3M8WA

Phosphopentomutase from bacillus cereus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
4KJGA 5GRRA 1AJAA 1AJDA 3T02A 1ALKA 1E1ZP 5L0EA 2IUCA 3Q3QA 3OT9A 4UORA 1URAA 5L0KA 4UOOA 1HJKA 3SZZA 1KH4A 4CXUA 1AJCA 3NKOA 4ZG6A 4LREA 2ANHA 1FSUA 1KHKA 5DLTA 3MK0A 3IGZB 4ZGAA 1EI6A 3WAVA 4MHXA 1URBA 2D1GA 3NKNA 3KD8A 4KAYA 2W5XA 4GTZA 5GOVA 3M8YA 3UN5A 2W8DA 3MK2A 1HDHA 1KHLA 1ANJA 4GTWA 3IGYB 1E3CP 3NKQA 1KH5A 2VQRA 3TX0A 1KHJA 1SHNA 4FDIA 1B8JA 1Y6VA 2W8SA 3NVLA 4YR1A 5LRMA 3BDGB 2X98A 1E33P 1ALJA 4QAXA 2GSNA 5C66A 1O99A 1ZEFA 4KAVA 5L0BA 4N7TA 1ZEDA 3M7VA 1KH7A 3IDDA 3DYCA 4MY4A 4LQYA 4UPLA 3TWZA 3A52A 4FDJA 1AUKA 2W5TA 3WBHA 3WAYA 4CXKA 5LRNA 4LRFA 1EQJA 1ZEBA 5IJSA 1ED9A 3LXQA 5DLVA 3UO0A 2W5SA 4LRAA 4UPKA 1O98A 2GLQA 1EW8A 4UPIA 5AJ9A 5TJ3A 1EW2A 3B5QA 3UNYA 1N2LA 3DPCA 1ALIA 2W5VA 4LR7A 2XRGA 5LIAA 4B56A 3ED4A 1EJJA 1ED8A 4LRCA 2W5WA 1ANIA 3T00A 3UN2A 3BDHA 1SHQA 1HQAA 1P49A 2G9YA 2W5QA 1ALHA 2GA3A 4NWXA 2XR9A 3WAXA 3M8WA 4LR2A 4GTXA 3T01A 3NKRA 1Y7AA 3NKPA 4LRBA 4LR9A 4KJDA 1KH9A 5HRTA 1KHNA 3WAWA 2IUCB 2ZKTA 3MK1A 5EGHA 4CYSA 1E2SP 1K7HA 2GSOA 4ZG7A 2IFYA 4KM4A 4UOPA 1ELZA 4LR8A 2RH6A 2W5RA 3E2DA 3NKMA 5INHA 2GSUA 4LRDA 3M8ZA 4UPHA 3BDFA 1N2KA 4GTYA 4NWJA 4MIVA 3CMRA 3UN3A 4ZG9A 5DLWA 5IJQA 5LQQA 1AJBA 4TN0A 1ELXA 1ELYA 4CYRA 1EW9A 5EGEA 3SZYA 5KXAA 2QZUA 3TG0A 3BDGA 5K4PA 4CXSA
chains in the Genus database with same CATH superfamily
1SL2A 2UXCJ 3KJQB 4JYAF 2MSSA 3ZFVA 1ZS6A 3BGRA 3MECA 4L74A 5GAEU 4NRUA 5KFGA 2ZZNA 5CQGA 3NNCA 5L0EA 3THTA 4FXWA 4QJVA 2IUCA 5J1PA 3J7Z5 3NKYA 4IFYB 1TU0B 2VFTA 2UUCJ 1RA6A 2BKOA 2C1EB 2NXEA 3HD1A 3Q2SC 4R0JA 1SL1A 3VAGA 1R89A 4DS4A 2NQPA 3TX8A 1NHUA 2MZJA 2HBQB 4DV0J 4LF5F 1IJFB 1LWFB 3C66A 4NA3A 2V68A 1RAHB 4ZG6A 2WOMA 3L4BC 2CJXB 3ILOA 4OYWA 5KG5A 3CCMS 3N9UC 1CJUB 1NK7A 2CWXA 1FWPA 5B09A 1PYTA 2VFSA 2XG8A 1C1CB 5KFDA 5D0GA 3CJTA 3G8QA 2VA3A 2BJDA 4U6PA 4FYYB 4MK9A 1RLDA 4NEYA 3UW1A 2DB1A 3GIMA 4K5SA 3BYPA 5KFAA 3IAM9 5DETA 2RD5C 1FKPA 4G1PA 3UCZP 1V3SA 2YXLA 3GG0A 4AE5A 4FBUA 4GKKJ 1FKOB 1UZDA 1VRQC 4WFXA 3E01A 1E6YA 4HLBA 4D3GA 3THPA 5ETOA 3EPGA 3IC1A 2OPRB 1RAIB 4PYDA 3CIMA 3HVTB 5C66A 2AT1B 1P6TA 1B3TA 2C3YA 2VL1A 3I0RA 5K14B 5F8HA 2UVWA 4X66J 1KH7A 5I3QA 4DMZA 4F50A 2ASLA 3NXZA 3FEZA 3ILIA 5DM7Q 1JJCB 1BQNB 1T03A 1RT3B 2YX4A 4RBVA 4WFYA 5C42A 4ZVSB 1ED9A 2GC8A 3UO0A 2Y0SD 2A18A 3HD2A 1RWXB 1SJ1A 4LFAJ 3SSQA 4YDDB 5HANA 3E8OA 3Q8RB 2GIQA 4LSLA 2GJ2A 4DUTA 5DQHA 2KTQA 1GMWD 4X2BA 3I6PA 5KG0A 3JSYA 5A6PA 3QJLA 1M5VC 1UJ6A 2IJRA 1X5SA 3FZBA 3R5JB 2LQ8A 4M5JA 3M30A 3DDNA 4I2PB 1RHMB 2HG4A 4WK3A 4ZPVR 2R7XA 3PZPA 2EFNA 4DX7A 1N36F 3MM7B 3DU5A 3ET6A 2ZJPQ 3CCTA 4OYIA 3OW2R 2LDYA 4ZDNA 2HZAA 3IR7B 2ADCA 1NK9A 2WSEC 3PIPQ 3BPSP 3M4XA 3ZZRA 2AYGA 4ILLA 2V8PA 2GVDB 2GAGC 2BJ8A 3DGVA 5HI7A 3KLEB 4FYWB 2OIHA 3GLJA 1YX2A 1W26A 2IDLA 2YKNB 3MDFA 1RT4A 4EEYA 3FEXB 3I82A 1SC6A 5FJ4A 5KG6A 1RWKB 1UTAA 2N7YA 2V2QA 4RNMA 4V19J 1RK8A 1F5AA 2EK6A 1RSCA 3MMAA 5HK4A 5I42B 1CC7A 5DDOC 4UOFA 2AJ2A 4ZKAA 2OTJS 2KFNA 3KUGA 1BD6A 2OLWA 2UUWA 3EDQB 2LEAA 4RU9A 3G8SA 4J9PA 3RAQA 1NO8A 2BRLA 3G6XA 2R8KA 4ELUA 4O4GA 4PPZA 4NCBA 2UZAA 1HHQA 3KUHA 3P49B 2R8IA 3TANA 2GSOA 2J9CA 3G2XA 1KN6A 3FFIB 1EQMA 1SJ3P 3E2DA 5AXNA 1TFYA 1EX8A 3RR8A 4USWA 3PM9A 5DRKA 3MEDA 4DF8A 4OI3A 2ATLA 4WKRA 5SZTA 4ZVUB 1K44A 2UUBJ 2FJDB 2DT9A 2ATCB 1NAQA 2I1RA 2P9CA 3BZQA 2W8LA 4FS1A 3R9LA 1XNRJ 3UN3A 2B4UA 2Z8QA 4FNIA 4DUZJ 5J1NA 4QIFA 2DNZA 1ELXA 4ZS6A 3JB9k 3M8PB 1XIQA 4PG6A 4PABA 4XAKA 3ZTOA 4IG3B 2ZH3A 4PPDA 3CUNA 2FVSA 4DR3F 3SZYA 5L39A 4CQ1A 3D0GE 1SKSA 2NR0A 1K8AT 1N4LA 2CUYA 1M90T 3QMQA 2H9ZA 1T9WA 2FLNA 1H7WA 1J5EF 2F7VA 4ES1A 3H25A 2VHGA 4F2RA 4I0WA 1I94J 2DNGA 3H8YA 1Y10A 3DRSB 2DNOA 3VAFA 1R8PA 2PI5A 3HFKA 3SFGA 4IUFA 1KH4A 3H2LA 2RRAA 2D3O1 2GX8A 3BB5A 1OPIA 3FFIA 5HQ8A 3D4JA 3OUYA 1PJ7A 2E1MC 3DYAB 4OX8A 1SIZA 3NMRA 1JKHA 1FVQA 1HQEA 2G13A 3C6TA 3TARA 1CJKB 1T7PA 5CZVA 2CPEA 3L7UA 3QPIA 1N32F 4TLRA 5CHCB 3M8YA 3EGZA 1PAUB 3MF5A 2EFPA 2Y1JA 5DG9A 1QVFR 3P96A 2QIFA 4KH0B 2PMZD 1Y7PA 4WP9A 3BH6B 3CO9A 4QW9A 1J2VA 3JQKA 4RX6A 4Y28C 1EQ0A 5KFCA 1RTHA 2AEJA 3CJKB 3NVLA 2DYAA 1X9SA 5KFTA 1FRHA 4CLKA 4CLYA 3KLFA 4F4ZA 3AA9A 3NMAA 5DZ7A 2UXBJ 1S9FA 2E9ZA 2GSNA 7FD1A 1RTIB 5GAHU 3UD3P 3CMES 3C6TB 1X4CA 2MYFA 3A3PB 1X4HA 4Q0BA 2MLZA 2YWEA 3BKUA 4MJKA 4N8NA 4MYTA 1JJ2R 4FDJA 1NM2A 3ELHA 3ICLA 2V8GA 4I56A 2VQEJ 1U6BA 2CVIA 5IJSA 2U2FA 1K47A 1VMBA 4R25A 3VCDA 4C11B 3OHAA 1ZM4A 2M70A 3RRKA 2FJWA 2MQNA 3IGVA 3ZZTA 1QSLA 2HHHF 1IQZA 4LBPA 1CS4A 1S4EA 3FMWA 3W2WA 1K0TA 2CPXA 2G0JA 3LF0A 1UJ5A 4HEA9 2B9WA 5EHHA 3TEHB 5LIAA 2DO0A 2GHWA 5HAOA 4TQSA 1X9MA 3CNQP 2YNIB 3W7BA 2WVBA 5CCMA 4URQU 3Q8SB 3HPOA 1TL5A 3POTB 3I9V9 2WZ1A 1LW0A 5H9FK 1YZ7A 2ZBPA 1P49A 2ZBRA 2CJAA 3DOMA 1UEUA 2F5GA 2G9YA 1UEKA 3DKDA 4F2SA 3A8KA 3HVTA 4G3IA 1DQAA 4B9NA 2QYGA 3ADAC 1C1BB 1UKUA 2EKYA 1UW4A 3SDEA 5KFEA 2MXYA 3MD1A 2B4OA 1IKVA 1RTJB 2CZ9A 4KGZB 5GMDA 4ZK7M 1FKOA 1P27B 5AXMA 3OVBA 3V6DB 4ZP6A 1MU2A 2ZFHA 3OL6A 2W01A 4LR9A 4HDHA 3ET6B 1PILA 2R7VA 2HLTA 3NCQA 1SHNA 4I2QB 3KLGA 3K59A 5L1IA 2Q6CA 3POTA 2E5HA 4WTYA 2KT2A 4X4QA 2FHJD 3R3TA 4USMA 3SI8A 1H0HB 1K7HA 1JLQB 2J9EA 3R7SB 4ECXA 1B0VA 2CPIA 2AGOA 2B7CB 3T6JA 5KFYA 1HQ2A 2RAQA 5KT6A 1KRPA 3GFXA 4ELTA 4LR8A 2IA0A 4P74A 1MLAA 2Z2MA 2HWTA 2R7QA 3IO1A 1X5OA 3R6GB 5KFVA 4JI7F 1N0UA 2DNPA 5ETRA 2F40A 5IT0A 2K3IA 2V63A 1SL0A 4NXMJ 3K5PA 1OMSA 1VRUB 2Z57B 1X4BA 1X31C 2OPSB 3HCXA 1HQUB 4P9SA 1U1LA 2ZEJA 4MKYA 2K06A 2XWYA 3HHLC 4KJIA 2UXBF 4ZG9A 2E7XA 2GHPA 3HHEA 3MMCA 3Q8YA 4ECTA 3OXGA 4ECZA 4F3MA 2BMBA 4X4NA 2OSQA 3PHTA 3QIDA 2QN6B 2HNYB 1B70B 1N6QB 3BH7B 2OPRA 4NLVA 3CXCR 1U6FA 1F1BB 2WBRA 3T1YJ 1LNQA 3ITHB 1FI4A 5SUHA 1X7VA 4DR2J 1LWEA 2V4JB 5J2MA 1S0OA 1CJVA 1VDHA 3GFHA 3PW5A 1LV5A 1J5OA 2R7TA 1RT4B 3W2VB 2JJ4D 2R8JA 3CCQS 4ZP7A 4P7TA 1D9AA 1NZ8A 3IP0A 2Z30B 5CYMB 4JI2F 1S97A 1CVJA 1IBMF 3PKMA 4LREA 2XLIA 2YBVA 3KLVA 3GB0A 3M8QA 1U24A 1W7WA 1M5SA 1BXNA 1FWKA 2F8MA 3IGZB 4B17A 4USJC 1GFWB 2RHSB 3AD7C 2Z2YB 4EZ6A 3PYFA 1DY3A 4G65A 4YEAA 3VHQA 4NCGB 5LJ5Y 4GKJJ 3VAKA 3DI6B 4CH7A 3BO4A 2C42A 1WI6A 1R8BA 3BGOP 2Z2ZA 1FXRA 1SC1B 5A8KB 2CQCA 2PN6A 1EZZB 4QZVB 5DDQC 1RACB 2MHNA 2ZC3A 2MKSA 2M52A 2YWKA 3R6LB 1PO6A 3W64A 4ZN3A 1FFSB 3FCVA 5CAAA 3D54A 1Q82T 3EDRB 4AUKA 4FXDA 2ASJA 1H98A 2P8IA 1ALJA 4K4VA 4CH0S 4UW2A 4U7UD 4JI0J 3MEGB 1R27B 4DR7J 3M7VA 4OZ5A 3IFEA 4OZ3A 5H9EJ 2QG9B 2K2PA 5KFNA 1ZTWA 3WAYA 1JK9B 1HNZJ 2FB0A 1OSDA 4MYUA 1KD1T 2R2SA 3BBCA 3R2DJ 3LXQA 3OPKA 1G4CA 3CJ8A 4QIGA 4FZVA 4UZCA 1FJGJ 2POKA 2XO6A 3J7YU 4PRFA 4ZA1A 1S99A 3MM9B 4N47A 1DFDA 1RBAA 2V9KA 3KG4A 1IWGA 2JFDA 1DTTB 5B0GA 4HI1A 3S1TA 2R8GA 4OZ2A 3DCAA 4M5LA 1PBUA 2W24A 2XS5A 1RT5A 1VBYA 1WC0A 3M6UA 3ZZ0A 4NZ6A 1VQ5S 4CLSA 2GZOA 3UDEA 4N56A 1RTDA 4LVOP 1TKTA 3P8BB 4ZVRB 3JAMY 4YMEA 5CH7B 4DL7A 2F4VJ 2Q1LA 2HS3A 2K7JA 4OV1A 3W9HA 2E1AA 3OR2B 2YVSA 3MMAB 3GWCA 3WC0A 2E44A 3PJXA 3CCSS 3GV8B 2LP4A 3M8WA 5IFMA 2YKQA 3EM1A 4M5DA 2CZVC 2MMYA 3FMBA 3PDNA 3PJ9A 4CT8A 2HFUA 4X4RA 1M5HA 4F67A 4ANEA 3OTDA 3PX0A 1F2GA 1TL7A 1NJIT 1TL4A 2ROPA 2X3GA 3D67A 4W90B 3JTPA 5M2RA 4K4YA 2CQIA 3EVMA 1VHFA 2UP1A 4LSNB 2MZRA 5MLCV 2BA9A 3J81U 3MAAB 5EGHA 1KOHA 1RAOA 3GCXP 1H72C 4G1IA 1ZPVA 2JOQA 2WW8A 5DO2A 5E41A 1K0VA 1WOOA 3PEHA 4XPCA 4KFBA 1FE0A 1IKXA 2IY5B 5K20B 4CM2A 1JJ4A 3EWGA 4DDFA 4XDDA 5B0AA 1F9EB 2C2OB 3M8ZA 2EEYA 5C5JA 2UVVA 4F26A 4DV3F 4RPFA 4K5RA 2DIUA 2HGNA 1XN9A 4NX9A 4DQRA 4MIVA 3KK3B 1F5CA 1BGXT 4IRKA 2Y8WA 3CC4S 3TUJC 4EYHB 1AA1B 1FJEB 1N5YA 1LOUA 3UD5A 2MGZA 2X1FA 1G1XA 1X4DA 2LXUA 1VRTB 2EW9A 3CCWA 3H42A 2QO3A 3MR6A 2IMWP 3BEGB 2QZUA 4LIRA 3QFWA 4C8NA 4OJ3A 5GRRA 1TUWA 2XNRA 1S6UA 1YLXA 4NLYA 2MQQA 3MOZA 3GSDA 1TKZB 2MKJA 3MTJA 5I4MA 4YHHJ 1KQKA 3HHNB 4RLEA 2M88A 2W2PP 4KHRA 5KG4A 1SUQA 3AXMA 2BE9B 2NS1B 1WG1A 2VG5A 3QGHA 3PY8A 3CJ2A 2GVZB 1A0OB 2RQMA 2VKRA 1IXKA 3H0PA 4RW7B 4KH1B 2FJEB 3NGKA 5D4LA 2EC0A 1PBAA 2W25A 4IH5A 4IKAA 2MJNA 2ZH4A 1T11A 5I3UB 1WC1A 4JI8F 4K4UA 2VG7B 2IMOA 4TY8A 2QFJA 1E6VA 1J5EJ 2MB0B 2DCLA 3MWBA 2FJAB 4RW7A 3R1LA 3NNAA 3AD8C 3HI9A 5B0BA 3FRZA 1X5PA 1K9MT 4OHWA 3HKWA 4IH7A 2NCKL 4KBIA 2KM8C 3UN5A 2F9DA 4FN5A 3MK2A 5T7LA 2QMXA 3M32A 2XTJP 4IO1A 4USIA 1E3CP 1RWUA 1L3UA 1KH5A 1VHIA 1KBRA 3K89A 1IN0A 4IFYA 4NZ7A 3TX0A 4JI1F 2QLXA 4GO7X 4FDIA 4B9UA 2WRMA 3BR9A 3GU0A 1FDDA 2MJUA 4KAIA 4X4TA 1KKHA 1RE1B 2ILYA 4DSIA 1XNRF 4Q44A 3MECB 3RBEA 3MEEB 2HFSA 4H54A 2ZOMA 2FDNA 3AOCA 2FLLA 1FNOA 1YSJA 2RSQA 2XZWA 2J7KA 1N5VA 1NZAA 2ZBIA 3L9ZA 4IQMA 1WKLA 4NI2B 5D78A 5EGYA 1DURA 3DOKA 4IFVB 2KO1A 3OBIA 1UMJA 1ZH5A 2CQ3A 1N8RT 1AUKA 3QNWB 1AXQA 2M9KA 4LF8F 1BWEA 3G86A 2R4FA 4CZCA 4FKYA 4DQIA 2VQFJ 4ELVA 4LRAA 1IR1A 3WIVA 4PUOB 1FFWB 5F8IA 1S7HA 3JSMA 3C6UA 4UY85 2K1RA 1HNXJ 5KFOA 4CIOA 1MMNA 3MEKA 5EWFA 4RNFA 2RJZA 4UQTA 1Q5VA 3V6DA 3LTOA 3U27A 4IO9Q 4JI7J 2HNDB 3T9ZA 1TKXB 3CJRA 3QLHB 4XK8C 2W9BB 2KI2A 1KHVA 1C1BA 4NLGA 1BQMB 4OHZA 3CD6S 3KLIA 3GJRB 3IRXB 1CC8A 1S9EB 1ALHA 2RQKA 3BBFA 1HNVB 4M5MA 1IBKJ 2Y1IA 3AH6A 2AP6A 4JI1J 3F0NA 2CIMA 2D7SA 3B78A 4O23A 4OI1A 5E5NA 3DNCA 4NL5A 5IQ6A 3NCRA 1GK8A 2NSBA 2QA2A 4P75A 3J81j 4LUBA 1QTMA 3LAKA 1MNEA 2QL9B 4QWBA 3CJ0A 3ZZZA 2CXEA 2VUGA 3AOAA 1TK0A 1TV6B 4NMLA 2RU9A 5LOQA 3SV3A 1T9UA 1Q8LA 3MAHA 3D7SB 1LWEB 2V4JA 3OFHA 4I7FB 5FLXU 2AX1A 2WW4A 2WVCA 3ITHA 4WF9Q 1FJCA 2YNIA 5FLXY 2O67A 1BQMA 4LF1A 2CPYA 2CRLA 4IG0A 3D1OA 3SCIE 2AGPA 1HKAA 4ZCIA 4KSEB 5IT4A 4KM4A 2M7SA 2W5RA 4OZNA 4K4SA 1OQ3A 3V5RA 4ZN1A 2CG8A 1M1KT 1H73A 3CMQA 4Q7AA 3FQKA 5C24A 2BV3A 4DV7F 3EE3A 2NUUG 4GVLA 4IOBA 5FDLB 5KFBA 1S0VA 3QWPA 2VA2A 3CGIA 2OH2A 1SJQA 5DLFA 1S1UB 3GIJA 1FD8A 1N5QA 3PRDA 2J8AA 3QT8A 3UNGC 2FVPA 1TAQA 1RWPB 4O4GB 3W5ZA 1EW9A 2AU0A 4CYRA 2VFRA 5KAKA 4NOHA 1ZBTA 1NMEB 2WB1D 3CWJA 1F6TA 1VJWA 3O3LA 4FPRA 4IG0B 4TN2A 2VQEF 3QJPA 2RVJA 2CQHA 4HL9A 1Y00A 4J9QA 3TRGA 1DQ8A 2EFGA 4RNOA 3BF4A 4LF4J 2G4BA 1WHWA 2IPOB 2Y1RI 1VQYA 2AJQA 3PW0A 3ULHA 4Z37A 4DV1J 4URGA 3PW2A 3Q3QA 2H54B 3GFYA 1KWMA 5L0KA 2V6AA 4M5DB 2BR0A 2CZ4A 2KXHA 4S0MA 5IQQA 2CJ9A 4CXUA 3MM6B 2ZH1A 1A9NB 2JDJA 1C0UA 5EN1A 2ANHA 3CJ4A 5D0HA 2FVRA 3NNHA 4ANCA 3OD2A 1VQ9S 2GHVC 2HNZA 4JP8A 1N32J 2V50A 4H4MA 2OFHX 3RB3A 1JLAB 3BGFA 4MT1A 5HMWA 4GTZA 3M30B 4I2PA 2WB4A 2VH7A 5D4NA 4Z2XA 1MWQA 3VALA 2BRKA 3M8PA 2W9AA 2H48B 2GJFA 2JWNA 4DSEA 2FVQA 2D1CA 2KG0A 2KRBA 1Y6VA 4TY9A 3H5YA 2NZ4A 4YR1A 3BDGB 5LXYA 1U02A 4O3PA 1GAOA 2IDEA 5CYJA 4DQPA 1NDPA 1Q4RA 2HVDA 1SV5A 1YGYA 3NCPA 4C11A 2HAFA 2HRTA 1RAAB 3K2YA 3C16B 1HR0J 2KDOA 3QAUA 4USHA 1VFJA 5HVFA 3UCGA 1M5KC 3FJ2A 2AJFE 2G9OA 1RBLA 1TL3A 3JTOA 4DUYJ 1S0MA 2HFZA 2M0GB 1C2PA 3AB2B 4IYQA 3DXBA 4RNHA 4JI6J 2V34A 4ECRA 1HWJA 3A3NB 2L3MA 2QRRA 4I6AA 3CE8A 5B7WA 5C2GA 1OO0B 3I96A 5F3ZA 1OWXA 2J0WA 4NXNJ 2CVEA 2BM1A 1U1RA 2XWXA 4NMXA 1V3ZA 5IC6B 5U47A 3J80Y 1ALIA 1IKXB 1JLAA 3QSIA 3M32B 1IR2A 4I2QA 3KLGB 4ED2A 4A8XA 1ANIA 4KTQA 5KT4A 1FRMA 4DV4F 3HP6A 2EVZA 3MAAA 1RISA 4ETZA 1YBTA 6FDRA 1IBKF 1Q86T 1CJKA 1O8BA 2VC0A 3TW0A 2FC9A 4IOAQ 1TL7B 4OQJA 4P71A 3K5LA 1D8ZA 3MMBB 4CO2A 5KFLA 1VC5A 2ZE2A 3TAMB 1B7YB 1FO1A 3K17A 4F3QA 4DR5J 5K8PA 1UVKA 5C2CA 3BGRB 1KC8T 4KJDA 1WHVA 4A48A 4HTIA 4NWBA 4OYPA 1WI8A 4LSLB 5G4DA 3D0IE 2D41A 5KT7A 2QLJB 2QT7A 1SH2A 2RH3A 3QO9A 4AXJA 3QIPA 2C2MB 3OTCA 4Q43A 2C2DA 1VC0A 2KL8A 4OHVA 4PWWA 1I6JA 1VQ8S 4UOCA 1B4SA 4WTOB 1S72S 1DTQB 2EK1A 4C8MA 3MR3A 4QIWD 4F36A 5M2UA 4C8KA 1N52B 4NLQA 4P2XA 1VS3A 3T19A 2ZE2B 3TAMA 3NAIA 4C7QA 5CCLA 1ACMB 4DL2A 1B0PA 3CCRS 2LU1A 4Y2CA 4DCPB 2R7OA 4C0BA 1P9QC 3VAMA 2LQ5A 1FHTA 5IJQA 2HK2A 3Q86A 3UR0A 5IT9U 1Q79A 2YX7A 2XBPA 4OI2A 2GAHC 2JLFA 2DPIA 3H20A 2OI2A 3O44A 4DV3J 3HSZA 4DS5A 2Y9HA 1JLEA 1XR7A 9ATCB 4ED1A 2WBMA 3VZIA 2B8QA 3RB6A 1RABB 4UOHA 2ASYA 4DR5F 1MU2B 3MPDA 2QA4G 1U48A 1F9HA 1KDNA 3B6BA 2XI3A 2DGUA 3TQEA 4DPYA 4QCLA 1S6QA 4AL7A 5KFRA 4HACB 4WYLA 4USUA 2B6AB 4L6V3 3I56S 3T5JA 2RMLA 2MLYA 3RUBL 4UUXA 3ZZOA 2R7SA 5KFZA 5E3AA 2R2TA 1D9FA 4FBTA 2L9NA 1IQTA 7AT1B 2RKIA 2G2OA 2XY7A 1YRUA 4LT6A 4N41A 3MK0A 1JQGA 2E29A 4GRSA 4KO0B 3V6JA 3QZ7A 2XY6A 2D9OA 3MM5A 1WSVA 2GGPA 3AOBA 1FX2A 4U8YA 1WOPA 3T6BA 1B99A 2QX0A 2DGQA 3LANA 1QAJA 3QGPA 1WF2A 2BW2A 2DNNA 2K1RB 3IM9A 1CS4B 2PMWA 1SH0A 2AIRB 4IR1A 3MURP 4GO5X 2L9WA 3MOJB 4DUYF 1QUPA 2FHMA 2JC1A 4FF3A 1Z2LA 4TNOA 3PYEA 1E33P 3PNIA 4OV6A 4LQ3A 4DV1F 3FC9A 4QAXA 1HL6A 1AYEA 2G0CA 4WU2A 5KFJA 1S10A 2JEFA 1YRTA 2GW8A 2VBWA 3CSKA 2XS2A 4ZJQA 3DRPA 2BOAA 4WFZA 1NNDA 4NXMF 3IDDA 5IV3A 2XM3A 4B3RF 1RZMA 1YJNS 1YIJS 5BR8F 1HNWF 5LRNA 3LH2S 4NEZA 4W98A 3V4IB 1EJ7L 3ZTSA 4A8MP 1RU1A 1W2IA 1RT6B 4CLWA 9RUBA 2DR6A 4KB7A 2LQBA 8RUCA 3ISND 3DHXA 3QGIA 3QRRA 2MDAA 3KUEA 3G96A 1X0FA 2LMIA 2XRGA 4O3RA 2B3TB 2I0XA 5JJBA 4ZVOB 3L3CA 4PG7A 3BV8A 2GS8A 4C0HA 3BKTA 1FDNA 4DX8H 4UT4A 4RUHA 1JXLA 3G8TA 4Q0BB 2DHSA 3TJAA 3WDOA 2G1DA 5A8WA 4H4MB 2OTLS 2FQQB 1NDCA 3B54A 2IVFB 3W9IA 1GXUA 4RUAA 5ETKA 4FS2A 1NCLA 5LL6d 4NLWA 3O5TB 3SEOA 2ROGA 3HVAA 3KNGA 5LXRA 2ACMA 1GX5A 2RQCA 3KHGA 5L1KA 3V6HA 2IBKA 2UU9F 4OL8A 1JNZB 1AFJA 2YKAA 3ZNJ1 5IC4B 2CAJA 4O44B 4C3LA 1S1VB 1WNEA 2BJ1A 2D9PA 1W25A 3NKRA 1VK8A 2XSFA 2L41A 1WSRA 1U1QA 3B8HA 4X4OA 1EAYC 4WFBQ 4I1TA 1IBCB 5MAOA 4DFMA 2FJXA 5HRTA 4PQUA 1PCAA 3LPYA 4B9LA 4QW8A 3C2PA 3EVOA 4J5OA 1ZETA 2WONA 1WKKA 4IRDA 3CD0A 1LFWA 4M1KA 3RB4A 2WVFA 1VBZA 2HQDA 2Q43A 2XMWA 2XMVA 1L3SA 5DDPC 1N34F 1UWAA 3SBMA 1LXJA 3SSSA 3D3CJ 2F65A 2FY8A 3T5LA 1T05B 1KVIA 2DXDA 1HNXF 1F0XA 1HWUA 2AV5A 2GMLA 3E3XA 1PG5B 3LOUA 1RHUB 2QJ3A 3M2RA 5GAGU 3BBBA 2HRYA 2IM3A 5A8WB 2UU9J 4Y2IA 5BJRA 3DFEA 2XYPB 4P2FA 3BKFA 1QM9A 3J81Y 3A3OB 1KR4A 1R31A 4OYMA 2XYHB 3KJFB 3IWLA 1JXVA 2NXJA 2B5JB 1AROP 2XSJA 3QYYA 1JLQA 4DBQA 2J0XA 4DL0C 1VQSA 3NKOA 1JX4A 1R3NA 4DR1F 3O2IA 5AE1A 1TK8A 1MWYA 3DLKA 3HM9A 2EFOA 3AODA 4DF4A 4YDXA 4OZLA 4ED6A 2QGFB 4RUBA 2VG7A 4O3SA 4FP9A 4V1Ak 2M4MA 1LKZA 1JMTA 3CEDA 4ZJLA 4UORA 2Y0BB 1DRZA 2RF2B 4BWMA 1SJ4P 4UOOA 5F0WA 4R5PA 2ZH7A 2ZZTA 2CPFA 1PJ6A 3DRRB 2HQGA 1KHKA 3SCKE 2J6SA 2PEBA 2IBOA 2ROEA 3H90A 4NI2A 1KFSA 3US5A 4F4XA 2IA6A 3VAIA 3JTNA 1NJYA 1NHKL 3NLCA 2YKOA 3KD8A 3ENWA 2EI5A 3MUVP 4TXSA 1FKAF 5ETPA 1FEHA 2W5XA 3HSJA 1JLGB 1ZYQA 1FRKA 1YJWS 3A1YG 2X51A 1V9OA 4K4ZA 1OSCA 1R0CB 3LO3A 3CC7S 1HD1A 3P4UB 1VBKA 1GMWA 2A2DA 2VV5A 1RAJA 2KN4A 3GIIA 4DHVA 4WPAA 1RHKB 2DY1A 3H2UB 1GTHA 1T9YA 2MQ8A 4OX6A 4DI6A 2ZJQQ 3W2WB 2DHXA 2APOA 5L9NA 5LRMA 5T41A 1OY8A 2EBGA 3KK3A 4BDPA 4KY3A 1BLUA 2KHCA 3F44A 4WU3A 3VF0B 1JXEA 3LGMA 3PRVA 2HHXA 4YOEA 1E6VB 1P8GA 4TY8B 3BQ0A 4EZ9A 1UWBA 2ZITA 5H9FJ 2HBRB 3L7PA 1AUSL 1IBLJ 1VQPS 2BANB 1XBWA 2HHSA 3OHBA 1OS5A 5J2QB 4ZJOA 1VLOA 3ZNUA 2BE7D 3DRRA 2VKZG 4MIAA 3AHPA 1MMLA 1XK8A 1O5JA 4I69A 4QR2A 4I64A 3H98A 4DSFA 1R0AB 1HYSA 4YFUA 3D28A 5TJ3A 4DR4J 2BX6A 3E01B 4J9UE 4EUVA 1HI0P 1C4CA 2VZ9A 2H5IB 4RWWA 3IN5A 1KQFB 4CDIA 3DI6A 1Y3JA 2AMCB 4HHJA 2KYXA 3NAHA 2FC8A 2I8EA 2PFFB 5HROB 2ZWPA 3LP2B 1U1KA 3CO0P 4LSNA 3GTYX 2ZNYA 3KK1B 3ILJA 4FNHA 2VG6A 4YQWA 4PXDA 1I1GA 2HURA 2MZSA 3DU6A 3GE9A 4U96A 3KLHA 1FDAA 1HLWA 2IYGA 1NSAA 3D6FB 4C8OA 2DR8A 4H4KC 3N6NA 3HJVA 4A4JA 3M9OB 1WF1A 1WHXA 2IVMA 3A8JA 3CW2C 3U7JA 3IBFB 1MWZA 3CTRA 3VGVA 4DPWA 5LSLA 4CLPA 1G7CB 2J7WA 1YJVA 4WIIA 4ZVGA 2BXJA 1HMVA 2NXCA 2PFDA 3N5BA 1KH9A 2YQ3A 4ED0A 2OSRA 3PCOB 2JLGA 1N6QA 3DGPB 1KOOA 3MM5B 1H2TZ 3S6EA 4CNYA 5DQGA 4JV1A 4OX9J 2QLFB 1Y11A 2IM2A 2OPQB 4RW8A 3WX4A 1WJ9A 1XWLA 4CO5A 2GIRA 3CJSA 1Q53A 3U1LA 4XPEA 1WTBA 1WDTA 2BUNA 4LF6J 3IMQJ 4Q45A 5F8JA 2OJ3A 2BZ2A 5AXLA 3MMBA 4TQRA 1N2KA 1FTCA 5CYQA 3MUTP 4TYAA 4GTYA 4NWJA 3T1AA 2GGPB 3J7ZT 4JI5J 1VQOS 2B6AA 2DR5A 4UY8T 5K8NA 2JH3A 1H2VZ 3NBPB 4DUZF 1UA1A 4LFBJ 3R7BB 1N5TA 2LYVA 2VPZB 4UTGA 3RTVA 5LMUJ 2H51B 3VGTA 1RT2A 3JQMA 2NPFA 3IGNA 4C8LA 3FQLA 3OXLA 4CXSA 2CQ1A 2FGCA 2G2ZA 2RUSA 2BJ7A 2KYZA 4NCGA 1UCNA 5G0RA 5BYSA 2JEIA 1U2RA 3R5CA 1F3VA 1S57A 5KFSA 4BHQA 1NK6A 3M6XA 3RB0A 5GMKa 4K50A 1EP4B 2CG4A 2HPUA 3D2WA 2XI2A 2WVDA 3SYZA 1URAA 2ZH6A 1VGYA 5B0EA 2MKCA 4YB6A 2WHOA 4ZCKA 3AQPA 3D66A 1I3OB 4E98A 1QVGR 4B3OB 1HJKA 2C3UA 1NXIA 4HKQA 2HVZA 3HHLD 1AUDA 1QE1A 5DG7A 3OSPA 2YKMA 3LP0B 4KV8B 1EI6A 3AXKA 1S49A 2D1GA 3MEGA 2K8GA 1HHTP 1Q7LB 1S5ZA 1U09A 1HI1A 3MPWA 1UL3A 5CYMA 5B0CA 1UVNA 2ILZA 5HLFA 1JJHA 3NOGA 3W65A 3OJSA 2IVYA 4K59A 4DR3J 3IGYB 1CG2A 2HS0A 2KZZA 4I6YA 2PMHA 2W4DA 1X4EA 3W61A 2HMIB 4E0DA 3FCWA 4ZPBA 4M5GA 3R97A 5DGBA 1NK4A 3KG1A 1NJZA 3PFOA 4LF2A 4OZJA 4RW6B 2XS7A 1D1UA 2AJ0A 2FZCB 2JL9A 3I5AA 4FYXB 3CDBA 3OR1A 2DXEA 4KHMA 5BYQA 2YNGB 3JSBA 2BQUA 4ILMA 1TMJA 1O99A 1U6ZA 2QYCA 4KAVA 2QZ8A 2NYIA 2PO4A 3BM7A 4RJVA 5A2QY 1F5BA 4JI0F 3UR3C 5GVQA 4ILRA 3RBZA 2W5TA 3PTWA 2X1GA 2JC0A 1H7XA 3AT1B 3AQOA 4LJMA 4HT5A 1RQ0A 3MPYA 3RJMB 4B08A 1SKWA 4B3OA 2QL7B 1H74A 1O98A 3RAXA 2PD1A 2GLQA 5AJ9A 1R6YA 2VFVA 2ACYA 3DOLA 1SPBP 4I6WA 4KKOB 2VQFF 2XEXA 5HVHA 1TFWA 1EW2A 4X66F 1DQ9A 5KG7A 5CZXA 5JXSA 2W9CB 3TEGA 3KTQA 4JI5F 3TA1A 5A2QU 1NK8A 2JVOA 3I31A 1FTRA 3R1HA 2HAIA 1HBNB 2XULA 1ELOA 3CD5A 3DYAA 3TVYA 2XCAA 3MZIA 5KFFA 1VLYA 3I87A 3KJNB 2DNKA 1HWIA 1ZM2A 2H65B 1VQLS 2IAJA 5IM0B 4JI2J 1U2CA 1WC3A 4W92B 1RBOB 4MFBB 1FRJA 3M2UB 5T14A 2QE5A 1QY7A 4JUZA 4DJBA 3ZZUA 2XGQA 1ZTTA 1RU2A 1LWXA 3SV4A 3W60A 2DHAA 1XMOF 4DQQA 2LXFA 3HF5A 1KFDA 4RNNA 1CQNA 5E3CA 3I4HX 1N33F 1WUUA 4DZDA 4RW6A 3NKPA 5EX0A 1U8WA 2FD2A 4LRBA 1YHQS 3NRBA 1Q7YT 2CKWA 1Q8BA 1U4BA 4F4YA 1MROB 3DRYA 3BQ1A 2QMWA 1FT8A 5A0YA 4DV2J 4IG3A 3CF5Q 2MY8A 3B4DA 3HLUA 1N48A 4MAKA 2VICA 4J9SA 2WVEA 3AJ2A 4QYRA 3IXQA 3VR1A 2AZ1A 2M5YA 2MLXA 4BBYA 2MKKA 5LSRA 2LECA 1VBXA 2G0IA 2HQ3A 2JZ5A 2PE8A 2W7AA 3GYNA 1RTJA 4LRDA 4O4RA 4QIVA 1NSKL 4URSA 3MCSA 2ZC4A 4WK1A 4M5IA 3EGNA 1HBUB 4X62J 5LSOA 3TZXA 2COLA 2L48A 1NH8A 2DHHA 2B4VA 2QTWA 2ALZA 4F3OA 1CULA 3GR0A 1T0TV 1EHWA 2IRXA 1LWCA 1T02A 2F4FA 1HIYA 2RE1A 3DLKB 4OYXA 1ZAXA 4WFNQ 2Q79A 2L08A 3JYTB 1Y9OA 4KGMA 4PG4A 4DV5F 1T9TA 2XMKA 5D0EA 2MSTA 2AF6A 4GVBB 1JLBA 5E7OB 2PA8D 2FUG9 1AJDA 1ALKA 4ES3A 2C2RA 4EI2A 2ZHOA 3C6UB 4USTA 3TZYA 2OP5A 2W2OP 1WKJA 1UZHA 2LQJA 4EWTA 2BBEA 2V8HA 2HFOA 4OX7A 3NBPA 3R5GA 1KVJA 1GMVA 3H5UA 2BE2B 2H4YB 1EKSA 3NEKA 4OJGA 3Q8PB 3JYTA 3GQCA 1JWWA 3GV5B 2Z2LA 4Z7YA 5KT3A 3WAVA 3HO1A 3W63A 1RTIA 1XJWB 4U8VA 3C16A 1U1OA 3DOMB 2JEJA 3OL9A 3T9NA 4ICLB 2GQ2A 5D15A 4ITSA 5HL7Q 2H1YA 2FLPA 4P2MA 1NB2A 3LGHA 3DXSX 5B0FA 4PG8A 3V4MA 4CT9A 1R0BG 2HGMA 3UVJA 3TI0A 1S6PB 1O6XA 1LK5A 4A8YA 5EWEA 3A8EA 1RHJB 3TA0A 3IM8A 2AGQA 2GQCA 3W9JA 2IM0A 2NLWA 4HH0A 2RT3A 2CQ0A 4QU7A 4YR2A 3TO8A 4B3SJ 2Y8YA 2YKMB 3LP0A 4KV8A 2R2RA 1JLFA 2RQ4A 3PFEA 1K1SA 4W4MA 4Y0FA 2E66A 2O3DA 2OEKA 3RW6A 3K8WA 3T1YF 2K7KA 4ZIVA 1TV6A 5GADI 4LRFA 2WTFA 2G1HA 1TAUA 4DR1J 3OTEA 1IJEB 3FUYA 2OUGA 3QFHA 3VGUA 4F7VA 2BE2A 2I6WA 2HNDA 5ITHA 2FIUA 3KWMA 3CIZA 2EBEA 2NUHA 1IUJA 2KB2A 1S77D 4GMKA 5CA5A 1VIOA 4IQXA 4CO4A 1KP6A 5IS2A 3SQOP 1IM4A 4R8UB 4DQSA 5HP1A 4PUOA 4LRCA 4YHHF 1YITS 3Q2TC 1PSDA 2D3UA 1C0TB 4DX5A 1SQFA 2JHEA 3DRPB 4ECUA 1D3WA 2YNHB 2OELA 3P6YC 2ZKUA 3HHDA 2BANA 2GA3A 1YBAA 2D74B 4NWXA 4NRTA 1LWCB 4B3RJ 3JXOA 4BLGA 3NL0A 3MEEA 4LFBF 1CEZA 5J1EA 3CB4A 3OXFA 2XC9A 3SFUA 2ABYA 2GIFA 2BJ9A 4U95A 4DV6F 3O1LA 1BUXA 4B9TA 2MZ1A 2ZH5A 4PG5A 3MCNA 4HI2A 8AT1B 2W2NP 4LQ9A 1DARA 1HBMA 4QR1A 3CPWR 4K4XA 1KHNA 3JQJA 1IBMJ 1NDLA 1HA1A 2J0QD 5KT2A 1B0TA 3TA2A 2C2KB 3ZO7A 3AA8A 1V6HA 1URNA 1PAEX 3RW7A 3NG8A 4YY3F 5KG2A 1FRIA 2UXDF 3VQSA 5GAHI 3K0JA 3I55S 3T1HF 2BW7A 2GO9A 2VPYB 4I7FA 3BSAA 4ERDA 4C4WA 2HQFA 4R0EA 3VGSA 2IRYA 2XNQA 4JI3F 5IT9Y 2E7VA 2PA3A 1VQ6S 3WX8A 4YR0A 4NLOA 4J9OA 2GVZA 1ZZNA 1OY9A 2E5GA 4R5PB 1S6OA 4OZ1A 4RZRA 2NPIA 2DH9A 2GVDA 3M2UA 4WE1A 2P6SA 5KT5A 2V9WA 4FVMA 3TUIC 1QE1B 5KFKA 4TN0A 1EETB 2YNFB 2C3PA 2CQPA 1U1NA 1ITPA 4ZCLA 5ADZA 3OL7A 2CNOB 3I0SB 5AE2A 4CCHA 3OVAA 2KZMA 3T02A 2Z58B 4LFAF 3TNVA 4ZPDA 1CPZA 1DLOB 2OPPA 3MM9A 1Q95G 3IWNC 1FXLA 4DR4F 2HYIB 2EFQA 5DZ6A 2X1AA 2C2EA 1RWOB 2JSXA 1UFWA 3QT7A 1QLNA 1KONA 1TL3B 1UW9A 2B43A 2X7IA 3N6LA 3WHIA 1HD0A 1VRTA 2YWGA 3PG9A 1CBKA 4B3MJ 2CPHA 1RADB 2MQMA 3LW5C 4AL6A 1D09B 5IV4A 1GTEA 1TKTB 1HWKA 2AX0A 3VQTA 2EKNA 2H5JB 1T3OA 4X62F 3IRWP 2BABA 2W8DA 4ER8A 2UV8G 3M2VB 2RDDA 1RT5B 2F4VF 3QRQA 3MM7A 1L5UA 4ANDA 4J90A 1TL1B 2EWHA 2CA9A 1KHJA 1X5TA 4DPXA 1I5OB 3QRPA 5KG3A 4J37A 4NASA 2XMUA 4DL5A 5KFPA 2V94A 2W8SA 3UDLA 3KG0A 5E0OA 4ID5B 3DM2B 4ZPTR 4U7UK 1PC5A 4ECVA 2DH8A 2U1AA 4WE1B 1ZEFA 3K5NA 1VC6A 2D69A 1IM6A 1CJUA 5ETNA 4TU7A 4MY4A 3MD3A 3QGGA 2VG6B 2RS2A 2ZOFA 3KHRA 5HN0A 2AQ4A 3TP2A 4X4PA 1KSPA 1EQJA 1FE4A 1WD6A 4AQYJ 3CJQA 4OLPA 5I3UA 1N5SA 1T95A 2VDIA 4C6AA 3VWSA 1GNKA 2CQBA 3DLEB 2C3MA 4ZVQB 1L3VA 2IC3B 1MN7A 4FDFA 2RS8A 1LW2B 5C25A 4OYOA 2R8HA 3SZ2A 3DLBA 2VOOA 2CJBA 2JX2A 4RWXA 1HNZF 3MR7A 4NLXA 1L3KA 1T94A 3OFEA 4JB8B 4C98A 4FXVA 1TK5A 1FKPB 3GP9A 2QL5B 4CH1A 1SKUB 3GIRA 3H40A 4DL3A 4Y6IA 5IOLA 3PW7A 4Y3CA 4PKDB 3T3FA 1RYSA 3GFZA 2X1BA 2ZHBA 4YB1P 3M2RB 1VYAA 4KQZA 3IBWA 1N56A 3PR4A 2V8DA 1NB7A 2BEFA 4O0IA 1R0AA 1JLCA 1HR0F 2J9DE 2RRNA 2FTRA 1U0SA 3MPVA 1HYSB 1MW7A 2V4QA 2DKOB 4RUCA 4LF8J 4BC7A 1FVSA 2HHQA 1RGVA 3GMGA 4DOZA 2F1FA 2XZTB 4B3SF 1BC6A 4C0OC 5J2NB 3SQGB 2JVRA 4ZHRB 2CFXA 4K7QA 1QAYA 2UXCF 2E5IA 2HHTA 3LA0A 1RHQB 2HVEA 2ZKTA 3P5TL 4CM0A 3Q24A 4DL6A 2IUCB 1R43A 4K2JA 5E2QA 5GADU 1TKDA 4ZLJA 1NUEA 3T41A 4ALZA 4IDKB 4CTAB 2HIYA 2I9SA 3I9ZA 6AT1B 5HBMB 3M8QB 2KT3A 3R5AA 4FYVB 1Y4ZB 1FRXA 2RRBA 3M05A 5JMNA 2E1RA 4KO0A 1XMQF 1GH8A 2QC3A 3NGUA 4CLFA 2BYCA 5B08A 2FJVA 2HIQA 4OZ0A 1Y5NB 2QLBB 4AYBD 2RF2A 3CMRA 4O3NA 5IZHA 4PZVA 2LCWA 2W7PA 2DR7A 1HNVA 3HJFA 3GG1A 3Q8VA 2E1CA 3F73A 2WAQD 1NKBA 5A6WA 1G6BA 4TLQA 2DVIA 5EGEA 3G82A 3N6MA 1S9GA 3HULA 3IBCB 4QQBA 3PW4A 4RW9B 4WP3A 2VIHA 1WEYA 3NP5A 1CJTB 3GONA 1VQMS 3DLGA 2VDHA 1JIHA 4BS2A 5L9XA 2HRUA 3QATA 2XO7A 1HNIA 2LXIA 3RR7A 2OPSA 3ISNC 1HBUA 1X4FA 2OMOA 4KIAA 4EFAC 1XMOJ 4QYZK 2OEMA 3TYTA 3SZZA 2C2ZB 2M8HA 1F9FA 2E5JA 5DJBA 1ZOTA 1RWVB 3ETMA 5HATA 3SCLE 4B02A 1LXNA 4B3MF 4MK8A 2A1BA 1DBDA 3MMCB 1U0HB 1ZM3A 4Q8EA 4Y34A 3M6WA 2V2KA 2BVZA 4UUWA 2F8HA 4KPYA 1JLFB 1ZAWA 2VBZA 3H7HB 3RYLA 5IXUA 3V2UC 5GOVA 5D3GB 1JNRB 1O0PA 5HP1B 2KXFA 4R8UA 4JV2A 4GTWA 4CP5A 5CXTA 4K2XA 2DCUB 1XTZA 1SVDA 4OYZA 1BWVA 4WBFA 2OAUA 4YR3A 4DV2F 4PYAA 2GA7A 1S1VA 2Y3YA 2ZUGA 4F25A 1YQHA 1LQ9A 3TOQA 2JLEA 4RU2A 4IRCA 3ENAA 1U47A 4M5NA 3TR5A 4YP3A 4NLSA 1FDBA 5A8KA 2MKYA 3MCMA 3UCUP 4EBCA 3HHKA 2FHKA 2B0GA 4RW4B 1VJQA 2CYYA 1VR6A 3FCHA 4QBUA 3G6YA 3KHHA 3TUPA 4LF4F 2NXNA 1Q8KA 3M9MB 3PV8A 3FEYB 2VBYA 3WBHA 3GJQB 1BHNA 1S79A 4O0NA 5ETTA 5DM6Q 1RT7A 4AXIA 1WC6A 2LEBA 1C0UB 4JYAJ 1YI2S 4Q8FA 1FEEA 2CJQA 3MM6A 2W5SA 4UPKA 2HHHJ 3T1HJ 2DGWA 1SC3B 1S6PA 1RTHB 1S1XA 2V8VA 3CJKA 1WC5A 5HSPA 2B56A 2X3DA 3DMJA 3UI3A 1IWAA 3RBDA 1J5OB 2DPJA 2W5VA 1FRLA 3SMZA 4WIQA 3CCES 3PX4A 3R5DA 1RT6A 3SIPB 1DAXA 1M1GA 1XR6A 2HKEA 2OGUA 4KHPJ 1HHSA 2AEFA 1S1TB 2CQDA 3C14A 4MKAA 1U0HA 3AB4B 2DRAA 4O3QA 1YJTA 5HO4A 3U1NA 2YQ1A 1GEHA 2IM1A 4J9VA 5ETQA 1N5YB 2QEXS 4DSJA 1HQAA 1VOMA 2YPYA 1S1UA 4A8QA 2YNGA 3HX9A 2HHUA 1NPPA 2XR9A 2MEWA 3CDEA 3OR1B 4MIWA 4YB7A 3UDVA 5KTQA 3H5XA 2OD4A 3JS9A 2EFVA 4I68A 1T3NA 5DG8A 2QV6A 3R8YA 4QWDA 4J9RA 4A8KA 4LFCF 2IJNA 2J5AA 2F8EX 3W8PA 5F9LA 1WOSA 2YQ0A 3N4WA 3Q83A 4JI4F 3G9CA 4X4VA 2VFUA 1RWNB 4Q2MA 3C14B 3EUNA 3U1MA 4B9VA 1FX4A 1S1TA 1TUVA 2B9EA 3QZ8A 2FY1A 2HFVA 2IYIA 2PEHA 3TVZA 3DN9A 6FD1A 4Q2LA 5HMXA 2OO4A 3DMJB 4HYKA 4B3TJ 1CQMA 3W3SA 5INHA 1NKCA 4XIUA 2DXFA 4I4BA 3MPUB 2HZVA 1SQGA 4F0HA 1Q16B 1HPZB 4WWSA 3F41A 2LA4A 4DCJB 1SUQB 2A6MA 3CJ3A 3UPFA 4DL4A 4WKYA 4ZLNA 4P2SA 1GQEA 4L75A 2LFVA 4ETXA 5LT5A 4LF9F 1RAEB 1X0PA 1DJ0A 2BKPA 5D77A 1ELYA 4OFZA 3MUMP 3NGDA 1QUVA 2UUTA 3K58A 2ADBA 1REVA 1RT1A 2ZJRQ 4KJGA 4MMOA 4WZMA 1M0SA 3GYGA 2DHGA 5DDRC 2CQ2A 1VCTA 3ENQA 3RBXA 5F8MA 2WCXA 4KGVB 3A12A 5ETLA 3A4TA 5ETVA 1KS2A 2DNMA 5KFHA 4Q5VA 3G6ES 1N36J 4ED8A 2A6OA 1RLCL 3DHWC 3NS5A 3KXDA 3OJUA 5J2PA 4J7CA 2LQ9A 3KOAA 3H2VE 1JLEB 3FGVA 4JI6F 1OY6A 1CULB 1FFGB 3D9BA 5F8NA 2P2CB 1XC9A 2HHPA 3HZEA 4EBEA 2WK4A 3LPEA 3OQ2A 2HQIA 4LSZB 4KFBB 1RA7A 4EO8A 4UOGA 1SV5B 1WTFA 1EKRA 4ES2A 2YX1A 1WEZA 2LA6A 4P10A 4EGLA 4CI0B 1G3OA 1HBOB 1YBUA 2NXUA 3W66A 3HVRA 4EBDA 5H9EK 4FF2A 5ETMA 1SH3A 4DFPA 3IWXA 1KHLA 5M2PA 4Y2KA 1VQ4S 3NKQA 2HK3A 3HZGA 3CD7A 2I5JB 3HMJG 2N4CA 4PAAA 1WHYA 3ETOA 3RGIA 3FBCA 4CO1A 5AJ3J 2M3DA 4C2MA 4OI6A 3HT3A 2RU3A 2KFZA 1U2FA 2CJKA 1XQIA 2ZM6F 4FVCA 3PO4A 3GJSB 3A8IA 2DK2A 1M5OC 3ZXWA 3VAJA 2BJEA 3PXGa 4BCAA 4JI3J 4N7TA 1ZEDA 1A6LA 2O5DA 2VPXB 2DEJA 3IS9A 4CO3A 4LQYA 1TZ0A 2BKNA 1VQ7S 1U49A 2AZ3A 3W5YA 2W4CA 4DR2F 2BDPA 1SB6A 3QT6A 4ECQA 5IM0A 3Q22A 2VF3A 3IRXA 3R5BA 2AW0A 3AJDA 3BDPA 5GAGI 5IWAF 4TU9A 2W2MP 5HQLA 2NREA 4FYDA 4ZLLA 2HWIA 2ZBQA 3UWTA 2CNKB 2DIVA 1TL1A 3BN4A 4LBHA 3TJ8A 5J2MB 3TUZC 3M8SA 1XNQJ 2Q66A 2RILA 1E6YB 3ENVA 4HT7A 2WSCC 1N2LA 3ZTRA 2DNYA 2M2BA 3BR8A 1OJ4A 2XMAA 5L1LA 3RZAA 2DO4A 1ED8A 1QD1A 4ZOSA 4N8OA 3CDWA 2E7WA 3EXCX 3KDOA 1WACA 5D4PA 1JLCB 2AJ1A 2YTCA 1RCXB 1RT3A 2E1PA 1OPZA 3EJMA 4MIBA 5F8LA 2MQPA 3PKYA 1Q81T 1Q0NA 4NA1A 3DLJA 2RUGA 5AJ3F 5GMEA 5K8MA 2GO8A 1U26A 4G1QA 3NS7B 1IBLF 2O1PA 5GAEI 4OHYA 1SIWB 3N28A 1RUSA 1KLMB 2RHQB 4F04B 2ERRA 1WG4A 3B4MA 2F3JA 1IKYA 2VBXA 4JBCA 5CYQB 5BR8J 4CO0A 3MFHA 4LR2A 2HFNA 4J91A 5HQMA 2V5HG 1HWLA 2V67A 4G1QB 5L8RC 3FBBA 4MH8A 3RRHA 3PO5A 3QJJA 2YWFA 1R8CA 3N5FA 4FKXA 1EIYB 3MR5A 2XB2D 5HROA 2YWHA 1GXTA 3I5BA 1Q78A 1FJ7A 1RTZA 1E2SP 3M6VA 2MPUA 8ATCB 4CLUA 1QTNB 2KXNB 2ZD1B 4CYUB 4RW9A 1WWHA 3FRYA 5HLFB 2GCFA 1S76D 2KVQE 5F41A 2UUAF 3NKMA 4MK7A 4M5KA 4DV0F 4LF5J 3ZC4A 3AY0A 4J9LA 3LALA 2E5LF 3FBFA 2XGPA 2DNHA 2RB7A 3MHYA 1XMQJ 3BDFA 1AT1B 1AB8A 1TR0A 5KOXA 2YWWA 1CJVB 1LFPA 2L9DA 4Y2AA 3S8SA 1REGX 1QJHA 3E2EA 1IR0A 3FVYA 5I3PA 5HJYA 4IH6A 1EB0A 3KLHB 3CC2S 1MMDA 4B9MA 4Y65A 1FK9A 1KVKA 2GJIA 1Q8IA 3QLHA 5BYRA 3HK2A 4GKKF 3UDCA 4DPOA 4HVZA 1VIXA 1WG5A 4O3OA 1FXDA 4DR6F 3JAMU 3BDEA 1FNMA 1AJAA 2VOPA 4GC7A 3KJVA 1RJJA 3BSCA 3IG1B 4PQAA 5KFIA 4PWUA 5F9NA 5JUMA 1SJFA 4LMZA 2G2YA 2ZH2A 4NLUA 3GYXB 3P3DA 1KNZA 1ZM9A 4C97A 3ZTPA 3I4PA 1H3DA 2HMIA 1TP7A 4OJHA 3TAQA 1NU4A 2K3KA 1IKYB 3NGSA 5FDLA 3OTOJ 1RAFB 3CULA 2ZWOA 3QSYB 4KE5A 3H4BA 1U8SA 1VQKS 4G6VB 1UPPA 3D1QA 1PYSB 1RWWB 2KRRA 1UWBB 1N88A 3D1HA 4OYBA 3J7A1 4AL5A 3NKNA 2MQLA 1H6KX 3K5OA 1UVJA 2IRUA 3AJ1A 2MY7A 5LM7E 4L76A 2ALYB 1YDLA 4DFJA 2BOPA 2JEGA 2VJUA 4B9SA 1ANJA 1UETA 3DLGB 4DV5J 3PX6A 1CSJA 1P1LA 1EETA 2P6TA 4WFAQ 1H38A 1UEVA 2SXLA 1YZ6A 1EP4A 1QSSA 4KRWA 4OYAA 4ZVHA 1ZAVA 4PXCA 1Z4UA 4JV5J 1WEXA 1ZZFA 5D0RA 1TTHB 2DNQA 2W4PA 5G0RB 4CLZA 2C2NA 4NZ0A 4OHXA 4M95A 5L1JA 1HQEB 1OYEA 1NHVA 5L0BA 4P72A 1I94F 2ZUAA 1QAXA 3UQSA 1ZPWX 2HNZB 3SXLA 1VQNS 3V81B 3DYCA 3NGTA 4L73A 4CXKA 2CPJA 3MCOA 2E9RX 1RDRA 4ZITA 5IWAJ 2J6TA 4KC5A 1OIAA 1LK7A 1WC4A 5KOWA 3HHLA 1IKWB 2DEIA 1GMUA 2XMMA 1HBMB 1R7IA 1HPZA 2MTLA 4L3KA 2PGCA 3UNYA 4QWAA 4IDKA 4CTAA 4X65F 4NLTA 1NJXA 2OD6A 2RIJA 3TJ9A 3FBEA 4N76A 3R7NB 1X9WA 3NWGA 1NK5A 2W5WA 1DHMA 3M8RA 4LF7J 1OYDA 4DG1A 2ZVIA 1YJ7A 3UN2A 3VTIA 1LEOA 4X64J 3QQCD 5H1SV 2HBZB 3K57A 5B0DA 1QSYA 2Q6BA 1YTYA 4NXNF 3FDSA 5J2QA 1M1HA 3PACA 4ED3A 3WC2A 1NJWA 4EK2A 3OL8A 3FSIA 1FD2A 1T9XA 3EGVA 5DQIA 3KLFB 3JSMB 3WAXA 3G87A 2HVHA 4QYZJ 2HQCA 4P7VA 4UZBA 2NSCA 2R3VA 1AFIA 3D0HE 3CCUS 1S48A 1TUGB 2PDAA 5LMNF 3M1VA 2KHDA 1PIEA 2LU2A 2W1BA 3AD9C 2PC6A 3KFWX 1RHRB 2DGTA 4H4OB 5HJXA 2HWHA 1Y7AA 1NBEB 3KJVB 2O66A 3MAQA 3UE2A 1D9DA 2KH9A 4K4WA 1FA0A 1NKEA 2CQ4A 5L46A 4M5HA 1ZA1B 2LVWA 5E3QA 4L3NA 4DG1B 3KK1A 4JI8J 2FHOB 1J27A 2B5JA 2XSJB 5LMNJ 2UXDJ 1Q5YA 2KFYA 1RP5A 1TVRA 1RT1B 4ZVPB 2LKZA 3UFCX 1GXLA 4LF7F 3J80U 2IFYA 4MKVA 2ZH8A 2RKIB 4UOPA 3GSIA 3P45B 5EUHA 4KPCA 4USVA 2DGXA 2R7RA 1YKWA 4FF4A 1MN9A 1UPMB 3FNNA 2YKNA 1IKWA 1Y3KA 1IKVB 4HACA 1SC4B 2ZDOA 4DFKA 3NOCA 4KGXB 2VG5B 4DSLA 4DU7A 1KQSR 1Y5LB 3HSGA 3HSDA 2CNNB 2GMHA 4NA2A 4NLDA 2A10A 1D0EA 3KK2B 5DLWA 5K8OA 4QR0A 4ID8A 1QAIA 3KDNA 1TKZA 5LQQA 2DGSA 2DD8S 5JVHQ 3V6KA 5A0YB 4K4TA 3RRGA 5KXAA 3C8YA 1YJ9S 3G6VA 2R42A 1YJRA 2ZDPA 1TVRB 4ENOA 1F3FA 4ICLA 2O01C 4QPXA 3G4SS 1R8HA 3BPDA 4P52A 2XMJA 3RG6A 2VJVA 3NS6A 2KVIA 3EZUA 4ZHRA 2CDRB 3BS9A 4H4KA 4A8FA 2HNYA 3WBZA 4M63A 4DV6J 2GSUA 2OFGX 3C3LA 2YH1A 5DGAA 1JB0C 3Q8UA 1RKJA 2LDIA 4DX6A 4ZVEA 1FJGF 1PJ5A 1F2HA 1RCOB 1HQUA 2DH7A 4ZP8A 3W1YC 5LJ3Y 2V0NA 1AJCA 3CDAA 1NK0A 2C22A 4WP8A 1DTQA 2E9TA 1VI7A 3DDKA 2MGZB 3D5MA 2UUBF 1UFKA 2YH0A 3LUYA 3IA0A 3FZ2A 3CJ5A 2ZZMA 2AEMA 3I0RB 3L09A 5K14A 2YPZA 3QO9B 5D6GA 3IG1A 3P5BP 3H5SA 1ICEB 4LIWA 5E33A 4DV4J 2MZTA 2HW3A 3EGWB 4XO0A 3L95X 3R27A 3KYLA 2UVRA 1HDHA 2W2QP 1C0TA 2OPPB 2FZKB 2HS4A 4UQGA 4QIEA 3TVKA 3CCVS 3EPIA 2QLWA 4RR5A 1A7GE 2B4PA 3I0SA 4U7CA 2D3OR 1K73T 3BYRA 1U7LA 2QSFA 4KHPF 3NY0A 2OMLA 4DLGA 1W2BR 4LF9J 1JLBB 1RWMB 4XTTA 3KLEA 2A0FB 3J7AN 2MKHA 2PSZA 2CJYB 1YJUA 2R7WA 3V4IA 2EXUA 2FJBB 2XYGB 3Q8QB 3T5KA 2AYMA 2QMUB 2ASDA 4OI0A 1FK9B 2DJWA 1JKHB 3HXMA 3Q23A 2FLOA 3TWZA 4DPTA 2V4RA 2J0SD 2WSFC 5KFXA 2GFFA 1NDKA 3BO2A 1RXOB 1ZEBA 3HDSA 5DS7A 3KNAA 5DLVA 3IAS9 3O6QA 5D4OA 4OX9F 4IR9A 4YB5A 2ZH9A 2AWZA 3QT5A 4QWCA 2EC2A 3GIKA 3EMTA 4B3TF 4M94A 1S6QB 1Y5IB 1S12A 3IR6B 3ZZYA 4U9RA 2M8DB 4M8LA 4J9KA 4LR7A 4TYBA 1L3TA 2ZD1A 3X3UA 3M2VA 3ED4A 4ECYA 3MXHP 3SSRA 2V69A 2A3JA 4NYZA 3PVXA 2VD3A 4NLPA 4PXBA 3CCJS 2UUAJ 2VASA 2WONB 1V5IB 5A8RA 2N3OA 4ATNA 1URRA 3THVA 1DTTA 3QAEA 3LQVA 3U02A 1SHQA 3O8WA 4ZPCA 5EX3A 2E5LJ 1NEEA 2B9XA 3TZZA 2N82B 1X60A 1RYRA 2B51A 4J9NA 4MTPA 3ZZPA 7FDRA 4TKTA 4J9MA 3BSNA 4DLEA 4A8SA 1FNXH 4L72B 2HSEB 3KKFA 2IJFA 4A8OA 4X4SA 3TAPA 3B82A 1YRXA 4DSKA 2CDQA 3MEDB 1N54B 1PKUA 2DGVA 4LVNP 4YUDA 2Z4PA 2P5VA 1X8DA 4K8RA 5L38A 4C3KA 2W9CA 4UPIA 1DLOA 1B64A 4CYUA 1KQGB 1S7IA 1N0VC 2VPWB 3GPAA 4DPUA 2D3ZA 3HT0A 4DR6J 3DOLB 4ED7A 3BN7A 1REVB 5F0UA 5D8HB 4V19X 3AFGA 1GT8A 1V5VA 3OTBA 1RT2B 4E2FB 3GZ7A 5C7PA 1AZSB 2OKQA 3MI7X 4PWDA 3DLLQ 1Z1ZA 2CPZA 2CWKA 2R7UA 1ELZA 4C3MA 3GV7B 3OLBA 3SDEB 3OFFA 2KU7A 4F0KA 1RI7A 3D3BJ 4UPHA 1KLMA 3SCJE 3L7OA 2GV1A 4CWBA 3W2VA 1YVFA 2F63A 3BGUA 5KFQA 5KG1A 3KMSA 1CLFA 3MM8B 5K9FA 4ZIWA 1SCJB 3C15A 4GC6A 1HNWJ 2P9EA 1KTVA 2MZQA 2I5JA 4ZVFA 4WZQA 4OJ1A 2CPDA 3QBCA 2XCPA 4KR0B 3BJYA 4CNZA 1AZSA 2DTJA 2NZCA 3QIPB 3RU0A 1XNQF 3BDGA 3TG0A 1HFEL 5FD1A 3ISZA 5HVGA 3N0VA 3EZ5A 4AD6A 1HMVB 1VK3A 2BACA 1TQLA 5JVGQ 3A13A 3C19A 1MROA 3GR1A 1XR5A 1WF0A 5EWGA 1N33J 2KM8B 3LAMA 4HDGA 4Y2MA 4OMFG 2H3EB 3OT9A 4EYIB 3DRXA 2Q3PA 3ZTQA 3BO3A 1VRUA 4ECSA 1M5PC 4EO6A 1APSA 3HKZD 1C4AA 4PEOA 4HR2A 1SBRA 3N01A 4HHHA 2YKPA 1FESA 3NGRA 4QWEA 1SJRA 4RO0A 4ZGAA 1NSQA 2KT5A 3IS9B 3VVTA 3D6MB 2XMTA 3PR5B 3LWLA 1UVLA 3K8VA 4MHXA 3HFZB 2IAJB 3FSXA 4KAYA 1UA0A 3MTKA 3EYZA 1H2UX 2DRBA 3CCLS 2CADA 1RKIA 4K0KF 2H4WB 2FYXA 5F3TA 5FIIA 2JRSA 1FF2A 3MFIA 3EX7B 1D8YA 4C8ZA 5J2PB 3CT9A 1P9YA 2J9DA 2P9GA 5ETSA 3G71S 3VV2B 1LW2A 5C25B 4GVBA 1O51A 5RUBA 4QPTA 5EDWA 4PCQA 2EPIA 1HI8A 3N79A 4F0MA 2FHJA 4X64F 2C28A 4RKUC 4P6QA 2JFKA 1KHWA 2V2VA 5HMZA 1B7FA 1C1CA 3BQ2A 1YWXA 4UPLA 2VU5A 3KLIB 4U67Q 2IHR1 2BQ3A 3PIOQ 3DRSA 1S1WA 1UFLA 3D6TB 1LWFA 3E51A 3J7YI 3M9NB 2DRDA 3PJWA 5LMUF 3OLAA 2EG1A 4HH1A 4OLOA 3W5XA 3MR2A 1WORA 1U45A 4CRJA 3PYGA 3B5QA 2RNEA 3Q0AA 2OEJA 2DITA 5E3PA 4BC9A 1WELA 1LW0B 1NPRA 2OPQA 4NPOA 2ZBCA 4RW8B 1JLGA 5AXKA 3UD4P 3R2CJ 2DNRA 1EJJA 2C3OA 2ZNZA 4AQYF 4OI4A 2KG1A 2FPHX 3CMAS 4JOUA 3T00A 1U1MA 4Y00A 2A2CA 4FF1A 4NCAA 1UP1A 4LF6F 1XMBA 4QU6A 2QA4S 1T8EA 2AYBA 3CVKA 1HBOA 2HEKA 2QA1A 4USKA 5C42B 5A76A 1QDUB 4EMDA 3C15B 2ZHAA 2DBBA 3LWMA 2RDJA 1HNIB 3X1LB 5C24B 1EARA 3W62A 2W8KA 4DU8A 1NH7A 3LP1B 3GJTB 3T01A 2B7BB 4C9DA 3VAHA 4LFCJ 3D68A 1CJTA 2XQCA 4PR6A 4AFFA 4DR7F 5HMYA 1IVZA 5KFWA 1TKXA 4TVAB 2W9BA 2HHVA 3EZOA 3WAWA 4OIXA 3FK4A 2KJWA 1U25A 2FVCA 1S0NA 1S9GB 2MKIA 1G2EA 3G82B 4CYSA 2QFIA 3HVWA 2XHCA 4PXEA 3H59A 2I38A 4ZP9A 5I42A 3BREA 4WXWA 2MHEA 2N7CA 2RH6A 1X4AA 2BQRA 2XHWA 1K1QA 3HFVA 4P73A 3Q89A 4D3HA 4DXLA 2UVUA 4K0KJ 1Y0HA 2HLUA 4GKJF 2AJ4A 1HW9A 2J76E 3QWUA 5HBMA 4ZMMA 1X4GA 1WDDA 2HZCA 4Z7CA 3OFGA 4ZPAA 4WCEQ 2GNKA 1S9EA 1SQEA 1NPKA 3OUYB 5CD4A 1XERA 2R2UA 2IFXA 3LGNA 2ZOGA 3F56A 5A8RB 4JI4J 1OQ6A 1V3RA 3KHLA 3SQGA 4ZLPA 2J7UA 2RDIA 1SI9A 3MMJA 5J2NA 1E1ZP 5T7LB 4YY3J 1NSPA 1Z2ZA 2KJVA 2UV8A 5KFMA 2B9YA 3IR5B 4WXOA 2B8PA 3UVJB 3CDUA 4CLLA 1GX6A 5KFUA 4F4WA 4DWIA 3C46A 5J1EB 5F8GA 4RBTA 4A46A 4FPIA 4C8YA 1MSWD 1BQNA 1T03B 5AE3A 1RT7B 2CQGA 2CNLB 1S1WB 1YG0A 2NYHA 1S4FA 3WZ0A 2PI4A 1UVMA 1FSUA 5DLTA 3EXYA 2DGOA 3OSNA 2FZGB 2BJ3A 1RB0A 4KGKA 3DDIA 4RW4A 4DCOB 3W8GA 1ROFA 2YNHA 1URBA 2DY9A 2PIIA 4NYOA 1FWLA 3NWRA 2EG2A 1HW8A 1TMMA 1UVIA 2AHOB 5AT1B 1FERA 2H5EA 3VZHA 3LP2A 3PRBA 2AYEA 4KYZA 2IC3A 4HHUA 2VQRA 1BMQB 4BWJA 2YY3A 4ED5A 4WYWA 3BSOA 1B8JA 4DZ6A 1UAWA 4KKOA 4LBIA 1SKRA 2HHWA 2AKWB 5D3GA 1S1XB 2X98A 3GILA 4IOCQ 3OV7A 3BGLA 2I2YA 2VC1A 1R6VA 2HGLA 4E8UA 5K5MA 3OVSA 3DLHA 4F02A 3FSYA 5CABA 4X65J 3H4DA 4A8WA 1PGZA 3RAMA 1ULRA 1DZ5A 3A52A 3K7RA 4DV7J 1YK9A 1RTDB 3JSRA 3PEJA 3PHEA 4EU0A 2XZDB 3DM2A 1R8AA 1I51B 4DN9A 5DLGA 2N4DA 1U1PA 1ZA2B 4DEZA 4WJBA 1Q1KA 1T05A 1EW8A 4PQUB 2FGOA 1FCAA 4NLRA 4YS2A 4ED4A 3DPCA 4ZVTB 4A47A 2Z56B 2Y1LB 4O44A 4B56A 5BXIA 4N77A 2OHDA 1KEKA 3TZWA 3DC2A 2HBYB 2J8SA 3WQPA 2VONA 4UF4A 1N34J 2J6UA 4F4KA 3BDHA 3CCZA 2V2ZA 2DISA 2ZM6J 2HVIA 3WIUA 2XLKA 2W5QA 1SXLA 4AT1B 1KTQA 2LLZA 3VVUA 3MM8A 4YN3B 2XLJA 2XY5A 3KK2A 4XDCA 1T9VA 2GMJA 3GCWP 3HHLB 4JV5F 2N3LA 4ZCMA 3T5HA 3ONQA 4I67A 1HARA 4DN0A 3KMQA 4GTXA 1PC4A 2LEPA 5E3RA 2VB6A 3V81A 4CLTA 1UJ4A 4MFBA 5THWA 4PWDB 1MG7A 3MGJA 1AW0A 4JV0A 1NRKA 3FKBA 4RBUA 2R9LA 3DLEA 4KT0C 2KKHA 3MK1A 3EVWA 4ECWA 2PT0A 1HBNA 2YNFA 2IIHA 1BY9A 2Z0GA 2VODA 4ZG7A 2QSWA 2W7OA 4X4UA 3PYDA 2GQQA 4X84A 3AAWB 3OTOF 4F8RA 2UUCF 3EICA 4ZPWR 4N5SA 2MQOA 1BQXA 3LP1A 3I5CA 4C48A 4NYPA 4H4OA 3S01A 1XEZA 1VISA 1RAGB 1S59A 1PYOB 2JNJA 3M1VB 4HTJA 4ID5A 3I32A 3TQ1A 4QOTA 3K5MA 1TELA 3OR2A 1P1TA 4NE9C 4TU8A 3D6HB 3ILLA 4F4AA 5CD4H 3S7RA 1BE4A 1KLNA 1AJBA 2ZVSA 2WOMB 2AD9A 1F60B 3DOKB 4IFVA 2BM0A 2F9JA 2DNLA 4MKBA 3DGPA 4RL1A 5K4PA 1NLKL 2DR9A
chains in the Genus database with same CATH topology
4KJGA 5GRRA 1AJAA 1AJDA 3T02A 1ALKA 1E1ZP 5L0EA 2IUCA 3Q3QA 3OT9A 4UORA 1URAA 5L0KA 4UOOA 1HJKA 3SZZA 1KH4A 4CXUA 1AJCA 3NKOA 4ZG6A 4LREA 2ANHA 1FSUA 1KHKA 5DLTA 3MK0A 3IGZB 4ZGAA 1EI6A 3WAVA 4MHXA 1URBA 2D1GA 3NKNA 3KD8A 4KAYA 2W5XA 4GTZA 5GOVA 3M8YA 3UN5A 2W8DA 3MK2A 1HDHA 1KHLA 1ANJA 4GTWA 3IGYB 1E3CP 3NKQA 1KH5A 2VQRA 3TX0A 1KHJA 1SHNA 4FDIA 1B8JA 1Y6VA 2W8SA 3NVLA 4YR1A 5LRMA 3BDGB 2X98A 1E33P 1ALJA 4QAXA 2GSNA 5C66A 1O99A 1ZEFA 4KAVA 5L0BA 4N7TA 1ZEDA 3M7VA 1KH7A 3IDDA 3DYCA 4MY4A 4LQYA 4UPLA 3TWZA 3A52A 4FDJA 1AUKA 2W5TA 3WBHA 3WAYA 4CXKA 5LRNA 4LRFA 1EQJA 1ZEBA 5IJSA 1ED9A 3LXQA 5DLVA 3UO0A 2W5SA 4LRAA 4UPKA 1O98A 2GLQA 1EW8A 4UPIA 5AJ9A 5TJ3A 1EW2A 3B5QA 3UNYA 1N2LA 3DPCA 1ALIA 2W5VA 4LR7A 2XRGA 5LIAA 4B56A 3ED4A 1EJJA 1ED8A 4LRCA 2W5WA 1ANIA 3T00A 3UN2A 3BDHA 1SHQA 1HQAA 1P49A 2G9YA 2W5QA 1ALHA 2GA3A 4NWXA 2XR9A 3WAXA 3M8WA 4LR2A 4GTXA 3T01A 3NKRA 1Y7AA 3NKPA 4LRBA 4LR9A 4KJDA 1KH9A 5HRTA 1KHNA 3WAWA 2IUCB 2ZKTA 3MK1A 5EGHA 4CYSA 1E2SP 1K7HA 2GSOA 4ZG7A 2IFYA 4KM4A 4UOPA 1ELZA 4LR8A 2RH6A 2W5RA 3E2DA 3NKMA 5INHA 2GSUA 4LRDA 3M8ZA 4UPHA 3BDFA 1N2KA 4GTYA 4NWJA 4MIVA 3CMRA 3UN3A 4ZG9A 5DLWA 5IJQA 5LQQA 1AJBA 4TN0A 1ELXA 1ELYA 4CYRA 1EW9A 5EGEA 3SZYA 5KXAA 2QZUA 3TG0A 3BDGA 5K4PA 4CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJG A;  5GRR A;  1AJA A;  1AJD A;  3T02 A;  1ALK A;  1E1Z P;  5L0E A;  2IUC A;  3Q3Q A;  3OT9 A;  4UOR A;  1URA A;  5L0K A;  4UOO A;  1HJK A;  3SZZ A;  1KH4 A;  4CXU A;  1AJC A;  3NKO A;  4ZG6 A;  4LRE A;  2ANH A;  1FSU A;  1KHK A;  5DLT A;  3MK0 A;  3IGZ B;  4ZGA A;  1EI6 A;  3WAV A;  4MHX A;  1URB A;  2D1G A;  3NKN A;  3KD8 A;  4KAY A;  2W5X A;  4GTZ A;  5GOV A;  3M8Y A;  3UN5 A;  2W8D A;  3MK2 A;  1HDH A;  1KHL A;  1ANJ A;  4GTW A;  3IGY B;  1E3C P;  3NKQ A;  1KH5 A;  2VQR A;  3TX0 A;  1KHJ A;  1SHN A;  4FDI A;  1B8J A;  1Y6V A;  2W8S A;  3NVL A;  4YR1 A;  5LRM A;  3BDG B;  2X98 A;  1E33 P;  1ALJ A;  4QAX A;  2GSN A;  5C66 A;  1O99 A;  1ZEF A;  4KAV A;  5L0B A;  4N7T A;  1ZED A;  3M7V A;  1KH7 A;  3IDD A;  3DYC A;  4MY4 A;  4LQY A;  4UPL A;  3TWZ A;  3A52 A;  4FDJ A;  1AUK A;  2W5T A;  3WBH A;  3WAY A;  4CXK A;  5LRN A;  4LRF A;  1EQJ A;  1ZEB A;  5IJS A;  1ED9 A;  3LXQ A;  5DLV A;  3UO0 A;  2W5S A;  4LRA A;  4UPK A;  1O98 A;  2GLQ A;  1EW8 A;  4UPI A;  5AJ9 A;  5TJ3 A;  1EW2 A;  3B5Q A;  3UNY A;  1N2L A;  3DPC A;  1ALI A;  2W5V A;  4LR7 A;  2XRG A;  5LIA A;  4B56 A;  3ED4 A;  1EJJ A;  1ED8 A;  4LRC A;  2W5W A;  1ANI A;  3T00 A;  3UN2 A;  3BDH A;  1SHQ A;  1HQA A;  1P49 A;  2G9Y A;  2W5Q A;  1ALH A;  2GA3 A;  4NWX A;  2XR9 A;  3WAX A;  3M8W A;  4LR2 A;  4GTX A;  3T01 A;  3NKR A;  1Y7A A;  3NKP A;  4LRB A;  4LR9 A;  4KJD A;  1KH9 A;  5HRT A;  1KHN A;  3WAW A;  2IUC B;  2ZKT A;  3MK1 A;  5EGH A;  4CYS A;  1E2S P;  1K7H A;  2GSO A;  4ZG7 A;  2IFY A;  4KM4 A;  4UOP A;  1ELZ A;  4LR8 A;  2RH6 A;  2W5R A;  3E2D A;  3NKM A;  5INH A;  2GSU A;  4LRD A;  3M8Z A;  4UPH A;  3BDF A;  1N2K A;  4GTY A;  4NWJ A;  4MIV A;  3CMR A;  3UN3 A;  4ZG9 A;  5DLW A;  5IJQ A;  5LQQ A;  1AJB A;  4TN0 A;  1ELX A;  1ELY A;  4CYR A;  1EW9 A;  5EGE A;  3SZY A;  5KXA A;  2QZU A;  3TG0 A;  3BDG A;  5K4P A;  4CXS A; 
#chains in the Genus database with same CATH topology
 1SL2 A;  2UXC J;  3KJQ B;  4JYA F;  2MSS A;  3ZFV A;  1ZS6 A;  3BGR A;  3MEC A;  4L74 A;  5GAE U;  4NRU A;  5KFG A;  2ZZN A;  5CQG A;  3NNC A;  5L0E A;  3THT A;  4FXW A;  4QJV A;  2IUC A;  5J1P A;  3J7Z 5;  3NKY A;  4IFY B;  1TU0 B;  2VFT A;  2UUC J;  1RA6 A;  2BKO A;  2C1E B;  2NXE A;  3HD1 A;  3Q2S C;  4R0J A;  1SL1 A;  3VAG A;  1R89 A;  4DS4 A;  2NQP A;  3TX8 A;  1NHU A;  2MZJ A;  2HBQ B;  4DV0 J;  4LF5 F;  1IJF B;  1LWF B;  3C66 A;  4NA3 A;  2V68 A;  1RAH B;  4ZG6 A;  2WOM A;  3L4B C;  2CJX B;  3ILO A;  4OYW A;  5KG5 A;  3CCM S;  3N9U C;  1CJU B;  1NK7 A;  2CWX A;  1FWP A;  5B09 A;  1PYT A;  2VFS A;  2XG8 A;  1C1C B;  5KFD A;  5D0G A;  3CJT A;  3G8Q A;  2VA3 A;  2BJD A;  4U6P A;  4FYY B;  4MK9 A;  1RLD A;  4NEY A;  3UW1 A;  2DB1 A;  3GIM A;  4K5S A;  3BYP A;  5KFA A;  3IAM 9;  5DET A;  2RD5 C;  1FKP A;  4G1P A;  3UCZ P;  1V3S A;  2YXL A;  3GG0 A;  4AE5 A;  4FBU A;  4GKK J;  1FKO B;  1UZD A;  1VRQ C;  4WFX A;  3E01 A;  1E6Y A;  4HLB A;  4D3G A;  3THP A;  5ETO A;  3EPG A;  3IC1 A;  2OPR B;  1RAI B;  4PYD A;  3CIM A;  3HVT B;  5C66 A;  2AT1 B;  1P6T A;  1B3T A;  2C3Y A;  2VL1 A;  3I0R A;  5K14 B;  5F8H A;  2UVW A;  4X66 J;  1KH7 A;  5I3Q A;  4DMZ A;  4F50 A;  2ASL A;  3NXZ A;  3FEZ A;  3ILI A;  5DM7 Q;  1JJC B;  1BQN B;  1T03 A;  1RT3 B;  2YX4 A;  4RBV A;  4WFY A;  5C42 A;  4ZVS B;  1ED9 A;  2GC8 A;  3UO0 A;  2Y0S D;  2A18 A;  3HD2 A;  1RWX B;  1SJ1 A;  4LFA J;  3SSQ A;  4YDD B;  5HAN A;  3E8O A;  3Q8R B;  2GIQ A;  4LSL A;  2GJ2 A;  4DUT A;  5DQH A;  2KTQ A;  1GMW D;  4X2B A;  3I6P A;  5KG0 A;  3JSY A;  5A6P A;  3QJL A;  1M5V C;  1UJ6 A;  2IJR A;  1X5S A;  3FZB A;  3R5J B;  2LQ8 A;  4M5J A;  3M30 A;  3DDN A;  4I2P B;  1RHM B;  2HG4 A;  4WK3 A;  4ZPV R;  2R7X A;  3PZP A;  2EFN A;  4DX7 A;  1N36 F;  3MM7 B;  3DU5 A;  3ET6 A;  2ZJP Q;  3CCT A;  4OYI A;  3OW2 R;  2LDY A;  4ZDN A;  2HZA A;  3IR7 B;  2ADC A;  1NK9 A;  2WSE C;  3PIP Q;  3BPS P;  3M4X A;  3ZZR A;  2AYG A;  4ILL A;  2V8P A;  2GVD B;  2GAG C;  2BJ8 A;  3DGV A;  5HI7 A;  3KLE B;  4FYW B;  2OIH A;  3GLJ A;  1YX2 A;  1W26 A;  2IDL A;  2YKN B;  3MDF A;  1RT4 A;  4EEY A;  3FEX B;  3I82 A;  1SC6 A;  5FJ4 A;  5KG6 A;  1RWK B;  1UTA A;  2N7Y A;  2V2Q A;  4RNM A;  4V19 J;  1RK8 A;  1F5A A;  2EK6 A;  1RSC A;  3MMA A;  5HK4 A;  5I42 B;  1CC7 A;  5DDO C;  4UOF A;  2AJ2 A;  4ZKA A;  2OTJ S;  2KFN A;  3KUG A;  1BD6 A;  2OLW A;  2UUW A;  3EDQ B;  2LEA A;  4RU9 A;  3G8S A;  4J9P A;  3RAQ A;  1NO8 A;  2BRL A;  3G6X A;  2R8K A;  4ELU A;  4O4G A;  4PPZ A;  4NCB A;  2UZA A;  1HHQ A;  3KUH A;  3P49 B;  2R8I A;  3TAN A;  2GSO A;  2J9C A;  3G2X A;  1KN6 A;  3FFI B;  1EQM A;  1SJ3 P;  3E2D A;  5AXN A;  1TFY A;  1EX8 A;  3RR8 A;  4USW A;  3PM9 A;  5DRK A;  3MED A;  4DF8 A;  4OI3 A;  2ATL A;  4WKR A;  5SZT A;  4ZVU B;  1K44 A;  2UUB J;  2FJD B;  2DT9 A;  2ATC B;  1NAQ A;  2I1R A;  2P9C A;  3BZQ A;  2W8L A;  4FS1 A;  3R9L A;  1XNR J;  3UN3 A;  2B4U A;  2Z8Q A;  4FNI A;  4DUZ J;  5J1N A;  4QIF A;  2DNZ A;  1ELX A;  4ZS6 A;  3JB9 k;  3M8P B;  1XIQ A;  4PG6 A;  4PAB A;  4XAK A;  3ZTO A;  4IG3 B;  2ZH3 A;  4PPD A;  3CUN A;  2FVS A;  4DR3 F;  3SZY A;  5L39 A;  4CQ1 A;  3D0G E;  1SKS A;  2NR0 A;  1K8A T;  1N4L A;  2CUY A;  1M90 T;  3QMQ A;  2H9Z A;  1T9W A;  2FLN A;  1H7W A;  1J5E F;  2F7V A;  4ES1 A;  3H25 A;  2VHG A;  4F2R A;  4I0W A;  1I94 J;  2DNG A;  3H8Y A;  1Y10 A;  3DRS B;  2DNO A;  3VAF A;  1R8P A;  2PI5 A;  3HFK A;  3SFG A;  4IUF A;  1KH4 A;  3H2L A;  2RRA A;  2D3O 1;  2GX8 A;  3BB5 A;  1OPI A;  3FFI A;  5HQ8 A;  3D4J A;  3OUY A;  1PJ7 A;  2E1M C;  3DYA B;  4OX8 A;  1SIZ A;  3NMR A;  1JKH A;  1FVQ A;  1HQE A;  2G13 A;  3C6T A;  3TAR A;  1CJK B;  1T7P A;  5CZV A;  2CPE A;  3L7U A;  3QPI A;  1N32 F;  4TLR A;  5CHC B;  3M8Y A;  3EGZ A;  1PAU B;  3MF5 A;  2EFP A;  2Y1J A;  5DG9 A;  1QVF R;  3P96 A;  2QIF A;  4KH0 B;  2PMZ D;  1Y7P A;  4WP9 A;  3BH6 B;  3CO9 A;  4QW9 A;  1J2V A;  3JQK A;  4RX6 A;  4Y28 C;  1EQ0 A;  5KFC A;  1RTH A;  2AEJ A;  3CJK B;  3NVL A;  2DYA A;  1X9S A;  5KFT A;  1FRH A;  4CLK A;  4CLY A;  3KLF A;  4F4Z A;  3AA9 A;  3NMA A;  5DZ7 A;  2UXB J;  1S9F A;  2E9Z A;  2GSN A;  7FD1 A;  1RTI B;  5GAH U;  3UD3 P;  3CME S;  3C6T B;  1X4C A;  2MYF A;  3A3P B;  1X4H A;  4Q0B A;  2MLZ A;  2YWE A;  3BKU A;  4MJK A;  4N8N A;  4MYT A;  1JJ2 R;  4FDJ A;  1NM2 A;  3ELH A;  3ICL A;  2V8G A;  4I56 A;  2VQE J;  1U6B A;  2CVI A;  5IJS A;  2U2F A;  1K47 A;  1VMB A;  4R25 A;  3VCD A;  4C11 B;  3OHA A;  1ZM4 A;  2M70 A;  3RRK A;  2FJW A;  2MQN A;  3IGV A;  3ZZT A;  1QSL A;  2HHH F;  1IQZ A;  4LBP A;  1CS4 A;  1S4E A;  3FMW A;  3W2W A;  1K0T A;  2CPX A;  2G0J A;  3LF0 A;  1UJ5 A;  4HEA 9;  2B9W A;  5EHH A;  3TEH B;  5LIA A;  2DO0 A;  2GHW A;  5HAO A;  4TQS A;  1X9M A;  3CNQ P;  2YNI B;  3W7B A;  2WVB A;  5CCM A;  4URQ U;  3Q8S B;  3HPO A;  1TL5 A;  3POT B;  3I9V 9;  2WZ1 A;  1LW0 A;  5H9F K;  1YZ7 A;  2ZBP A;  1P49 A;  2ZBR A;  2CJA A;  3DOM A;  1UEU A;  2F5G A;  2G9Y A;  1UEK A;  3DKD A;  4F2S A;  3A8K A;  3HVT A;  4G3I A;  1DQA A;  4B9N A;  2QYG A;  3ADA C;  1C1B B;  1UKU A;  2EKY A;  1UW4 A;  3SDE A;  5KFE A;  2MXY A;  3MD1 A;  2B4O A;  1IKV A;  1RTJ B;  2CZ9 A;  4KGZ B;  5GMD A;  4ZK7 M;  1FKO A;  1P27 B;  5AXM A;  3OVB A;  3V6D B;  4ZP6 A;  1MU2 A;  2ZFH A;  3OL6 A;  2W01 A;  4LR9 A;  4HDH A;  3ET6 B;  1PIL A;  2R7V A;  2HLT A;  3NCQ A;  1SHN A;  4I2Q B;  3KLG A;  3K59 A;  5L1I A;  2Q6C A;  3POT A;  2E5H A;  4WTY A;  2KT2 A;  4X4Q A;  2FHJ D;  3R3T A;  4USM A;  3SI8 A;  1H0H B;  1K7H A;  1JLQ B;  2J9E A;  3R7S B;  4ECX A;  1B0V A;  2CPI A;  2AGO A;  2B7C B;  3T6J A;  5KFY A;  1HQ2 A;  2RAQ A;  5KT6 A;  1KRP A;  3GFX A;  4ELT A;  4LR8 A;  2IA0 A;  4P74 A;  1MLA A;  2Z2M A;  2HWT A;  2R7Q A;  3IO1 A;  1X5O A;  3R6G B;  5KFV A;  4JI7 F;  1N0U A;  2DNP A;  5ETR A;  2F40 A;  5IT0 A;  2K3I A;  2V63 A;  1SL0 A;  4NXM J;  3K5P A;  1OMS A;  1VRU B;  2Z57 B;  1X4B A;  1X31 C;  2OPS B;  3HCX A;  1HQU B;  4P9S A;  1U1L A;  2ZEJ A;  4MKY A;  2K06 A;  2XWY A;  3HHL C;  4KJI A;  2UXB F;  4ZG9 A;  2E7X A;  2GHP A;  3HHE A;  3MMC A;  3Q8Y A;  4ECT A;  3OXG A;  4ECZ A;  4F3M A;  2BMB A;  4X4N A;  2OSQ A;  3PHT A;  3QID A;  2QN6 B;  2HNY B;  1B70 B;  1N6Q B;  3BH7 B;  2OPR A;  4NLV A;  3CXC R;  1U6F A;  1F1B B;  2WBR A;  3T1Y J;  1LNQ A;  3ITH B;  1FI4 A;  5SUH A;  1X7V A;  4DR2 J;  1LWE A;  2V4J B;  5J2M A;  1S0O A;  1CJV A;  1VDH A;  3GFH A;  3PW5 A;  1LV5 A;  1J5O A;  2R7T A;  1RT4 B;  3W2V B;  2JJ4 D;  2R8J A;  3CCQ S;  4ZP7 A;  4P7T A;  1D9A A;  1NZ8 A;  3IP0 A;  2Z30 B;  5CYM B;  4JI2 F;  1S97 A;  1CVJ A;  1IBM F;  3PKM A;  4LRE A;  2XLI A;  2YBV A;  3KLV A;  3GB0 A;  3M8Q A;  1U24 A;  1W7W A;  1M5S A;  1BXN A;  1FWK A;  2F8M A;  3IGZ B;  4B17 A;  4USJ C;  1GFW B;  2RHS B;  3AD7 C;  2Z2Y B;  4EZ6 A;  3PYF A;  1DY3 A;  4G65 A;  4YEA A;  3VHQ A;  4NCG B;  5LJ5 Y;  4GKJ J;  3VAK A;  3DI6 B;  4CH7 A;  3BO4 A;  2C42 A;  1WI6 A;  1R8B A;  3BGO P;  2Z2Z A;  1FXR A;  1SC1 B;  5A8K B;  2CQC A;  2PN6 A;  1EZZ B;  4QZV B;  5DDQ C;  1RAC B;  2MHN A;  2ZC3 A;  2MKS A;  2M52 A;  2YWK A;  3R6L B;  1PO6 A;  3W64 A;  4ZN3 A;  1FFS B;  3FCV A;  5CAA A;  3D54 A;  1Q82 T;  3EDR B;  4AUK A;  4FXD A;  2ASJ A;  1H98 A;  2P8I A;  1ALJ A;  4K4V A;  4CH0 S;  4UW2 A;  4U7U D;  4JI0 J;  3MEG B;  1R27 B;  4DR7 J;  3M7V A;  4OZ5 A;  3IFE A;  4OZ3 A;  5H9E J;  2QG9 B;  2K2P A;  5KFN A;  1ZTW A;  3WAY A;  1JK9 B;  1HNZ J;  2FB0 A;  1OSD A;  4MYU A;  1KD1 T;  2R2S A;  3BBC A;  3R2D J;  3LXQ A;  3OPK A;  1G4C A;  3CJ8 A;  4QIG A;  4FZV A;  4UZC A;  1FJG J;  2POK A;  2XO6 A;  3J7Y U;  4PRF A;  4ZA1 A;  1S99 A;  3MM9 B;  4N47 A;  1DFD A;  1RBA A;  2V9K A;  3KG4 A;  1IWG A;  2JFD A;  1DTT B;  5B0G A;  4HI1 A;  3S1T A;  2R8G A;  4OZ2 A;  3DCA A;  4M5L A;  1PBU A;  2W24 A;  2XS5 A;  1RT5 A;  1VBY A;  1WC0 A;  3M6U A;  3ZZ0 A;  4NZ6 A;  1VQ5 S;  4CLS A;  2GZO A;  3UDE A;  4N56 A;  1RTD A;  4LVO P;  1TKT A;  3P8B B;  4ZVR B;  3JAM Y;  4YME A;  5CH7 B;  4DL7 A;  2F4V J;  2Q1L A;  2HS3 A;  2K7J A;  4OV1 A;  3W9H A;  2E1A A;  3OR2 B;  2YVS A;  3MMA B;  3GWC A;  3WC0 A;  2E44 A;  3PJX A;  3CCS S;  3GV8 B;  2LP4 A;  3M8W A;  5IFM A;  2YKQ A;  3EM1 A;  4M5D A;  2CZV C;  2MMY A;  3FMB A;  3PDN A;  3PJ9 A;  4CT8 A;  2HFU A;  4X4R A;  1M5H A;  4F67 A;  4ANE A;  3OTD A;  3PX0 A;  1F2G A;  1TL7 A;  1NJI T;  1TL4 A;  2ROP A;  2X3G A;  3D67 A;  4W90 B;  3JTP A;  5M2R A;  4K4Y A;  2CQI A;  3EVM A;  1VHF A;  2UP1 A;  4LSN B;  2MZR A;  5MLC V;  2BA9 A;  3J81 U;  3MAA B;  5EGH A;  1KOH A;  1RAO A;  3GCX P;  1H72 C;  4G1I A;  1ZPV A;  2JOQ A;  2WW8 A;  5DO2 A;  5E41 A;  1K0V A;  1WOO A;  3PEH A;  4XPC A;  4KFB A;  1FE0 A;  1IKX A;  2IY5 B;  5K20 B;  4CM2 A;  1JJ4 A;  3EWG A;  4DDF A;  4XDD A;  5B0A A;  1F9E B;  2C2O B;  3M8Z A;  2EEY A;  5C5J A;  2UVV A;  4F26 A;  4DV3 F;  4RPF A;  4K5R A;  2DIU A;  2HGN A;  1XN9 A;  4NX9 A;  4DQR A;  4MIV A;  3KK3 B;  1F5C A;  1BGX T;  4IRK A;  2Y8W A;  3CC4 S;  3TUJ C;  4EYH B;  1AA1 B;  1FJE B;  1N5Y A;  1LOU A;  3UD5 A;  2MGZ A;  2X1F A;  1G1X A;  1X4D A;  2LXU A;  1VRT B;  2EW9 A;  3CCW A;  3H42 A;  2QO3 A;  3MR6 A;  2IMW P;  3BEG B;  2QZU A;  4LIR A;  3QFW A;  4C8N A;  4OJ3 A;  5GRR A;  1TUW A;  2XNR A;  1S6U A;  1YLX A;  4NLY A;  2MQQ A;  3MOZ A;  3GSD A;  1TKZ B;  2MKJ A;  3MTJ A;  5I4M A;  4YHH J;  1KQK A;  3HHN B;  4RLE A;  2M88 A;  2W2P P;  4KHR A;  5KG4 A;  1SUQ A;  3AXM A;  2BE9 B;  2NS1 B;  1WG1 A;  2VG5 A;  3QGH A;  3PY8 A;  3CJ2 A;  2GVZ B;  1A0O B;  2RQM A;  2VKR A;  1IXK A;  3H0P A;  4RW7 B;  4KH1 B;  2FJE B;  3NGK A;  5D4L A;  2EC0 A;  1PBA A;  2W25 A;  4IH5 A;  4IKA A;  2MJN A;  2ZH4 A;  1T11 A;  5I3U B;  1WC1 A;  4JI8 F;  4K4U A;  2VG7 B;  2IMO A;  4TY8 A;  2QFJ A;  1E6V A;  1J5E J;  2MB0 B;  2DCL A;  3MWB A;  2FJA B;  4RW7 A;  3R1L A;  3NNA A;  3AD8 C;  3HI9 A;  5B0B A;  3FRZ A;  1X5P A;  1K9M T;  4OHW A;  3HKW A;  4IH7 A;  2NCK L;  4KBI A;  2KM8 C;  3UN5 A;  2F9D A;  4FN5 A;  3MK2 A;  5T7L A;  2QMX A;  3M32 A;  2XTJ P;  4IO1 A;  4USI A;  1E3C P;  1RWU A;  1L3U A;  1KH5 A;  1VHI A;  1KBR A;  3K89 A;  1IN0 A;  4IFY A;  4NZ7 A;  3TX0 A;  4JI1 F;  2QLX A;  4GO7 X;  4FDI A;  4B9U A;  2WRM A;  3BR9 A;  3GU0 A;  1FDD A;  2MJU A;  4KAI A;  4X4T A;  1KKH A;  1RE1 B;  2ILY A;  4DSI A;  1XNR F;  4Q44 A;  3MEC B;  3RBE A;  3MEE B;  2HFS A;  4H54 A;  2ZOM A;  2FDN A;  3AOC A;  2FLL A;  1FNO A;  1YSJ A;  2RSQ A;  2XZW A;  2J7K A;  1N5V A;  1NZA A;  2ZBI A;  3L9Z A;  4IQM A;  1WKL A;  4NI2 B;  5D78 A;  5EGY A;  1DUR A;  3DOK A;  4IFV B;  2KO1 A;  3OBI A;  1UMJ A;  1ZH5 A;  2CQ3 A;  1N8R T;  1AUK A;  3QNW B;  1AXQ A;  2M9K A;  4LF8 F;  1BWE A;  3G86 A;  2R4F A;  4CZC A;  4FKY A;  4DQI A;  2VQF J;  4ELV A;  4LRA A;  1IR1 A;  3WIV A;  4PUO B;  1FFW B;  5F8I A;  1S7H A;  3JSM A;  3C6U A;  4UY8 5;  2K1R A;  1HNX J;  5KFO A;  4CIO A;  1MMN A;  3MEK A;  5EWF A;  4RNF A;  2RJZ A;  4UQT A;  1Q5V A;  3V6D A;  3LTO A;  3U27 A;  4IO9 Q;  4JI7 J;  2HND B;  3T9Z A;  1TKX B;  3CJR A;  3QLH B;  4XK8 C;  2W9B B;  2KI2 A;  1KHV A;  1C1B A;  4NLG A;  1BQM B;  4OHZ A;  3CD6 S;  3KLI A;  3GJR B;  3IRX B;  1CC8 A;  1S9E B;  1ALH A;  2RQK A;  3BBF A;  1HNV B;  4M5M A;  1IBK J;  2Y1I A;  3AH6 A;  2AP6 A;  4JI1 J;  3F0N A;  2CIM A;  2D7S A;  3B78 A;  4O23 A;  4OI1 A;  5E5N A;  3DNC A;  4NL5 A;  5IQ6 A;  3NCR A;  1GK8 A;  2NSB A;  2QA2 A;  4P75 A;  3J81 j;  4LUB A;  1QTM A;  3LAK A;  1MNE A;  2QL9 B;  4QWB A;  3CJ0 A;  3ZZZ A;  2CXE A;  2VUG A;  3AOA A;  1TK0 A;  1TV6 B;  4NML A;  2RU9 A;  5LOQ A;  3SV3 A;  1T9U A;  1Q8L A;  3MAH A;  3D7S B;  1LWE B;  2V4J A;  3OFH A;  4I7F B;  5FLX U;  2AX1 A;  2WW4 A;  2WVC A;  3ITH A;  4WF9 Q;  1FJC A;  2YNI A;  5FLX Y;  2O67 A;  1BQM A;  4LF1 A;  2CPY A;  2CRL A;  4IG0 A;  3D1O A;  3SCI E;  2AGP A;  1HKA A;  4ZCI A;  4KSE B;  5IT4 A;  4KM4 A;  2M7S A;  2W5R A;  4OZN A;  4K4S A;  1OQ3 A;  3V5R A;  4ZN1 A;  2CG8 A;  1M1K T;  1H73 A;  3CMQ A;  4Q7A A;  3FQK A;  5C24 A;  2BV3 A;  4DV7 F;  3EE3 A;  2NUU G;  4GVL A;  4IOB A;  5FDL B;  5KFB A;  1S0V A;  3QWP A;  2VA2 A;  3CGI A;  2OH2 A;  1SJQ A;  5DLF A;  1S1U B;  3GIJ A;  1FD8 A;  1N5Q A;  3PRD A;  2J8A A;  3QT8 A;  3UNG C;  2FVP A;  1TAQ A;  1RWP B;  4O4G B;  3W5Z A;  1EW9 A;  2AU0 A;  4CYR A;  2VFR A;  5KAK A;  4NOH A;  1ZBT A;  1NME B;  2WB1 D;  3CWJ A;  1F6T A;  1VJW A;  3O3L A;  4FPR A;  4IG0 B;  4TN2 A;  2VQE F;  3QJP A;  2RVJ A;  2CQH A;  4HL9 A;  1Y00 A;  4J9Q A;  3TRG A;  1DQ8 A;  2EFG A;  4RNO A;  3BF4 A;  4LF4 J;  2G4B A;  1WHW A;  2IPO B;  2Y1R I;  1VQY A;  2AJQ A;  3PW0 A;  3ULH A;  4Z37 A;  4DV1 J;  4URG A;  3PW2 A;  3Q3Q A;  2H54 B;  3GFY A;  1KWM A;  5L0K A;  2V6A A;  4M5D B;  2BR0 A;  2CZ4 A;  2KXH A;  4S0M A;  5IQQ A;  2CJ9 A;  4CXU A;  3MM6 B;  2ZH1 A;  1A9N B;  2JDJ A;  1C0U A;  5EN1 A;  2ANH A;  3CJ4 A;  5D0H A;  2FVR A;  3NNH A;  4ANC A;  3OD2 A;  1VQ9 S;  2GHV C;  2HNZ A;  4JP8 A;  1N32 J;  2V50 A;  4H4M A;  2OFH X;  3RB3 A;  1JLA B;  3BGF A;  4MT1 A;  5HMW A;  4GTZ A;  3M30 B;  4I2P A;  2WB4 A;  2VH7 A;  5D4N A;  4Z2X A;  1MWQ A;  3VAL A;  2BRK A;  3M8P A;  2W9A A;  2H48 B;  2GJF A;  2JWN A;  4DSE A;  2FVQ A;  2D1C A;  2KG0 A;  2KRB A;  1Y6V A;  4TY9 A;  3H5Y A;  2NZ4 A;  4YR1 A;  3BDG B;  5LXY A;  1U02 A;  4O3P A;  1GAO A;  2IDE A;  5CYJ A;  4DQP A;  1NDP A;  1Q4R A;  2HVD A;  1SV5 A;  1YGY A;  3NCP A;  4C11 A;  2HAF A;  2HRT A;  1RAA B;  3K2Y A;  3C16 B;  1HR0 J;  2KDO A;  3QAU A;  4USH A;  1VFJ A;  5HVF A;  3UCG A;  1M5K C;  3FJ2 A;  2AJF E;  2G9O A;  1RBL A;  1TL3 A;  3JTO A;  4DUY J;  1S0M A;  2HFZ A;  2M0G B;  1C2P A;  3AB2 B;  4IYQ A;  3DXB A;  4RNH A;  4JI6 J;  2V34 A;  4ECR A;  1HWJ A;  3A3N B;  2L3M A;  2QRR A;  4I6A A;  3CE8 A;  5B7W A;  5C2G A;  1OO0 B;  3I96 A;  5F3Z A;  1OWX A;  2J0W A;  4NXN J;  2CVE A;  2BM1 A;  1U1R A;  2XWX A;  4NMX A;  1V3Z A;  5IC6 B;  5U47 A;  3J80 Y;  1ALI A;  1IKX B;  1JLA A;  3QSI A;  3M32 B;  1IR2 A;  4I2Q A;  3KLG B;  4ED2 A;  4A8X A;  1ANI A;  4KTQ A;  5KT4 A;  1FRM A;  4DV4 F;  3HP6 A;  2EVZ A;  3MAA A;  1RIS A;  4ETZ A;  1YBT A;  6FDR A;  1IBK F;  1Q86 T;  1CJK A;  1O8B A;  2VC0 A;  3TW0 A;  2FC9 A;  4IOA Q;  1TL7 B;  4OQJ A;  4P71 A;  3K5L A;  1D8Z A;  3MMB B;  4CO2 A;  5KFL A;  1VC5 A;  2ZE2 A;  3TAM B;  1B7Y B;  1FO1 A;  3K17 A;  4F3Q A;  4DR5 J;  5K8P A;  1UVK A;  5C2C A;  3BGR B;  1KC8 T;  4KJD A;  1WHV A;  4A48 A;  4HTI A;  4NWB A;  4OYP A;  1WI8 A;  4LSL B;  5G4D A;  3D0I E;  2D41 A;  5KT7 A;  2QLJ B;  2QT7 A;  1SH2 A;  2RH3 A;  3QO9 A;  4AXJ A;  3QIP A;  2C2M B;  3OTC A;  4Q43 A;  2C2D A;  1VC0 A;  2KL8 A;  4OHV A;  4PWW A;  1I6J A;  1VQ8 S;  4UOC A;  1B4S A;  4WTO B;  1S72 S;  1DTQ B;  2EK1 A;  4C8M A;  3MR3 A;  4QIW D;  4F36 A;  5M2U A;  4C8K A;  1N52 B;  4NLQ A;  4P2X A;  1VS3 A;  3T19 A;  2ZE2 B;  3TAM A;  3NAI A;  4C7Q A;  5CCL A;  1ACM B;  4DL2 A;  1B0P A;  3CCR S;  2LU1 A;  4Y2C A;  4DCP B;  2R7O A;  4C0B A;  1P9Q C;  3VAM A;  2LQ5 A;  1FHT A;  5IJQ A;  2HK2 A;  3Q86 A;  3UR0 A;  5IT9 U;  1Q79 A;  2YX7 A;  2XBP A;  4OI2 A;  2GAH C;  2JLF A;  2DPI A;  3H20 A;  2OI2 A;  3O44 A;  4DV3 J;  3HSZ A;  4DS5 A;  2Y9H A;  1JLE A;  1XR7 A;  9ATC B;  4ED1 A;  2WBM A;  3VZI A;  2B8Q A;  3RB6 A;  1RAB B;  4UOH A;  2ASY A;  4DR5 F;  1MU2 B;  3MPD A;  2QA4 G;  1U48 A;  1F9H A;  1KDN A;  3B6B A;  2XI3 A;  2DGU A;  3TQE A;  4DPY A;  4QCL A;  1S6Q A;  4AL7 A;  5KFR A;  4HAC B;  4WYL A;  4USU A;  2B6A B;  4L6V 3;  3I56 S;  3T5J A;  2RML A;  2MLY A;  3RUB L;  4UUX A;  3ZZO A;  2R7S A;  5KFZ A;  5E3A A;  2R2T A;  1D9F A;  4FBT A;  2L9N A;  1IQT A;  7AT1 B;  2RKI A;  2G2O A;  2XY7 A;  1YRU A;  4LT6 A;  4N41 A;  3MK0 A;  1JQG A;  2E29 A;  4GRS A;  4KO0 B;  3V6J A;  3QZ7 A;  2XY6 A;  2D9O A;  3MM5 A;  1WSV A;  2GGP A;  3AOB A;  1FX2 A;  4U8Y A;  1WOP A;  3T6B A;  1B99 A;  2QX0 A;  2DGQ A;  3LAN A;  1QAJ A;  3QGP A;  1WF2 A;  2BW2 A;  2DNN A;  2K1R B;  3IM9 A;  1CS4 B;  2PMW A;  1SH0 A;  2AIR B;  4IR1 A;  3MUR P;  4GO5 X;  2L9W A;  3MOJ B;  4DUY F;  1QUP A;  2FHM A;  2JC1 A;  4FF3 A;  1Z2L A;  4TNO A;  3PYE A;  1E33 P;  3PNI A;  4OV6 A;  4LQ3 A;  4DV1 F;  3FC9 A;  4QAX A;  1HL6 A;  1AYE A;  2G0C A;  4WU2 A;  5KFJ A;  1S10 A;  2JEF A;  1YRT A;  2GW8 A;  2VBW A;  3CSK A;  2XS2 A;  4ZJQ A;  3DRP A;  2BOA A;  4WFZ A;  1NND A;  4NXM F;  3IDD A;  5IV3 A;  2XM3 A;  4B3R F;  1RZM A;  1YJN S;  1YIJ S;  5BR8 F;  1HNW F;  5LRN A;  3LH2 S;  4NEZ A;  4W98 A;  3V4I B;  1EJ7 L;  3ZTS A;  4A8M P;  1RU1 A;  1W2I A;  1RT6 B;  4CLW A;  9RUB A;  2DR6 A;  4KB7 A;  2LQB A;  8RUC A;  3ISN D;  3DHX A;  3QGI A;  3QRR A;  2MDA A;  3KUE A;  3G96 A;  1X0F A;  2LMI A;  2XRG A;  4O3R A;  2B3T B;  2I0X A;  5JJB A;  4ZVO B;  3L3C A;  4PG7 A;  3BV8 A;  2GS8 A;  4C0H A;  3BKT A;  1FDN A;  4DX8 H;  4UT4 A;  4RUH A;  1JXL A;  3G8T A;  4Q0B B;  2DHS A;  3TJA A;  3WDO A;  2G1D A;  5A8W A;  4H4M B;  2OTL S;  2FQQ B;  1NDC A;  3B54 A;  2IVF B;  3W9I A;  1GXU A;  4RUA A;  5ETK A;  4FS2 A;  1NCL A;  5LL6 d;  4NLW A;  3O5T B;  3SEO A;  2ROG A;  3HVA A;  3KNG A;  5LXR A;  2ACM A;  1GX5 A;  2RQC A;  3KHG A;  5L1K A;  3V6H A;  2IBK A;  2UU9 F;  4OL8 A;  1JNZ B;  1AFJ A;  2YKA A;  3ZNJ 1;  5IC4 B;  2CAJ A;  4O44 B;  4C3L A;  1S1V B;  1WNE A;  2BJ1 A;  2D9P A;  1W25 A;  3NKR A;  1VK8 A;  2XSF A;  2L41 A;  1WSR A;  1U1Q A;  3B8H A;  4X4O A;  1EAY C;  4WFB Q;  4I1T A;  1IBC B;  5MAO A;  4DFM A;  2FJX A;  5HRT A;  4PQU A;  1PCA A;  3LPY A;  4B9L A;  4QW8 A;  3C2P A;  3EVO A;  4J5O A;  1ZET A;  2WON A;  1WKK A;  4IRD A;  3CD0 A;  1LFW A;  4M1K A;  3RB4 A;  2WVF A;  1VBZ A;  2HQD A;  2Q43 A;  2XMW A;  2XMV A;  1L3S A;  5DDP C;  1N34 F;  1UWA A;  3SBM A;  1LXJ A;  3SSS A;  3D3C J;  2F65 A;  2FY8 A;  3T5L A;  1T05 B;  1KVI A;  2DXD A;  1HNX F;  1F0X A;  1HWU A;  2AV5 A;  2GML A;  3E3X A;  1PG5 B;  3LOU A;  1RHU B;  2QJ3 A;  3M2R A;  5GAG U;  3BBB A;  2HRY A;  2IM3 A;  5A8W B;  2UU9 J;  4Y2I A;  5BJR A;  3DFE A;  2XYP B;  4P2F A;  3BKF A;  1QM9 A;  3J81 Y;  3A3O B;  1KR4 A;  1R31 A;  4OYM A;  2XYH B;  3KJF B;  3IWL A;  1JXV A;  2NXJ A;  2B5J B;  1ARO P;  2XSJ A;  3QYY A;  1JLQ A;  4DBQ A;  2J0X A;  4DL0 C;  1VQS A;  3NKO A;  1JX4 A;  1R3N A;  4DR1 F;  3O2I A;  5AE1 A;  1TK8 A;  1MWY A;  3DLK A;  3HM9 A;  2EFO A;  3AOD A;  4DF4 A;  4YDX A;  4OZL A;  4ED6 A;  2QGF B;  4RUB A;  2VG7 A;  4O3S A;  4FP9 A;  4V1A k;  2M4M A;  1LKZ A;  1JMT A;  3CED A;  4ZJL A;  4UOR A;  2Y0B B;  1DRZ A;  2RF2 B;  4BWM A;  1SJ4 P;  4UOO A;  5F0W A;  4R5P A;  2ZH7 A;  2ZZT A;  2CPF A;  1PJ6 A;  3DRR B;  2HQG A;  1KHK A;  3SCK E;  2J6S A;  2PEB A;  2IBO A;  2ROE A;  3H90 A;  4NI2 A;  1KFS A;  3US5 A;  4F4X A;  2IA6 A;  3VAI A;  3JTN A;  1NJY A;  1NHK L;  3NLC A;  2YKO A;  3KD8 A;  3ENW A;  2EI5 A;  3MUV P;  4TXS A;  1FKA F;  5ETP A;  1FEH A;  2W5X A;  3HSJ A;  1JLG B;  1ZYQ A;  1FRK A;  1YJW S;  3A1Y G;  2X51 A;  1V9O A;  4K4Z A;  1OSC A;  1R0C B;  3LO3 A;  3CC7 S;  1HD1 A;  3P4U B;  1VBK A;  1GMW A;  2A2D A;  2VV5 A;  1RAJ A;  2KN4 A;  3GII A;  4DHV A;  4WPA A;  1RHK B;  2DY1 A;  3H2U B;  1GTH A;  1T9Y A;  2MQ8 A;  4OX6 A;  4DI6 A;  2ZJQ Q;  3W2W B;  2DHX A;  2APO A;  5L9N A;  5LRM A;  5T41 A;  1OY8 A;  2EBG A;  3KK3 A;  4BDP A;  4KY3 A;  1BLU A;  2KHC A;  3F44 A;  4WU3 A;  3VF0 B;  1JXE A;  3LGM A;  3PRV A;  2HHX A;  4YOE A;  1E6V B;  1P8G A;  4TY8 B;  3BQ0 A;  4EZ9 A;  1UWB A;  2ZIT A;  5H9F J;  2HBR B;  3L7P A;  1AUS L;  1IBL J;  1VQP S;  2BAN B;  1XBW A;  2HHS A;  3OHB A;  1OS5 A;  5J2Q B;  4ZJO A;  1VLO A;  3ZNU A;  2BE7 D;  3DRR A;  2VKZ G;  4MIA A;  3AHP A;  1MML A;  1XK8 A;  1O5J A;  4I69 A;  4QR2 A;  4I64 A;  3H98 A;  4DSF A;  1R0A B;  1HYS A;  4YFU A;  3D28 A;  5TJ3 A;  4DR4 J;  2BX6 A;  3E01 B;  4J9U E;  4EUV A;  1HI0 P;  1C4C A;  2VZ9 A;  2H5I B;  4RWW A;  3IN5 A;  1KQF B;  4CDI A;  3DI6 A;  1Y3J A;  2AMC B;  4HHJ A;  2KYX A;  3NAH A;  2FC8 A;  2I8E A;  2PFF B;  5HRO B;  2ZWP A;  3LP2 B;  1U1K A;  3CO0 P;  4LSN A;  3GTY X;  2ZNY A;  3KK1 B;  3ILJ A;  4FNH A;  2VG6 A;  4YQW A;  4PXD A;  1I1G A;  2HUR A;  2MZS A;  3DU6 A;  3GE9 A;  4U96 A;  3KLH A;  1FDA A;  1HLW A;  2IYG A;  1NSA A;  3D6F B;  4C8O A;  2DR8 A;  4H4K C;  3N6N A;  3HJV A;  4A4J A;  3M9O B;  1WF1 A;  1WHX A;  2IVM A;  3A8J A;  3CW2 C;  3U7J A;  3IBF B;  1MWZ A;  3CTR A;  3VGV A;  4DPW A;  5LSL A;  4CLP A;  1G7C B;  2J7W A;  1YJV A;  4WII A;  4ZVG A;  2BXJ A;  1HMV A;  2NXC A;  2PFD A;  3N5B A;  1KH9 A;  2YQ3 A;  4ED0 A;  2OSR A;  3PCO B;  2JLG A;  1N6Q A;  3DGP B;  1KOO A;  3MM5 B;  1H2T Z;  3S6E A;  4CNY A;  5DQG A;  4JV1 A;  4OX9 J;  2QLF B;  1Y11 A;  2IM2 A;  2OPQ B;  4RW8 A;  3WX4 A;  1WJ9 A;  1XWL A;  4CO5 A;  2GIR A;  3CJS A;  1Q53 A;  3U1L A;  4XPE A;  1WTB A;  1WDT A;  2BUN A;  4LF6 J;  3IMQ J;  4Q45 A;  5F8J A;  2OJ3 A;  2BZ2 A;  5AXL A;  3MMB A;  4TQR A;  1N2K A;  1FTC A;  5CYQ A;  3MUT P;  4TYA A;  4GTY A;  4NWJ A;  3T1A A;  2GGP B;  3J7Z T;  4JI5 J;  1VQO S;  2B6A A;  2DR5 A;  4UY8 T;  5K8N A;  2JH3 A;  1H2V Z;  3NBP B;  4DUZ F;  1UA1 A;  4LFB J;  3R7B B;  1N5T A;  2LYV A;  2VPZ B;  4UTG A;  3RTV A;  5LMU J;  2H51 B;  3VGT A;  1RT2 A;  3JQM A;  2NPF A;  3IGN A;  4C8L A;  3FQL A;  3OXL A;  4CXS A;  2CQ1 A;  2FGC A;  2G2Z A;  2RUS A;  2BJ7 A;  2KYZ A;  4NCG A;  1UCN A;  5G0R A;  5BYS A;  2JEI A;  1U2R A;  3R5C A;  1F3V A;  1S57 A;  5KFS A;  4BHQ A;  1NK6 A;  3M6X A;  3RB0 A;  5GMK a;  4K50 A;  1EP4 B;  2CG4 A;  2HPU A;  3D2W A;  2XI2 A;  2WVD A;  3SYZ A;  1URA A;  2ZH6 A;  1VGY A;  5B0E A;  2MKC A;  4YB6 A;  2WHO A;  4ZCK A;  3AQP A;  3D66 A;  1I3O B;  4E98 A;  1QVG R;  4B3O B;  1HJK A;  2C3U A;  1NXI A;  4HKQ A;  2HVZ A;  3HHL D;  1AUD A;  1QE1 A;  5DG7 A;  3OSP A;  2YKM A;  3LP0 B;  4KV8 B;  1EI6 A;  3AXK A;  1S49 A;  2D1G A;  3MEG A;  2K8G A;  1HHT P;  1Q7L B;  1S5Z A;  1U09 A;  1HI1 A;  3MPW A;  1UL3 A;  5CYM A;  5B0C A;  1UVN A;  2ILZ A;  5HLF A;  1JJH A;  3NOG A;  3W65 A;  3OJS A;  2IVY A;  4K59 A;  4DR3 J;  3IGY B;  1CG2 A;  2HS0 A;  2KZZ A;  4I6Y A;  2PMH A;  2W4D A;  1X4E A;  3W61 A;  2HMI B;  4E0D A;  3FCW A;  4ZPB A;  4M5G A;  3R97 A;  5DGB A;  1NK4 A;  3KG1 A;  1NJZ A;  3PFO A;  4LF2 A;  4OZJ A;  4RW6 B;  2XS7 A;  1D1U A;  2AJ0 A;  2FZC B;  2JL9 A;  3I5A A;  4FYX B;  3CDB A;  3OR1 A;  2DXE A;  4KHM A;  5BYQ A;  2YNG B;  3JSB A;  2BQU A;  4ILM A;  1TMJ A;  1O99 A;  1U6Z A;  2QYC A;  4KAV A;  2QZ8 A;  2NYI A;  2PO4 A;  3BM7 A;  4RJV A;  5A2Q Y;  1F5B A;  4JI0 F;  3UR3 C;  5GVQ A;  4ILR A;  3RBZ A;  2W5T A;  3PTW A;  2X1G A;  2JC0 A;  1H7X A;  3AT1 B;  3AQO A;  4LJM A;  4HT5 A;  1RQ0 A;  3MPY A;  3RJM B;  4B08 A;  1SKW A;  4B3O A;  2QL7 B;  1H74 A;  1O98 A;  3RAX A;  2PD1 A;  2GLQ A;  5AJ9 A;  1R6Y A;  2VFV A;  2ACY A;  3DOL A;  1SPB P;  4I6W A;  4KKO B;  2VQF F;  2XEX A;  5HVH A;  1TFW A;  1EW2 A;  4X66 F;  1DQ9 A;  5KG7 A;  5CZX A;  5JXS A;  2W9C B;  3TEG A;  3KTQ A;  4JI5 F;  3TA1 A;  5A2Q U;  1NK8 A;  2JVO A;  3I31 A;  1FTR A;  3R1H A;  2HAI A;  1HBN B;  2XUL A;  1ELO A;  3CD5 A;  3DYA A;  3TVY A;  2XCA A;  3MZI A;  5KFF A;  1VLY A;  3I87 A;  3KJN B;  2DNK A;  1HWI A;  1ZM2 A;  2H65 B;  1VQL S;  2IAJ A;  5IM0 B;  4JI2 J;  1U2C A;  1WC3 A;  4W92 B;  1RBO B;  4MFB B;  1FRJ A;  3M2U B;  5T14 A;  2QE5 A;  1QY7 A;  4JUZ A;  4DJB A;  3ZZU A;  2XGQ A;  1ZTT A;  1RU2 A;  1LWX A;  3SV4 A;  3W60 A;  2DHA A;  1XMO F;  4DQQ A;  2LXF A;  3HF5 A;  1KFD A;  4RNN A;  1CQN A;  5E3C A;  3I4H X;  1N33 F;  1WUU A;  4DZD A;  4RW6 A;  3NKP A;  5EX0 A;  1U8W A;  2FD2 A;  4LRB A;  1YHQ S;  3NRB A;  1Q7Y T;  2CKW A;  1Q8B A;  1U4B A;  4F4Y A;  1MRO B;  3DRY A;  3BQ1 A;  2QMW A;  1FT8 A;  5A0Y A;  4DV2 J;  4IG3 A;  3CF5 Q;  2MY8 A;  3B4D A;  3HLU A;  1N48 A;  4MAK A;  2VIC A;  4J9S A;  2WVE A;  3AJ2 A;  4QYR A;  3IXQ A;  3VR1 A;  2AZ1 A;  2M5Y A;  2MLX A;  4BBY A;  2MKK A;  5LSR A;  2LEC A;  1VBX A;  2G0I A;  2HQ3 A;  2JZ5 A;  2PE8 A;  2W7A A;  3GYN A;  1RTJ A;  4LRD A;  4O4R A;  4QIV A;  1NSK L;  4URS A;  3MCS A;  2ZC4 A;  4WK1 A;  4M5I A;  3EGN A;  1HBU B;  4X62 J;  5LSO A;  3TZX A;  2COL A;  2L48 A;  1NH8 A;  2DHH A;  2B4V A;  2QTW A;  2ALZ A;  4F3O A;  1CUL A;  3GR0 A;  1T0T V;  1EHW A;  2IRX A;  1LWC A;  1T02 A;  2F4F A;  1HIY A;  2RE1 A;  3DLK B;  4OYX A;  1ZAX A;  4WFN Q;  2Q79 A;  2L08 A;  3JYT B;  1Y9O A;  4KGM A;  4PG4 A;  4DV5 F;  1T9T A;  2XMK A;  5D0E A;  2MST A;  2AF6 A;  4GVB B;  1JLB A;  5E7O B;  2PA8 D;  2FUG 9;  1AJD A;  1ALK A;  4ES3 A;  2C2R A;  4EI2 A;  2ZHO A;  3C6U B;  4UST A;  3TZY A;  2OP5 A;  2W2O P;  1WKJ A;  1UZH A;  2LQJ A;  4EWT A;  2BBE A;  2V8H A;  2HFO A;  4OX7 A;  3NBP A;  3R5G A;  1KVJ A;  1GMV A;  3H5U A;  2BE2 B;  2H4Y B;  1EKS A;  3NEK A;  4OJG A;  3Q8P B;  3JYT A;  3GQC A;  1JWW A;  3GV5 B;  2Z2L A;  4Z7Y A;  5KT3 A;  3WAV A;  3HO1 A;  3W63 A;  1RTI A;  1XJW B;  4U8V A;  3C16 A;  1U1O A;  3DOM B;  2JEJ A;  3OL9 A;  3T9N A;  4ICL B;  2GQ2 A;  5D15 A;  4ITS A;  5HL7 Q;  2H1Y A;  2FLP A;  4P2M A;  1NB2 A;  3LGH A;  3DXS X;  5B0F A;  4PG8 A;  3V4M A;  4CT9 A;  1R0B G;  2HGM A;  3UVJ A;  3TI0 A;  1S6P B;  1O6X A;  1LK5 A;  4A8Y A;  5EWE A;  3A8E A;  1RHJ B;  3TA0 A;  3IM8 A;  2AGQ A;  2GQC A;  3W9J A;  2IM0 A;  2NLW A;  4HH0 A;  2RT3 A;  2CQ0 A;  4QU7 A;  4YR2 A;  3TO8 A;  4B3S J;  2Y8Y A;  2YKM B;  3LP0 A;  4KV8 A;  2R2R A;  1JLF A;  2RQ4 A;  3PFE A;  1K1S A;  4W4M A;  4Y0F A;  2E66 A;  2O3D A;  2OEK A;  3RW6 A;  3K8W A;  3T1Y F;  2K7K A;  4ZIV A;  1TV6 A;  5GAD I;  4LRF A;  2WTF A;  2G1H A;  1TAU A;  4DR1 J;  3OTE A;  1IJE B;  3FUY A;  2OUG A;  3QFH A;  3VGU A;  4F7V A;  2BE2 A;  2I6W A;  2HND A;  5ITH A;  2FIU A;  3KWM A;  3CIZ A;  2EBE A;  2NUH A;  1IUJ A;  2KB2 A;  1S77 D;  4GMK A;  5CA5 A;  1VIO A;  4IQX A;  4CO4 A;  1KP6 A;  5IS2 A;  3SQO P;  1IM4 A;  4R8U B;  4DQS A;  5HP1 A;  4PUO A;  4LRC A;  4YHH F;  1YIT S;  3Q2T C;  1PSD A;  2D3U A;  1C0T B;  4DX5 A;  1SQF A;  2JHE A;  3DRP B;  4ECU A;  1D3W A;  2YNH B;  2OEL A;  3P6Y C;  2ZKU A;  3HHD A;  2BAN A;  2GA3 A;  1YBA A;  2D74 B;  4NWX A;  4NRT A;  1LWC B;  4B3R J;  3JXO A;  4BLG A;  3NL0 A;  3MEE A;  4LFB F;  1CEZ A;  5J1E A;  3CB4 A;  3OXF A;  2XC9 A;  3SFU A;  2ABY A;  2GIF A;  2BJ9 A;  4U95 A;  4DV6 F;  3O1L A;  1BUX A;  4B9T A;  2MZ1 A;  2ZH5 A;  4PG5 A;  3MCN A;  4HI2 A;  8AT1 B;  2W2N P;  4LQ9 A;  1DAR A;  1HBM A;  4QR1 A;  3CPW R;  4K4X A;  1KHN A;  3JQJ A;  1IBM J;  1NDL A;  1HA1 A;  2J0Q D;  5KT2 A;  1B0T A;  3TA2 A;  2C2K B;  3ZO7 A;  3AA8 A;  1V6H A;  1URN A;  1PAE X;  3RW7 A;  3NG8 A;  4YY3 F;  5KG2 A;  1FRI A;  2UXD F;  3VQS A;  5GAH I;  3K0J A;  3I55 S;  3T1H F;  2BW7 A;  2GO9 A;  2VPY B;  4I7F A;  3BSA A;  4ERD A;  4C4W A;  2HQF A;  4R0E A;  3VGS A;  2IRY A;  2XNQ A;  4JI3 F;  5IT9 Y;  2E7V A;  2PA3 A;  1VQ6 S;  3WX8 A;  4YR0 A;  4NLO A;  4J9O A;  2GVZ A;  1ZZN A;  1OY9 A;  2E5G A;  4R5P B;  1S6O A;  4OZ1 A;  4RZR A;  2NPI A;  2DH9 A;  2GVD A;  3M2U A;  4WE1 A;  2P6S A;  5KT5 A;  2V9W A;  4FVM A;  3TUI C;  1QE1 B;  5KFK A;  4TN0 A;  1EET B;  2YNF B;  2C3P A;  2CQP A;  1U1N A;  1ITP A;  4ZCL A;  5ADZ A;  3OL7 A;  2CNO B;  3I0S B;  5AE2 A;  4CCH A;  3OVA A;  2KZM A;  3T02 A;  2Z58 B;  4LFA F;  3TNV A;  4ZPD A;  1CPZ A;  1DLO B;  2OPP A;  3MM9 A;  1Q95 G;  3IWN C;  1FXL A;  4DR4 F;  2HYI B;  2EFQ A;  5DZ6 A;  2X1A A;  2C2E A;  1RWO B;  2JSX A;  1UFW A;  3QT7 A;  1QLN A;  1KON A;  1TL3 B;  1UW9 A;  2B43 A;  2X7I A;  3N6L A;  3WHI A;  1HD0 A;  1VRT A;  2YWG A;  3PG9 A;  1CBK A;  4B3M J;  2CPH A;  1RAD B;  2MQM A;  3LW5 C;  4AL6 A;  1D09 B;  5IV4 A;  1GTE A;  1TKT B;  1HWK A;  2AX0 A;  3VQT A;  2EKN A;  2H5J B;  1T3O A;  4X62 F;  3IRW P;  2BAB A;  2W8D A;  4ER8 A;  2UV8 G;  3M2V B;  2RDD A;  1RT5 B;  2F4V F;  3QRQ A;  3MM7 A;  1L5U A;  4AND A;  4J90 A;  1TL1 B;  2EWH A;  2CA9 A;  1KHJ A;  1X5T A;  4DPX A;  1I5O B;  3QRP A;  5KG3 A;  4J37 A;  4NAS A;  2XMU A;  4DL5 A;  5KFP A;  2V94 A;  2W8S A;  3UDL A;  3KG0 A;  5E0O A;  4ID5 B;  3DM2 B;  4ZPT R;  4U7U K;  1PC5 A;  4ECV A;  2DH8 A;  2U1A A;  4WE1 B;  1ZEF A;  3K5N A;  1VC6 A;  2D69 A;  1IM6 A;  1CJU A;  5ETN A;  4TU7 A;  4MY4 A;  3MD3 A;  3QGG A;  2VG6 B;  2RS2 A;  2ZOF A;  3KHR A;  5HN0 A;  2AQ4 A;  3TP2 A;  4X4P A;  1KSP A;  1EQJ A;  1FE4 A;  1WD6 A;  4AQY J;  3CJQ A;  4OLP A;  5I3U A;  1N5S A;  1T95 A;  2VDI A;  4C6A A;  3VWS A;  1GNK A;  2CQB A;  3DLE B;  2C3M A;  4ZVQ B;  1L3V A;  2IC3 B;  1MN7 A;  4FDF A;  2RS8 A;  1LW2 B;  5C25 A;  4OYO A;  2R8H A;  3SZ2 A;  3DLB A;  2VOO A;  2CJB A;  2JX2 A;  4RWX A;  1HNZ F;  3MR7 A;  4NLX A;  1L3K A;  1T94 A;  3OFE A;  4JB8 B;  4C98 A;  4FXV A;  1TK5 A;  1FKP B;  3GP9 A;  2QL5 B;  4CH1 A;  1SKU B;  3GIR A;  3H40 A;  4DL3 A;  4Y6I A;  5IOL A;  3PW7 A;  4Y3C A;  4PKD B;  3T3F A;  1RYS A;  3GFZ A;  2X1B A;  2ZHB A;  4YB1 P;  3M2R B;  1VYA A;  4KQZ A;  3IBW A;  1N56 A;  3PR4 A;  2V8D A;  1NB7 A;  2BEF A;  4O0I A;  1R0A A;  1JLC A;  1HR0 F;  2J9D E;  2RRN A;  2FTR A;  1U0S A;  3MPV A;  1HYS B;  1MW7 A;  2V4Q A;  2DKO B;  4RUC A;  4LF8 J;  4BC7 A;  1FVS A;  2HHQ A;  1RGV A;  3GMG A;  4DOZ A;  2F1F A;  2XZT B;  4B3S F;  1BC6 A;  4C0O C;  5J2N B;  3SQG B;  2JVR A;  4ZHR B;  2CFX A;  4K7Q A;  1QAY A;  2UXC F;  2E5I A;  2HHT A;  3LA0 A;  1RHQ B;  2HVE A;  2ZKT A;  3P5T L;  4CM0 A;  3Q24 A;  4DL6 A;  2IUC B;  1R43 A;  4K2J A;  5E2Q A;  5GAD U;  1TKD A;  4ZLJ A;  1NUE A;  3T41 A;  4ALZ A;  4IDK B;  4CTA B;  2HIY A;  2I9S A;  3I9Z A;  6AT1 B;  5HBM B;  3M8Q B;  2KT3 A;  3R5A A;  4FYV B;  1Y4Z B;  1FRX A;  2RRB A;  3M05 A;  5JMN A;  2E1R A;  4KO0 A;  1XMQ F;  1GH8 A;  2QC3 A;  3NGU A;  4CLF A;  2BYC A;  5B08 A;  2FJV A;  2HIQ A;  4OZ0 A;  1Y5N B;  2QLB B;  4AYB D;  2RF2 A;  3CMR A;  4O3N A;  5IZH A;  4PZV A;  2LCW A;  2W7P A;  2DR7 A;  1HNV A;  3HJF A;  3GG1 A;  3Q8V A;  2E1C A;  3F73 A;  2WAQ D;  1NKB A;  5A6W A;  1G6B A;  4TLQ A;  2DVI A;  5EGE A;  3G82 A;  3N6M A;  1S9G A;  3HUL A;  3IBC B;  4QQB A;  3PW4 A;  4RW9 B;  4WP3 A;  2VIH A;  1WEY A;  3NP5 A;  1CJT B;  3GON A;  1VQM S;  3DLG A;  2VDH A;  1JIH A;  4BS2 A;  5L9X A;  2HRU A;  3QAT A;  2XO7 A;  1HNI A;  2LXI A;  3RR7 A;  2OPS A;  3ISN C;  1HBU A;  1X4F A;  2OMO A;  4KIA A;  4EFA C;  1XMO J;  4QYZ K;  2OEM A;  3TYT A;  3SZZ A;  2C2Z B;  2M8H A;  1F9F A;  2E5J A;  5DJB A;  1ZOT A;  1RWV B;  3ETM A;  5HAT A;  3SCL E;  4B02 A;  1LXN A;  4B3M F;  4MK8 A;  2A1B A;  1DBD A;  3MMC B;  1U0H B;  1ZM3 A;  4Q8E A;  4Y34 A;  3M6W A;  2V2K A;  2BVZ A;  4UUW A;  2F8H A;  4KPY A;  1JLF B;  1ZAW A;  2VBZ A;  3H7H B;  3RYL A;  5IXU A;  3V2U C;  5GOV A;  5D3G B;  1JNR B;  1O0P A;  5HP1 B;  2KXF A;  4R8U A;  4JV2 A;  4GTW A;  4CP5 A;  5CXT A;  4K2X A;  2DCU B;  1XTZ A;  1SVD A;  4OYZ A;  1BWV A;  4WBF A;  2OAU A;  4YR3 A;  4DV2 F;  4PYA A;  2GA7 A;  1S1V A;  2Y3Y A;  2ZUG A;  4F25 A;  1YQH A;  1LQ9 A;  3TOQ A;  2JLE A;  4RU2 A;  4IRC A;  3ENA A;  1U47 A;  4M5N A;  3TR5 A;  4YP3 A;  4NLS A;  1FDB A;  5A8K A;  2MKY A;  3MCM A;  3UCU P;  4EBC A;  3HHK A;  2FHK A;  2B0G A;  4RW4 B;  1VJQ A;  2CYY A;  1VR6 A;  3FCH A;  4QBU A;  3G6Y A;  3KHH A;  3TUP A;  4LF4 F;  2NXN A;  1Q8K A;  3M9M B;  3PV8 A;  3FEY B;  2VBY A;  3WBH A;  3GJQ B;  1BHN A;  1S79 A;  4O0N A;  5ETT A;  5DM6 Q;  1RT7 A;  4AXI A;  1WC6 A;  2LEB A;  1C0U B;  4JYA J;  1YI2 S;  4Q8F A;  1FEE A;  2CJQ A;  3MM6 A;  2W5S A;  4UPK A;  2HHH J;  3T1H J;  2DGW A;  1SC3 B;  1S6P A;  1RTH B;  1S1X A;  2V8V A;  3CJK A;  1WC5 A;  5HSP A;  2B56 A;  2X3D A;  3DMJ A;  3UI3 A;  1IWA A;  3RBD A;  1J5O B;  2DPJ A;  2W5V A;  1FRL A;  3SMZ A;  4WIQ A;  3CCE S;  3PX4 A;  3R5D A;  1RT6 A;  3SIP B;  1DAX A;  1M1G A;  1XR6 A;  2HKE A;  2OGU A;  4KHP J;  1HHS A;  2AEF A;  1S1T B;  2CQD A;  3C14 A;  4MKA A;  1U0H A;  3AB4 B;  2DRA A;  4O3Q A;  1YJT A;  5HO4 A;  3U1N A;  2YQ1 A;  1GEH A;  2IM1 A;  4J9V A;  5ETQ A;  1N5Y B;  2QEX S;  4DSJ A;  1HQA A;  1VOM A;  2YPY A;  1S1U A;  4A8Q A;  2YNG A;  3HX9 A;  2HHU A;  1NPP A;  2XR9 A;  2MEW A;  3CDE A;  3OR1 B;  4MIW A;  4YB7 A;  3UDV A;  5KTQ A;  3H5X A;  2OD4 A;  3JS9 A;  2EFV A;  4I68 A;  1T3N A;  5DG8 A;  2QV6 A;  3R8Y A;  4QWD A;  4J9R A;  4A8K A;  4LFC F;  2IJN A;  2J5A A;  2F8E X;  3W8P A;  5F9L A;  1WOS A;  2YQ0 A;  3N4W A;  3Q83 A;  4JI4 F;  3G9C A;  4X4V A;  2VFU A;  1RWN B;  4Q2M A;  3C14 B;  3EUN A;  3U1M A;  4B9V A;  1FX4 A;  1S1T A;  1TUV A;  2B9E A;  3QZ8 A;  2FY1 A;  2HFV A;  2IYI A;  2PEH A;  3TVZ A;  3DN9 A;  6FD1 A;  4Q2L A;  5HMX A;  2OO4 A;  3DMJ B;  4HYK A;  4B3T J;  1CQM A;  3W3S A;  5INH A;  1NKC A;  4XIU A;  2DXF A;  4I4B A;  3MPU B;  2HZV A;  1SQG A;  4F0H A;  1Q16 B;  1HPZ B;  4WWS A;  3F41 A;  2LA4 A;  4DCJ B;  1SUQ B;  2A6M A;  3CJ3 A;  3UPF A;  4DL4 A;  4WKY A;  4ZLN A;  4P2S A;  1GQE A;  4L75 A;  2LFV A;  4ETX A;  5LT5 A;  4LF9 F;  1RAE B;  1X0P A;  1DJ0 A;  2BKP A;  5D77 A;  1ELY A;  4OFZ A;  3MUM P;  3NGD A;  1QUV A;  2UUT A;  3K58 A;  2ADB A;  1REV A;  1RT1 A;  2ZJR Q;  4KJG A;  4MMO A;  4WZM A;  1M0S A;  3GYG A;  2DHG A;  5DDR C;  2CQ2 A;  1VCT A;  3ENQ A;  3RBX A;  5F8M A;  2WCX A;  4KGV B;  3A12 A;  5ETL A;  3A4T A;  5ETV A;  1KS2 A;  2DNM A;  5KFH A;  4Q5V A;  3G6E S;  1N36 J;  4ED8 A;  2A6O A;  1RLC L;  3DHW C;  3NS5 A;  3KXD A;  3OJU A;  5J2P A;  4J7C A;  2LQ9 A;  3KOA A;  3H2V E;  1JLE B;  3FGV A;  4JI6 F;  1OY6 A;  1CUL B;  1FFG B;  3D9B A;  5F8N A;  2P2C B;  1XC9 A;  2HHP A;  3HZE A;  4EBE A;  2WK4 A;  3LPE A;  3OQ2 A;  2HQI A;  4LSZ B;  4KFB B;  1RA7 A;  4EO8 A;  4UOG A;  1SV5 B;  1WTF A;  1EKR A;  4ES2 A;  2YX1 A;  1WEZ A;  2LA6 A;  4P10 A;  4EGL A;  4CI0 B;  1G3O A;  1HBO B;  1YBU A;  2NXU A;  3W66 A;  3HVR A;  4EBD A;  5H9E K;  4FF2 A;  5ETM A;  1SH3 A;  4DFP A;  3IWX A;  1KHL A;  5M2P A;  4Y2K A;  1VQ4 S;  3NKQ A;  2HK3 A;  3HZG A;  3CD7 A;  2I5J B;  3HMJ G;  2N4C A;  4PAA A;  1WHY A;  3ETO A;  3RGI A;  3FBC A;  4CO1 A;  5AJ3 J;  2M3D A;  4C2M A;  4OI6 A;  3HT3 A;  2RU3 A;  2KFZ A;  1U2F A;  2CJK A;  1XQI A;  2ZM6 F;  4FVC A;  3PO4 A;  3GJS B;  3A8I A;  2DK2 A;  1M5O C;  3ZXW A;  3VAJ A;  2BJE A;  3PXG a;  4BCA A;  4JI3 J;  4N7T A;  1ZED A;  1A6L A;  2O5D A;  2VPX B;  2DEJ A;  3IS9 A;  4CO3 A;  4LQY A;  1TZ0 A;  2BKN A;  1VQ7 S;  1U49 A;  2AZ3 A;  3W5Y A;  2W4C A;  4DR2 F;  2BDP A;  1SB6 A;  3QT6 A;  4ECQ A;  5IM0 A;  3Q22 A;  2VF3 A;  3IRX A;  3R5B A;  2AW0 A;  3AJD A;  3BDP A;  5GAG I;  5IWA F;  4TU9 A;  2W2M P;  5HQL A;  2NRE A;  4FYD A;  4ZLL A;  2HWI A;  2ZBQ A;  3UWT A;  2CNK B;  2DIV A;  1TL1 A;  3BN4 A;  4LBH A;  3TJ8 A;  5J2M B;  3TUZ C;  3M8S A;  1XNQ J;  2Q66 A;  2RIL A;  1E6Y B;  3ENV A;  4HT7 A;  2WSC C;  1N2L A;  3ZTR A;  2DNY A;  2M2B A;  3BR8 A;  1OJ4 A;  2XMA A;  5L1L A;  3RZA A;  2DO4 A;  1ED8 A;  1QD1 A;  4ZOS A;  4N8O A;  3CDW A;  2E7W A;  3EXC X;  3KDO A;  1WAC A;  5D4P A;  1JLC B;  2AJ1 A;  2YTC A;  1RCX B;  1RT3 A;  2E1P A;  1OPZ A;  3EJM A;  4MIB A;  5F8L A;  2MQP A;  3PKY A;  1Q81 T;  1Q0N A;  4NA1 A;  3DLJ A;  2RUG A;  5AJ3 F;  5GME A;  5K8M A;  2GO8 A;  1U26 A;  4G1Q A;  3NS7 B;  1IBL F;  2O1P A;  5GAE I;  4OHY A;  1SIW B;  3N28 A;  1RUS A;  1KLM B;  2RHQ B;  4F04 B;  2ERR A;  1WG4 A;  3B4M A;  2F3J A;  1IKY A;  2VBX A;  4JBC A;  5CYQ B;  5BR8 J;  4CO0 A;  3MFH A;  4LR2 A;  2HFN A;  4J91 A;  5HQM A;  2V5H G;  1HWL A;  2V67 A;  4G1Q B;  5L8R C;  3FBB A;  4MH8 A;  3RRH A;  3PO5 A;  3QJJ A;  2YWF A;  1R8C A;  3N5F A;  4FKX A;  1EIY B;  3MR5 A;  2XB2 D;  5HRO A;  2YWH A;  1GXT A;  3I5B A;  1Q78 A;  1FJ7 A;  1RTZ A;  1E2S P;  3M6V A;  2MPU A;  8ATC B;  4CLU A;  1QTN B;  2KXN B;  2ZD1 B;  4CYU B;  4RW9 A;  1WWH A;  3FRY A;  5HLF B;  2GCF A;  1S76 D;  2KVQ E;  5F41 A;  2UUA F;  3NKM A;  4MK7 A;  4M5K A;  4DV0 F;  4LF5 J;  3ZC4 A;  3AY0 A;  4J9L A;  3LAL A;  2E5L F;  3FBF A;  2XGP A;  2DNH A;  2RB7 A;  3MHY A;  1XMQ J;  3BDF A;  1AT1 B;  1AB8 A;  1TR0 A;  5KOX A;  2YWW A;  1CJV B;  1LFP A;  2L9D A;  4Y2A A;  3S8S A;  1REG X;  1QJH A;  3E2E A;  1IR0 A;  3FVY A;  5I3P A;  5HJY A;  4IH6 A;  1EB0 A;  3KLH B;  3CC2 S;  1MMD A;  4B9M A;  4Y65 A;  1FK9 A;  1KVK A;  2GJI A;  1Q8I A;  3QLH A;  5BYR A;  3HK2 A;  4GKK F;  3UDC A;  4DPO A;  4HVZ A;  1VIX A;  1WG5 A;  4O3O A;  1FXD A;  4DR6 F;  3JAM U;  3BDE A;  1FNM A;  1AJA A;  2VOP A;  4GC7 A;  3KJV A;  1RJJ A;  3BSC A;  3IG1 B;  4PQA A;  5KFI A;  4PWU A;  5F9N A;  5JUM A;  1SJF A;  4LMZ A;  2G2Y A;  2ZH2 A;  4NLU A;  3GYX B;  3P3D A;  1KNZ A;  1ZM9 A;  4C97 A;  3ZTP A;  3I4P A;  1H3D A;  2HMI A;  1TP7 A;  4OJH A;  3TAQ A;  1NU4 A;  2K3K A;  1IKY B;  3NGS A;  5FDL A;  3OTO J;  1RAF B;  3CUL A;  2ZWO A;  3QSY B;  4KE5 A;  3H4B A;  1U8S A;  1VQK S;  4G6V B;  1UPP A;  3D1Q A;  1PYS B;  1RWW B;  2KRR A;  1UWB B;  1N88 A;  3D1H A;  4OYB A;  3J7A 1;  4AL5 A;  3NKN A;  2MQL A;  1H6K X;  3K5O A;  1UVJ A;  2IRU A;  3AJ1 A;  2MY7 A;  5LM7 E;  4L76 A;  2ALY B;  1YDL A;  4DFJ A;  2BOP A;  2JEG A;  2VJU A;  4B9S A;  1ANJ A;  1UET A;  3DLG B;  4DV5 J;  3PX6 A;  1CSJ A;  1P1L A;  1EET A;  2P6T A;  4WFA Q;  1H38 A;  1UEV A;  2SXL A;  1YZ6 A;  1EP4 A;  1QSS A;  4KRW A;  4OYA A;  4ZVH A;  1ZAV A;  4PXC A;  1Z4U A;  4JV5 J;  1WEX A;  1ZZF A;  5D0R A;  1TTH B;  2DNQ A;  2W4P A;  5G0R B;  4CLZ A;  2C2N A;  4NZ0 A;  4OHX A;  4M95 A;  5L1J A;  1HQE B;  1OYE A;  1NHV A;  5L0B A;  4P72 A;  1I94 F;  2ZUA A;  1QAX A;  3UQS A;  1ZPW X;  2HNZ B;  3SXL A;  1VQN S;  3V81 B;  3DYC A;  3NGT A;  4L73 A;  4CXK A;  2CPJ A;  3MCO A;  2E9R X;  1RDR A;  4ZIT A;  5IWA J;  2J6T A;  4KC5 A;  1OIA A;  1LK7 A;  1WC4 A;  5KOW A;  3HHL A;  1IKW B;  2DEI A;  1GMU A;  2XMM A;  1HBM B;  1R7I A;  1HPZ A;  2MTL A;  4L3K A;  2PGC A;  3UNY A;  4QWA A;  4IDK A;  4CTA A;  4X65 F;  4NLT A;  1NJX A;  2OD6 A;  2RIJ A;  3TJ9 A;  3FBE A;  4N76 A;  3R7N B;  1X9W A;  3NWG A;  1NK5 A;  2W5W A;  1DHM A;  3M8R A;  4LF7 J;  1OYD A;  4DG1 A;  2ZVI A;  1YJ7 A;  3UN2 A;  3VTI A;  1LEO A;  4X64 J;  3QQC D;  5H1S V;  2HBZ B;  3K57 A;  5B0D A;  1QSY A;  2Q6B A;  1YTY A;  4NXN F;  3FDS A;  5J2Q A;  1M1H A;  3PAC A;  4ED3 A;  3WC2 A;  1NJW A;  4EK2 A;  3OL8 A;  3FSI A;  1FD2 A;  1T9X A;  3EGV A;  5DQI A;  3KLF B;  3JSM B;  3WAX A;  3G87 A;  2HVH A;  4QYZ J;  2HQC A;  4P7V A;  4UZB A;  2NSC A;  2R3V A;  1AFI A;  3D0H E;  3CCU S;  1S48 A;  1TUG B;  2PDA A;  5LMN F;  3M1V A;  2KHD A;  1PIE A;  2LU2 A;  2W1B A;  3AD9 C;  2PC6 A;  3KFW X;  1RHR B;  2DGT A;  4H4O B;  5HJX A;  2HWH A;  1Y7A A;  1NBE B;  3KJV B;  2O66 A;  3MAQ A;  3UE2 A;  1D9D A;  2KH9 A;  4K4W A;  1FA0 A;  1NKE A;  2CQ4 A;  5L46 A;  4M5H A;  1ZA1 B;  2LVW A;  5E3Q A;  4L3N A;  4DG1 B;  3KK1 A;  4JI8 J;  2FHO B;  1J27 A;  2B5J A;  2XSJ B;  5LMN J;  2UXD J;  1Q5Y A;  2KFY A;  1RP5 A;  1TVR A;  1RT1 B;  4ZVP B;  2LKZ A;  3UFC X;  1GXL A;  4LF7 F;  3J80 U;  2IFY A;  4MKV A;  2ZH8 A;  2RKI B;  4UOP A;  3GSI A;  3P45 B;  5EUH A;  4KPC A;  4USV A;  2DGX A;  2R7R A;  1YKW A;  4FF4 A;  1MN9 A;  1UPM B;  3FNN A;  2YKN A;  1IKW A;  1Y3K A;  1IKV B;  4HAC A;  1SC4 B;  2ZDO A;  4DFK A;  3NOC A;  4KGX B;  2VG5 B;  4DSL A;  4DU7 A;  1KQS R;  1Y5L B;  3HSG A;  3HSD A;  2CNN B;  2GMH A;  4NA2 A;  4NLD A;  2A10 A;  1D0E A;  3KK2 B;  5DLW A;  5K8O A;  4QR0 A;  4ID8 A;  1QAI A;  3KDN A;  1TKZ A;  5LQQ A;  2DGS A;  2DD8 S;  5JVH Q;  3V6K A;  5A0Y B;  4K4T A;  3RRG A;  5KXA A;  3C8Y A;  1YJ9 S;  3G6V A;  2R42 A;  1YJR A;  2ZDP A;  1TVR B;  4ENO A;  1F3F A;  4ICL A;  2O01 C;  4QPX A;  3G4S S;  1R8H A;  3BPD A;  4P52 A;  2XMJ A;  3RG6 A;  2VJV A;  3NS6 A;  2KVI A;  3EZU A;  4ZHR A;  2CDR B;  3BS9 A;  4H4K A;  4A8F A;  2HNY A;  3WBZ A;  4M63 A;  4DV6 J;  2GSU A;  2OFG X;  3C3L A;  2YH1 A;  5DGA A;  1JB0 C;  3Q8U A;  1RKJ A;  2LDI A;  4DX6 A;  4ZVE A;  1FJG F;  1PJ5 A;  1F2H A;  1RCO B;  1HQU A;  2DH7 A;  4ZP8 A;  3W1Y C;  5LJ3 Y;  2V0N A;  1AJC A;  3CDA A;  1NK0 A;  2C22 A;  4WP8 A;  1DTQ A;  2E9T A;  1VI7 A;  3DDK A;  2MGZ B;  3D5M A;  2UUB F;  1UFK A;  2YH0 A;  3LUY A;  3IA0 A;  3FZ2 A;  3CJ5 A;  2ZZM A;  2AEM A;  3I0R B;  3L09 A;  5K14 A;  2YPZ A;  3QO9 B;  5D6G A;  3IG1 A;  3P5B P;  3H5S A;  1ICE B;  4LIW A;  5E33 A;  4DV4 J;  2MZT A;  2HW3 A;  3EGW B;  4XO0 A;  3L95 X;  3R27 A;  3KYL A;  2UVR A;  1HDH A;  2W2Q P;  1C0T A;  2OPP B;  2FZK B;  2HS4 A;  4UQG A;  4QIE A;  3TVK A;  3CCV S;  3EPI A;  2QLW A;  4RR5 A;  1A7G E;  2B4P A;  3I0S A;  4U7C A;  2D3O R;  1K73 T;  3BYR A;  1U7L A;  2QSF A;  4KHP F;  3NY0 A;  2OML A;  4DLG A;  1W2B R;  4LF9 J;  1JLB B;  1RWM B;  4XTT A;  3KLE A;  2A0F B;  3J7A N;  2MKH A;  2PSZ A;  2CJY B;  1YJU A;  2R7W A;  3V4I A;  2EXU A;  2FJB B;  2XYG B;  3Q8Q B;  3T5K A;  2AYM A;  2QMU B;  2ASD A;  4OI0 A;  1FK9 B;  2DJW A;  1JKH B;  3HXM A;  3Q23 A;  2FLO A;  3TWZ A;  4DPT A;  2V4R A;  2J0S D;  2WSF C;  5KFX A;  2GFF A;  1NDK A;  3BO2 A;  1RXO B;  1ZEB A;  3HDS A;  5DS7 A;  3KNA A;  5DLV A;  3IAS 9;  3O6Q A;  5D4O A;  4OX9 F;  4IR9 A;  4YB5 A;  2ZH9 A;  2AWZ A;  3QT5 A;  4QWC A;  2EC2 A;  3GIK A;  3EMT A;  4B3T F;  4M94 A;  1S6Q B;  1Y5I B;  1S12 A;  3IR6 B;  3ZZY A;  4U9R A;  2M8D B;  4M8L A;  4J9K A;  4LR7 A;  4TYB A;  1L3T A;  2ZD1 A;  3X3U A;  3M2V A;  3ED4 A;  4ECY A;  3MXH P;  3SSR A;  2V69 A;  2A3J A;  4NYZ A;  3PVX A;  2VD3 A;  4NLP A;  4PXB A;  3CCJ S;  2UUA J;  2VAS A;  2WON B;  1V5I B;  5A8R A;  2N3O A;  4ATN A;  1URR A;  3THV A;  1DTT A;  3QAE A;  3LQV A;  3U02 A;  1SHQ A;  3O8W A;  4ZPC A;  5EX3 A;  2E5L J;  1NEE A;  2B9X A;  3TZZ A;  2N82 B;  1X60 A;  1RYR A;  2B51 A;  4J9N A;  4MTP A;  3ZZP A;  7FDR A;  4TKT A;  4J9M A;  3BSN A;  4DLE A;  4A8S A;  1FNX H;  4L72 B;  2HSE B;  3KKF A;  2IJF A;  4A8O A;  4X4S A;  3TAP A;  3B82 A;  1YRX A;  4DSK A;  2CDQ A;  3MED B;  1N54 B;  1PKU A;  2DGV A;  4LVN P;  4YUD A;  2Z4P A;  2P5V A;  1X8D A;  4K8R A;  5L38 A;  4C3K A;  2W9C A;  4UPI A;  1DLO A;  1B64 A;  4CYU A;  1KQG B;  1S7I A;  1N0V C;  2VPW B;  3GPA A;  4DPU A;  2D3Z A;  3HT0 A;  4DR6 J;  3DOL B;  4ED7 A;  3BN7 A;  1REV B;  5F0U A;  5D8H B;  4V19 X;  3AFG A;  1GT8 A;  1V5V A;  3OTB A;  1RT2 B;  4E2F B;  3GZ7 A;  5C7P A;  1AZS B;  2OKQ A;  3MI7 X;  4PWD A;  3DLL Q;  1Z1Z A;  2CPZ A;  2CWK A;  2R7U A;  1ELZ A;  4C3M A;  3GV7 B;  3OLB A;  3SDE B;  3OFF A;  2KU7 A;  4F0K A;  1RI7 A;  3D3B J;  4UPH A;  1KLM A;  3SCJ E;  3L7O A;  2GV1 A;  4CWB A;  3W2V A;  1YVF A;  2F63 A;  3BGU A;  5KFQ A;  5KG1 A;  3KMS A;  1CLF A;  3MM8 B;  5K9F A;  4ZIW A;  1SCJ B;  3C15 A;  4GC6 A;  1HNW J;  2P9E A;  1KTV A;  2MZQ A;  2I5J A;  4ZVF A;  4WZQ A;  4OJ1 A;  2CPD A;  3QBC A;  2XCP A;  4KR0 B;  3BJY A;  4CNZ A;  1AZS A;  2DTJ A;  2NZC A;  3QIP B;  3RU0 A;  1XNQ F;  3BDG A;  3TG0 A;  1HFE L;  5FD1 A;  3ISZ A;  5HVG A;  3N0V A;  3EZ5 A;  4AD6 A;  1HMV B;  1VK3 A;  2BAC A;  1TQL A;  5JVG Q;  3A13 A;  3C19 A;  1MRO A;  3GR1 A;  1XR5 A;  1WF0 A;  5EWG A;  1N33 J;  2KM8 B;  3LAM A;  4HDG A;  4Y2M A;  4OMF G;  2H3E B;  3OT9 A;  4EYI B;  3DRX A;  2Q3P A;  3ZTQ A;  3BO3 A;  1VRU A;  4ECS A;  1M5P C;  4EO6 A;  1APS A;  3HKZ D;  1C4A A;  4PEO A;  4HR2 A;  1SBR A;  3N01 A;  4HHH A;  2YKP A;  1FES A;  3NGR A;  4QWE A;  1SJR A;  4RO0 A;  4ZGA A;  1NSQ A;  2KT5 A;  3IS9 B;  3VVT A;  3D6M B;  2XMT A;  3PR5 B;  3LWL A;  1UVL A;  3K8V A;  4MHX A;  3HFZ B;  2IAJ B;  3FSX A;  4KAY A;  1UA0 A;  3MTK A;  3EYZ A;  1H2U X;  2DRB A;  3CCL S;  2CAD A;  1RKI A;  4K0K F;  2H4W B;  2FYX A;  5F3T A;  5FII A;  2JRS A;  1FF2 A;  3MFI A;  3EX7 B;  1D8Y A;  4C8Z A;  5J2P B;  3CT9 A;  1P9Y A;  2J9D A;  2P9G A;  5ETS A;  3G71 S;  3VV2 B;  1LW2 A;  5C25 B;  4GVB A;  1O51 A;  5RUB A;  4QPT A;  5EDW A;  4PCQ A;  2EPI A;  1HI8 A;  3N79 A;  4F0M A;  2FHJ A;  4X64 F;  2C28 A;  4RKU C;  4P6Q A;  2JFK A;  1KHW A;  2V2V A;  5HMZ A;  1B7F A;  1C1C A;  3BQ2 A;  1YWX A;  4UPL A;  2VU5 A;  3KLI B;  4U67 Q;  2IHR 1;  2BQ3 A;  3PIO Q;  3DRS A;  1S1W A;  1UFL A;  3D6T B;  1LWF A;  3E51 A;  3J7Y I;  3M9N B;  2DRD A;  3PJW A;  5LMU F;  3OLA A;  2EG1 A;  4HH1 A;  4OLO A;  3W5X A;  3MR2 A;  1WOR A;  1U45 A;  4CRJ A;  3PYG A;  3B5Q A;  2RNE A;  3Q0A A;  2OEJ A;  2DIT A;  5E3P A;  4BC9 A;  1WEL A;  1LW0 B;  1NPR A;  2OPQ A;  4NPO A;  2ZBC A;  4RW8 B;  1JLG A;  5AXK A;  3UD4 P;  3R2C J;  2DNR A;  1EJJ A;  2C3O A;  2ZNZ A;  4AQY F;  4OI4 A;  2KG1 A;  2FPH X;  3CMA S;  4JOU A;  3T00 A;  1U1M A;  4Y00 A;  2A2C A;  4FF1 A;  4NCA A;  1UP1 A;  4LF6 F;  1XMB A;  4QU6 A;  2QA4 S;  1T8E A;  2AYB A;  3CVK A;  1HBO A;  2HEK A;  2QA1 A;  4USK A;  5C42 B;  5A76 A;  1QDU B;  4EMD A;  3C15 B;  2ZHA A;  2DBB A;  3LWM A;  2RDJ A;  1HNI B;  3X1L B;  5C24 B;  1EAR A;  3W62 A;  2W8K A;  4DU8 A;  1NH7 A;  3LP1 B;  3GJT B;  3T01 A;  2B7B B;  4C9D A;  3VAH A;  4LFC J;  3D68 A;  1CJT A;  2XQC A;  4PR6 A;  4AFF A;  4DR7 F;  5HMY A;  1IVZ A;  5KFW A;  1TKX A;  4TVA B;  2W9B A;  2HHV A;  3EZO A;  3WAW A;  4OIX A;  3FK4 A;  2KJW A;  1U25 A;  2FVC A;  1S0N A;  1S9G B;  2MKI A;  1G2E A;  3G82 B;  4CYS A;  2QFI A;  3HVW A;  2XHC A;  4PXE A;  3H59 A;  2I38 A;  4ZP9 A;  5I42 A;  3BRE A;  4WXW A;  2MHE A;  2N7C A;  2RH6 A;  1X4A A;  2BQR A;  2XHW A;  1K1Q A;  3HFV A;  4P73 A;  3Q89 A;  4D3H A;  4DXL A;  2UVU A;  4K0K J;  1Y0H A;  2HLU A;  4GKJ F;  2AJ4 A;  1HW9 A;  2J76 E;  3QWU A;  5HBM A;  4ZMM A;  1X4G A;  1WDD A;  2HZC A;  4Z7C A;  3OFG A;  4ZPA A;  4WCE Q;  2GNK A;  1S9E A;  1SQE A;  1NPK A;  3OUY B;  5CD4 A;  1XER A;  2R2U A;  2IFX A;  3LGN A;  2ZOG A;  3F56 A;  5A8R B;  4JI4 J;  1OQ6 A;  1V3R A;  3KHL A;  3SQG A;  4ZLP A;  2J7U A;  2RDI A;  1SI9 A;  3MMJ A;  5J2N A;  1E1Z P;  5T7L B;  4YY3 J;  1NSP A;  1Z2Z A;  2KJV A;  2UV8 A;  5KFM A;  2B9Y A;  3IR5 B;  4WXO A;  2B8P A;  3UVJ B;  3CDU A;  4CLL A;  1GX6 A;  5KFU A;  4F4W A;  4DWI A;  3C46 A;  5J1E B;  5F8G A;  4RBT A;  4A46 A;  4FPI A;  4C8Y A;  1MSW D;  1BQN A;  1T03 B;  5AE3 A;  1RT7 B;  2CQG A;  2CNL B;  1S1W B;  1YG0 A;  2NYH A;  1S4F A;  3WZ0 A;  2PI4 A;  1UVM A;  1FSU A;  5DLT A;  3EXY A;  2DGO A;  3OSN A;  2FZG B;  2BJ3 A;  1RB0 A;  4KGK A;  3DDI A;  4RW4 A;  4DCO B;  3W8G A;  1ROF A;  2YNH A;  1URB A;  2DY9 A;  2PII A;  4NYO A;  1FWL A;  3NWR A;  2EG2 A;  1HW8 A;  1TMM A;  1UVI A;  2AHO B;  5AT1 B;  1FER A;  2H5E A;  3VZH A;  3LP2 A;  3PRB A;  2AYE A;  4KYZ A;  2IC3 A;  4HHU A;  2VQR A;  1BMQ B;  4BWJ A;  2YY3 A;  4ED5 A;  4WYW A;  3BSO A;  1B8J A;  4DZ6 A;  1UAW A;  4KKO A;  4LBI A;  1SKR A;  2HHW A;  2AKW B;  5D3G A;  1S1X B;  2X98 A;  3GIL A;  4IOC Q;  3OV7 A;  3BGL A;  2I2Y A;  2VC1 A;  1R6V A;  2HGL A;  4E8U A;  5K5M A;  3OVS A;  3DLH A;  4F02 A;  3FSY A;  5CAB A;  4X65 J;  3H4D A;  4A8W A;  1PGZ A;  3RAM A;  1ULR A;  1DZ5 A;  3A52 A;  3K7R A;  4DV7 J;  1YK9 A;  1RTD B;  3JSR A;  3PEJ A;  3PHE A;  4EU0 A;  2XZD B;  3DM2 A;  1R8A A;  1I51 B;  4DN9 A;  5DLG A;  2N4D A;  1U1P A;  1ZA2 B;  4DEZ A;  4WJB A;  1Q1K A;  1T05 A;  1EW8 A;  4PQU B;  2FGO A;  1FCA A;  4NLR A;  4YS2 A;  4ED4 A;  3DPC A;  4ZVT B;  4A47 A;  2Z56 B;  2Y1L B;  4O44 A;  4B56 A;  5BXI A;  4N77 A;  2OHD A;  1KEK A;  3TZW A;  3DC2 A;  2HBY B;  2J8S A;  3WQP A;  2VON A;  4UF4 A;  1N34 J;  2J6U A;  4F4K A;  3BDH A;  3CCZ A;  2V2Z A;  2DIS A;  2ZM6 J;  2HVI A;  3WIU A;  2XLK A;  2W5Q A;  1SXL A;  4AT1 B;  1KTQ A;  2LLZ A;  3VVU A;  3MM8 A;  4YN3 B;  2XLJ A;  2XY5 A;  3KK2 A;  4XDC A;  1T9V A;  2GMJ A;  3GCW P;  3HHL B;  4JV5 F;  2N3L A;  4ZCM A;  3T5H A;  3ONQ A;  4I67 A;  1HAR A;  4DN0 A;  3KMQ A;  4GTX A;  1PC4 A;  2LEP A;  5E3R A;  2VB6 A;  3V81 A;  4CLT A;  1UJ4 A;  4MFB A;  5THW A;  4PWD B;  1MG7 A;  3MGJ A;  1AW0 A;  4JV0 A;  1NRK A;  3FKB A;  4RBU A;  2R9L A;  3DLE A;  4KT0 C;  2KKH A;  3MK1 A;  3EVW A;  4ECW A;  2PT0 A;  1HBN A;  2YNF A;  2IIH A;  1BY9 A;  2Z0G A;  2VOD A;  4ZG7 A;  2QSW A;  2W7O A;  4X4U A;  3PYD A;  2GQQ A;  4X84 A;  3AAW B;  3OTO F;  4F8R A;  2UUC F;  3EIC A;  4ZPW R;  4N5S A;  2MQO A;  1BQX A;  3LP1 A;  3I5C A;  4C48 A;  4NYP A;  4H4O A;  3S01 A;  1XEZ A;  1VIS A;  1RAG B;  1S59 A;  1PYO B;  2JNJ A;  3M1V B;  4HTJ A;  4ID5 A;  3I32 A;  3TQ1 A;  4QOT A;  3K5M A;  1TEL A;  3OR2 A;  1P1T A;  4NE9 C;  4TU8 A;  3D6H B;  3ILL A;  4F4A A;  5CD4 H;  3S7R A;  1BE4 A;  1KLN A;  1AJB A;  2ZVS A;  2WOM B;  2AD9 A;  1F60 B;  3DOK B;  4IFV A;  2BM0 A;  2F9J A;  2DNL A;  4MKB A;  3DGP A;  4RL1 A;  5K4P A;  1NLK L;  2DR9 A; 
#chains in the Genus database with same CATH homology
 4KJG A;  5GRR A;  1AJA A;  1AJD A;  3T02 A;  1ALK A;  1E1Z P;  5L0E A;  2IUC A;  3Q3Q A;  3OT9 A;  4UOR A;  1URA A;  5L0K A;  4UOO A;  1HJK A;  3SZZ A;  1KH4 A;  4CXU A;  1AJC A;  3NKO A;  4ZG6 A;  4LRE A;  2ANH A;  1FSU A;  1KHK A;  5DLT A;  3MK0 A;  3IGZ B;  4ZGA A;  1EI6 A;  3WAV A;  4MHX A;  1URB A;  2D1G A;  3NKN A;  3KD8 A;  4KAY A;  2W5X A;  4GTZ A;  5GOV A;  3M8Y A;  3UN5 A;  2W8D A;  3MK2 A;  1HDH A;  1KHL A;  1ANJ A;  4GTW A;  3IGY B;  1E3C P;  3NKQ A;  1KH5 A;  2VQR A;  3TX0 A;  1KHJ A;  1SHN A;  4FDI A;  1B8J A;  1Y6V A;  2W8S A;  3NVL A;  4YR1 A;  5LRM A;  3BDG B;  2X98 A;  1E33 P;  1ALJ A;  4QAX A;  2GSN A;  5C66 A;  1O99 A;  1ZEF A;  4KAV A;  5L0B A;  4N7T A;  1ZED A;  3M7V A;  1KH7 A;  3IDD A;  3DYC A;  4MY4 A;  4LQY A;  4UPL A;  3TWZ A;  3A52 A;  4FDJ A;  1AUK A;  2W5T A;  3WBH A;  3WAY A;  4CXK A;  5LRN A;  4LRF A;  1EQJ A;  1ZEB A;  5IJS A;  1ED9 A;  3LXQ A;  5DLV A;  3UO0 A;  2W5S A;  4LRA A;  4UPK A;  1O98 A;  2GLQ A;  1EW8 A;  4UPI A;  5AJ9 A;  5TJ3 A;  1EW2 A;  3B5Q A;  3UNY A;  1N2L A;  3DPC A;  1ALI A;  2W5V A;  4LR7 A;  2XRG A;  5LIA A;  4B56 A;  3ED4 A;  1EJJ A;  1ED8 A;  4LRC A;  2W5W A;  1ANI A;  3T00 A;  3UN2 A;  3BDH A;  1SHQ A;  1HQA A;  1P49 A;  2G9Y A;  2W5Q A;  1ALH A;  2GA3 A;  4NWX A;  2XR9 A;  3WAX A;  3M8W A;  4LR2 A;  4GTX A;  3T01 A;  3NKR A;  1Y7A A;  3NKP A;  4LRB A;  4LR9 A;  4KJD A;  1KH9 A;  5HRT A;  1KHN A;  3WAW A;  2IUC B;  2ZKT A;  3MK1 A;  5EGH A;  4CYS A;  1E2S P;  1K7H A;  2GSO A;  4ZG7 A;  2IFY A;  4KM4 A;  4UOP A;  1ELZ A;  4LR8 A;  2RH6 A;  2W5R A;  3E2D A;  3NKM A;  5INH A;  2GSU A;  4LRD A;  3M8Z A;  4UPH A;  3BDF A;  1N2K A;  4GTY A;  4NWJ A;  4MIV A;  3CMR A;  3UN3 A;  4ZG9 A;  5DLW A;  5IJQ A;  5LQQ A;  1AJB A;  4TN0 A;  1ELX A;  1ELY A;  4CYR A;  1EW9 A;  5EGE A;  3SZY A;  5KXA A;  2QZU A;  3TG0 A;  3BDG A;  5K4P A;  4CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...