNA 1U3VA 5GADl 2BFEB 4NJOA 5FPKA 3DWEX 3P9KA 3WKAA 3AY6A 1QO0D 1GUAA 2RHGB 4BKQA 3BSWA 4R68A 2PY6A 4D3FA 4HDMA 1HE3A 3JQEA 2B8JA 3AWIA 3BGSA 1WW2A 3ZUPA 5FBVB 1U2DA 3DXFA 2FPKA 1U3CA 3IKLA 3KUCA 2J9ZB 3I6MA 3QEJA 4KLNA 5YASA 4LEIA 1ZLYA 3WLOA 4Y2PA 4WXPA 1SCBA 3KKPA 1LSUA 1KI8A 5JSZB 4P3YA 3RRYA 4QTTB 1GR1A 4RK1A 3IB6A 3PPXA 1Z0FA 3F46A 1Y1RA 1GT6A 5FBZA 2IIVA 4H4CA 4RADA 5FHRA 5LOVA 4C03A 3GEHA 4MROA 3OJ0A 2C5AA 2O3TA 4EELA 4JS0A 2P30A 1EUDB 1Z4PX 1GZDA 2PAAA 1QCZA 3JS5A 4HAOA 4J2HA 5EJ2A 5IC6A 4ESHA 3M9WA 2IH2A 3AW8A 3BGDA 1YJAA 2OORC 2I1VB 3A37A 3QWAA 2PGAA 3NTVA 4GI2A 1LTHR 5F4ZA 2H9YA 4HNRA 2V7BA 3QFCA 3L0CA 1ZMOA 4MWEA 1REQB 2BV3A 4HRVA 3VTFA 1FW8A 1YTUA 4F46A 4MI3A 4D0LB 3ZU6A 2XQKA 1XV5A 1T3HA 4C3UA 5DV9A 2CXRA 2XLCA 2HIHA 4TKVA 4GWKA 4YHHB 4QDTA 5AI8A 1V8PA 1ZUNA 1BKYA 2EFYA 2FRDC 3DLTA 3Q3JB 3VAYA 4BN4A 4LW8A 1Y7TA 1BX0A 1BH2A 1E5DA 1MIHA 3A26A 1JIJA 2YWJA 3JQ7A 1ABFA 4LXTA 5CYFA 1IN5A 3B9RA 1GDHA 1IPHA 1YQDA 4OQEA 3K72B 2J3JA 3DUFB 6GPBA 5KOIA 2WTAA 3CNBA 5L3QB 3B6KA 1ZJJA 4NE9A 3LRTA 2QM3A 4K2AA 2DU8A 3KL2A 1HDZA 2C4VA 4UNPA 3C1TA 1XRJA 1JZSA 2PSJA 4LCJA 2NXJA 3OTHA 4RHUA 2OM2A 4UUMA 4LRWA 5G3YA 5KAMA 3IJRA 4ND3A 3IMEA 5CK5A 4DLRA 5JSZA 3SFTA 1M2VB 4E07A 1JU3A 1F0KA 3FYUA 3BAZA 3JXEA 1KI1A 1FDUA 4BIMA 5EQFA 4P35A 1QVVA 3KVYA 1LQTA 5EIWA 3EHDA 4Y2QA 3S4YA 3L43A 4HUQB 3G8YA 3LF2A 3EQ8A 3QBTA 1YIOA 2HK7A 4B43A 4TXMA 2EBWA 2YXPX 5EMNA 3V34A 3GG2A 3VR6A 2C3OA 1OPXA 2GA8A 2PR2A 2AJBA 4R3WA 3NTRA 4JL6A 3RS3A 4FDVA 1D0IA 1MXFA 4K3VA 4DBZA 3I9V6 2HDWA 2IVZA 2C2OA 1HE1C 1APBA 1HNWB 4WZBA 5BYAA 1IBSA 4YCMA 5AVYA 1LK7A 1BS9A 5JASA 1KP2A 2Z08A 3OMLA 4AZ0B 1EB9A 1LH0A 5A02A 2B5OA 3VNVA 1VSTA 1MIOB 2HFJA 1ISIA 3N39C 1KA9H 4FXPA 2EQBA 2H1VA 1GPH1 1NVTA 2QU7A 3EZ6A 1CYEA 1TA4A 3IODA 3R0JA 1BRMA 4LRUA 3WYDA 1TUGA 1MAVA 4G86A 2G1AA 3JVVA 3OEWA 3PKZA 3IFSA 4X94A 2XCRB 4QQ8A 1G21B 2ZBVA 1PK7A 1IOVA 1BDMA 2VA8A 3T5CA 3ROZA 3WP1B 1E3IA 5JS6A 2WZQA 3FOWA 3T1TA 1GWNA 4Y2XA 3TJMA 3HZOA 2KBFA 1PKXA 1A8HA 2BONA 2VSXA 4ESOA 4DRXA 2V9PA 4BBPA 4KPFC 4Q3OA 5JQGF 1Z2OX 1Z0AA 3VTAA 3WTCA 5I47A 3AOEC 3P2YA 5D3QA 2R5NA 5DFAA 3VYUB 1YRYE 3HL4A 4XIJA 2W0SA 2XXJA 1RXIA 1WNTA 4NBUA 3RJMA 2DUJA 1O6FA 2QX8A 2VEDA 2Z09A 4ZVNA 3EGXB 1LNSA 3ER9A 3LRXA 1Y89A 3LQKA 1KAGA 4OH1A 5ALGA 1RJEA 2QLJA 2ZIEA 3GJ5A 3L8CA 5FUWA 4M0UA 2QN3A 3LBHA 3U3DA 4TWBA 1NXSA 3M8KA 3QOYA 1U1GA 4HH1A 1DQRA 4RF4A 4J6EA 3AMVA 4I1OA 3K31A 4EVRA 4PYKA 1Q14A 3FYCA 4R81A 3OIFA 3W1WA 3WXBA 2G0AA 3G79A 4E2ZA 1VLLA 2ZTUA 3B6MA 2PKQP 1IUKA 5IJZA 4D5EA 1WBDA 4MHTA 1KR2A 2ZS9A 4FSXA 2GYWA 3TEFA 1YKFA 1O95C 2CL0X 1AXGA 4Q12A 4AF7A 5BORA 1OZGA 3FFAA 2BN4A 3EZ7A 2ACVA 2QG4A 1FDOA 5A1JA 5JNUA 4L75A 4NV1A 1AHHA 4IGKA 2J5RA 1L5SA 3OOHA 3GVXA 4KDCA 3O8QA 4KMSA 1MAAA 4AIIA 2ZUEA 2QG6A 2XMBA 3E9ZA 5HUQA 1L4NA 5HYVA 1Z2DA 1TKBA 2B6NA 1JB9A 3KHSA 1XTJA 3DZGA 4JP3A 3SHTA 2NAPA 2SHKA 4G0ZA 5M3BA 1UAAA 1XTBA 1XDDA 1T2EA 2GKGA 2CJWA 1DHTA 2K4MA 4WXHA 2AYZA 2MYPA 1PJLA 2OZPA 3H18A 4OO3A 2OFOA 3EXAA 1N8TA 2HSWA 4MKRA 4IVNA 4ZRMA 2J4DA 4BO6A 4MJLA 4JYZA 3SJUA 5JDIA 4CIVA 2HQSA 2YOHA 4J3NA 1E6MA 1P4GA 1PSDA 3V7UA 2CW5A 5LQCA 4DV2B 2CXSA 4NE2A 5DI3B 3FETA 4W1PA 4PYIA 4I2NA 3GRKA 1GL6A 3HBLA 3QPUA 1M0EA 1JQLB 1XTZA 1CXZA 1UZNA 2GK6A 2XMDA 3REOA 3WQBA 1F9AA 1RFGE 3I9MA 3TLMA 4KHZA 4OU4A 1L7DA 3HADA 1EZ4A 2YXEA 5FUBA 4E11A 3D4BA 4ZQFA 5ECYA 1AMOA 3OCZA 3VSBA 2D1SA 4OBEA 3C3EA 3EXHB 1QHIA 2P5UA 2RHJA 3ND5A 4O4IB 2C8VA 2H1LA 2I9PA 4WKBA 4X20A 3STXA 1O94D 3T38A 2ES4A 4QG3A 3AVVA 3FUWA 3GJQA 2JIZA 3B70A 3ZUGA 1VBKA 3R0IA 3A9UA 3B3AA 4Z86A 3N86A 4KU4A 2Q8QA 1PWXA 1H23A 2WDPA 1FUEA 1RCFA 2WMDA 3OHSX 2V4ZA 1BXGB 1DIHA 1OREA 3ACCA 3FZEA 3OUUA 2C9YA 4FC6A 4N9QA 3ZE1B 1D7AA 1R6XA 4E33A 5JZBA 1DSSG 4BXOA 1NBMD 2XVXA 4RIFA 3JY6A 2D62A 1OY1A 2OGTA 1X7XA 2QNIA 3D5EA 3GY0A 3H9UA 2O2CA 3IDAA 4KYUA 4JEHA 4B31A 3D8SA 2EWMA 3GGPA 2CBXA 3VHQA 3EGWA 3H5IA 4V0OA 1X42A 1RCUA 2W2KB 4W8HA 3VR2A 3PC6A 2NVWA 4JVSB 4Z99A 2YUIA 3KOWA 1R5NA 4Q19A 1B0PA 4Z9FA 3RS7A 2IY9A 1ZJ5A 2FMFA 2IKQA 2VUUA 1MIOA 4OM7A 1LK5A 1U8XX 4Y9UA 3FCXA 5IN5A 3VYSB 2B5WA 5EE5B 4L51A 1T34A 3AFIA 2VJMB 3FGZA 1S01A 3UANA 4ML3A 1TIBA 2D7DA 3EHEA 1XVTA 3FPFA 1DQYA 3HKBA 1P74A 5LA6F 5LYYA 4EKIA 2PZJA 1J1IA 3D4IA 4NH4A 2J9RA 3OE5A 3HYNA 5J63A 4B75A 3QELB 4Z7JA 2DZDA 4CNQA 3IUEA 4OJYA 3FRJA 4Q7JB 4EGQA 1YVRA 4O5AA 3TD2A 1VLMA 2ENWA 2QRZA 3O0DA 3TDKA 3GQVA 3I0MA 3KZOA 4TT3D 4ZAVA 3T9CA 1FJXA 1A1SA 1MD9A 2Q2VA 3PVCA 1EX6A 2QYTA 3VBCA 4RS4A 3ZY6A 3JD4A 5BT8A 1MA3A 4CLOA 1ZH6A 3TEJA 3JD2A 3A4IA 3H5WA 4TYMA 3RHTA 5K2MA 1H8HD 1A50B 1L3IA 1U8TA 2OBNA 3EBLA 3EPRA 1U1EA 4XCXA 4C08A 3CUWA 4KO8A 4P82A 4MVJE 3ZNQA 5AM3A 3K70B 3ZZ1A 3L2OB 4P34A 5HKBA 4HXYA 1EESA 1PR5A 1H4VB 4BRSA 4H0FA 4I5GA 3UPDA 1JXQA 3BZUA 1JSZA 2BLNA 1S89A 3H0EA 1A98A 1LDNA 1WUTA 2BMWA 1XJ5A 2XTAA 4TLEA 1GTRA 4E08A 5SZIA 4CEIB 4HDNB 3T1QA 5ITSA 4E2XA 4BLWA 4J0FA 4RY0A 1YVPA 1FYWA 3KV3O 3UHJA 2AB0A 1JSLA 3AGPA 3E22A 4CHGA 2XNJA 2F8SA 4PC1A 5JDCA 2BGJA 2PKXA 2O54A 3LQFA 4QU8A 4B84A 4B7ZA 2PS0A 5EUBA 3QOXA 5DIFA 4JWTA 2YNMC 3AR3A 3PGVA 2W7TA 3IAM6 3KWJA 5TQ0A 4AO7A 4FWBA 5G02A 3NLLA 4JVLA 3D1LA 3F2IA 3N2KA 4UDNA 2M6KA 1I6MA 3WZLA 1SPXA 2PUJA 3BMCA 3GFGA 4GSLA 1OX4A 1SZDA 3DLPX 4GNKA 2RCNA 1ECFA 2TSYB 4MGHA 3RJTA 4QBFA 1G8GA 1VE9A 3IVCA 4Q7LA 2C83A 3LA8A 4M7WA 4OAQA 5IJ0B 1W0JA 5DCYA 5IM4A 5IBQA 1BN7A 5J43A 5H3LA 1P2DA 4MH0R 3V9PA 2YDXA 3GVPA 1EUDA 2Q27A 3BXXA 4XPZA 3TM5A 4Z1MD 4M76B 3EVDA 4GKAA 2JAQA 3KQSA 5KYTA 5ARDA 1M33A 2WYHA 1UKAA 4JB0A 1B93A 2P5TB 3BMXA 5C8ZA 3AF5A 4DRXB 2GN8A 2ZIUB 4BUZA 1GYPA 1VJTA 2PZAA 5BXYA 1C9DB 4CCYA 3RC1A 3QSYA 3KIPA 1CHNA 2RJ3A 1KIAA 4HGZA 3T7DA 3I04A 1C3EA 2B9VA 3EIWA 3Q85A 4CGYA 4TYWA 2PIAA 2NTVA 2Y67A 5TF4A 1E9RA 3V6LA 3UK6A 1H2FA 1FS6A 3VR4A 4DLXA 4OQXA 3A1NA 3QU7A 1X3LA 3GAAA 1D0SA 1Q50A 1UFQA 5CW2A 2GBPA 4QPPA 2GRAA 5EUCA 2KBEA 2YHAA 2WQ7A 3GJ8A 5IC5A 4EX7A 1X1AA 2GYVA 1BIFA 4LX0A 4MGYR 2ONYA 4H08A 3MW8A 1G9TA 2HHJA 3G2QA 1D5WA 3PGMA 3MPUA 2ZUBA 4FP9A 4B3GA 3HS3A 1FTNA 2YMLA 5LNK6 2UZIR 4YJFB 1QH1A 2YJZA 2ZI7A 1QE5A 3CRMA 4P2GA 4U4AA 4BFYA 4C78A 1ANKA 4D43A 5A5FA 5MFPA 2Q4BA 4KR0A 5PNTA 4AJ9A 1KYVA 3TFWA 4DYDA 3U56A 1MO2A 1IHXA 3QVTA 1GA4A 4Q6WA 4UM8B 3N87A 4YIHA 1NYLA 1J21A 1KMMA 4J1SA 1Z16A 3O0TA 1Y80A 1T1SA 3KR0A 2H07A 3OCYA 3AQIA 4TLCA 2A9OA 1QCDA 1T5LA 3ZCQA 5KU7A 3G1UA 4I3FA 5CYOA 4UMEA 1Q1BA 3MT0A 1DBSA 3B20A 3E18A 1QTRA 3V1KA 3ESDA 2HMWA 2HJSA 5GOZA 2LDXA 2RBKA 1ZQ9A 5JCJD 1FZTA 3LHIA 4HHEA 5B3JC 5JJIA 2XQJA 2DCMA 1R16A 3DOUA 1OLSA 5KC8A 3AZQA 5LM3A 2I71A 2RG1A 1Y5LA 4O4LF 5CVTA 3FPLA 4M37A 1W8DA 3E1KA 2O2JA 1XB2A 3LU1A 2UDPA 4HWGA 4L3WA 3EF0A 3UT0A 3ZV6A 5IAEA 3DCJA 1PWYE 1PFQA 1N6PA 4INOA 2OHOA 3UMRA 2GEDA 1VSVA 4Y0AA 4BP8A 3H4VA 4NZZA 1P91A 1ZZGA 3W8EA 3UMBA 1N36B 3A6JA 2FHPA 3GI1A 2PQMA 2BJWA 1NT2A 4RM2A 2YHBA 3N2EA 4OGGA 4PZAA 2I6QA 1P61B 1YQXA 2J9XB 4KXNA 4O2AF 4OHVA 1NF8A 3KJHA 4PO9A 3ZH9B 4UVEA 5C5CA 4R83A 2XD9A 3QJGA 5BQXA 1ZXLA 4XX0A 2OENG 3KUKA 3A32A 3NASA 1UKZA 4MRPA 4O08A 3GFSA 1X1SA 2VHJA 2QR5A 3WIOA 4EAAA 1RWBA 1JDNA 1SUAA 4KNWA 4MQ4A 1SXQA 5L3SB 4XQEA 2R84A 4HYQA 4NPAA 1BHQ1 2Y0PA 4L57A 2YV4A 4NZPA 3U80A 3MT7A 3R6TA 1MVOA 5KYWB 4IHJF 4Z7NB 2W11A 2JLUA 5CXSA 3M1LA 4V0QA 2H92A 4QUHA 4CMBA 3HXMA 5JAZA 4RANA 4EMBA 3KT3A 2KYRA 3FBWA 3FCOA 4X5OA 3OLCX 3OPMA 4DANA 5IDWA 3MCWA 5FI1B 3QRWA 1R18A 2NLOA 1Q5PA 4KB5A 4A6XA 1NTOA 2GVZC 4K46A 1NHWA 2G9NA 3ZXYA 5ALVA 2V96A 4I1RA 4UXIA 3WA6A 1X7WB 1KRWA 2RK6A 2QM7A 4RKRA 1PUIA 3RUPA 2YOFA 1QHFA 1U04A 1I13A 4ENVA 4PYJA 4D6PA 1EK1A 3FLEA 4QTXA 2PNJA 1HM5A 2OQVA 4K05A 2V6MA 4K6OA 4BMVA 2W4MA 1W1UA 2H3HA 1CEQA 3DZBA 1SZCA 3L3BA 3UW3A 3HK2A 2I03A 4C5BA 3OQOA 1GTMA 5K3CA 1OXTA 4B8WA 1J22A 5D01A 4RWZA 7MHTA 5DU2A 2YWCA 3HV0A 5EIHA 5A9TA 3ASUA 3G7UA 3U7QB 3HVRA 3KU4A 4DVJA 2ATXA 1TTTA 1BX3A 1JHOA 4AK9A 2QAGC 2IYXA 5BN5B 1SULA 1ESMA 4L08A 2ZR7A 3V8PA 3BJIC 3QFFA 3HUEA 5GWXA 3SF8A 3CZ4A 4HF7A 1LLCA 3VR6D 4G56A 2B5VA 2BMJA 3L46A 1R9NA 2HRDA 3A3NA 3LT4A 1K8RA 4D4GA 4J0DA 4YV2A 1NW3A 2H1WA 2ZRGA 5E4TA 2NP6A 1JG7A 4NARA 1A82A 1V96A 1G1AA 1Y9DA 2C95A 2X5OA 3ELUA 3QVMA 4UDOA 5BPHA 4KQJA 1F2UB 1ZK1A 4EDFA 2Q0SA 2XCUA 1DKMA 5K20A 5EIBD 5H3CA 3Q3GE 2JJ2A 4DEXA 1UBUS 4AKSA 4QARA 1ATIA 5TDHA 2LNDA 3OF3A 5IF9A 4FGKA 4BMDA 3OBIA 3HDHA 2P8JA 3M82A 2BI7A 3GAMA 3KL4A 2NGRA 3DE4X 4E5YA 1JHMA 2JB9A 2WQZA 1QXSA 2F1HA 4Q1VA 2ZUWA 2FMXA 2HL6A 5EIBC 5I8WA 2B7LA 3R7AA 3AUAA 2K7ZA 4ZO6A 3UM9A 3NAMA 1NJGA 3V2IA 4DOMA 2JH9A 4EG3A 4QRDA 4AXBA 4HB4A 4EPTA 1BCSA 2RGBA 2VSYA 3ASZA 3PNYA 1IHPA 3ZOZA 1IZZA 4L15A 821PA 5IXJA 1L4KA 5JD5A 2C5HA 1PR4A 1BDBA 1DI0A 1DJNA 1O95D 1X77A 2VJDA 4R1UA 4BU0A 5AVOA 5AT1A 1HC7A 4NCBA 1NMZA 1QKKA 1I01A 3E3MA 5DASA 5BN5A 3F9RA 3GLFB 3ZXIA 1AK9A 3GBSA 3NPMA 4U8HA 1EG7A 4ZQBA 1RWWA 3H3FA 1JHYA 1PFYA 2CHGA 3BG5A 3E0XA 3LKZA 3W5CA 5B57C 4ADSG 2AZMA 3R3UA 3GHHA 2FGJA 2EJWA 4JOCA 5K3AA 1HDOA 1NR7A 4ZVMA 1A97A 5TRTA 4B6PA 4IDPA 4TZKA 4XRRA 4CR6A 4LFBB 2PUHA 1YS4A 4G1CA 1HZJA 1B1CA 4BZWA 1OMOA 4ZU1X 4GWLA 4NZYA 2J33A 5HEKA 4MGIR 5DRYA 3RIGA 3EMBA 1W5FA 3V8MA 5JCOA 1E1LA 4H1VA 2CUTA 1W7AA 2X8BA 4RQUA 1BXZA 2CNWD 3O31A 1GRRA 2AC2A 3K1AA 1WMSA 1IRXA 4U5QA 3KSBC 1GFIA 4X7PA 1FLDA 4LZNA 3JZFA 4IFTA 5K3DA 1TCBA 2PO5A 1XL0A 5KZMB 1NV8A 1K8XB 4O3FA 4E03A 4IHKA 4XX0B 3QV2A 4ZZ2A 3TN7A 3HUTA 5FWYB 1PFGA 3F71A 4MWDA 4Q48A 4ETIA 1AO0A 4QJIA 3EODA 3ZI4A 1K5GA 3ZIAD 3C0KA 2GARA 1KS9A 2BJHA 3H2GA 4GRDA 3I4CA 4EX6A 2B4YA 4A2WA 1P81A 4OLJA 3REGA 2Q3DA 3C14C 1UJ2A 1KORA 1YRAA 4FX5A 1Z06A 2V3WA 4GYWA 1V11A 3FG9A 1T35A 1FDVA 1QMPA 2YJ6A 3IO5A 4KX5A 4XRGA 2SBTA 2UYGA 2HMUA 3E3NA 4GPZA 1QH8A 2ALJA 1CUUA 2GPJA 5DI3A 1R8SA 3PEVA 5E6UA 3OA2A 3ROEA 2CJYA 2X8AA 2CMKA 2Q2NA 3KAPA 4P38A 4M8IA 4UUBA 4D3DA 1W0KA 2G1UA 2X4DA 2R1ZA 4D8XA 3KXLA 1L2TA 3GA5A 1KMNA 1XR3A 1KIFA 1ZUD1 3N2IA 1JAIA 1UBMS 3DE7X 3Q9NA 4B87A 3GLGE 4KQCA 4O4IA 4U2KA 4X3CA 1R1DA 2WU8A 5FA6A 4L8GA 3HY4A 5KIAA 1KK1A 4YNBA 1IBCA 3CZQA 3NM5A 3PQ2A 5HF5A 4CXMA 1RXCA 3CSDA 3ZQ6A 3HFGA 4QSMA 1JAZA 1Z7EA 1GCGA 3D7RA 4MVJF 8GPBA 3TLGB 4BNWA 4R1PA 4UVHA 3A05A 4GXNA 3NAZA 5DO9A 2PTGA 3Q9LA 5FPHA 5JIBA 3V00A 4CR7A 4A82A 1HYGA 5DWVA 4AG5A 4D98A 5BR4A 3CVWA 3SGLA 3KP1A 3W1VA 1KI7A 3Q2KA 2A9FA 1QGAA 2XE7A 3DTYA 2C1XA 1O94A 1WB6A 3HN2A 1X19A 1EWKA 4IO1A 1ZUWA 4JP8A 4NONA 4MHOA 5E1DA 3AJEA 1ZIXA 3X1JA 5LR6A 1AOXA 4UD6A 3T9FA 1RQGA 1ENPA 4CBVA 3NB0A 1A4RA 3L02A 3O4GA 4R51A 3HBJA 3IXQA 3LUPA 5FIUA 3KJXA 4OOFA 4IIEA 2FN3A 2HSJA 2JBWA 1HG0A 1YKGA 3MS4A 4OHBA 2BFDB 4TSKA 3E8SA 1FDWA 4UREA 3D5QA 2GM9A 1T9ZA 1HSOA 2OO7A 4IFIA 4LJ6A 4UVIA 4IQGA 4Z9BA 1W0CA 3RRNA 4P9NA 4DXDA 2BLLA 2EF0A 2BMVA 3MGKA 2QMYA 4Y1FA 3C43A 3NRCA 4QYIB 1WPQA 5EKTA 5CA0F 4MR7A 4AYXA 1A8UA 4E5NA 3JYQA 2Z2KA 1TZJA 4U2DA 5D6NA 5DNYB 3HGQA 5CPFA 1TI7A 2H3EA 2DY1A 3OJWA 1QFYA 4W82A 1Q11A 1T9DA 1EDOA 2NIPA 3VC1A 5JEEA 2RHRA 4LHSA 1G41A 2PGJA 3AY0A 3B3QA 3TRFA 3K9BA 1OXSC 1B14A 2XYRA 3A4LA 4FBLA 1JLLA 1S1MA 4CIXA 2BEWA 4FFLA 1YJQA 2ETXA 1DKRA 3EN0A 4AS2A 2Q9CA 1TTHA 2QMUA 3HG7A 1A7AA 1AHNA 1HLPA 2CNKA 2V5VA 4GC9A