3M8ZA

Phosphopentomutase from bacillus cereus bound with ribose-5-phosphate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8zA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8zA01
4ZG7A 2W5QA 3LXQA 2GSNA 1P49A 4KM4A 5LIAA 1HQAA 1ELZA 1E2SP 2XRGA 3KD8A 3WBHA 4CYSA 4QAXA 4UPKA 1KH7A 3TG0A 1ELYA 5INHA 3NKPA 1KHKA 1KHNA 1KH4A 3MK1A 4KAYA 3T00A 2W5RA 3SZZA 2W8SA 1HDHA 3B5QA 5TJ3A 1KHJA 1E3CP 5L0KA 1AUKA 1FSUA 1E1ZP 4LREA 3UO0A 1AJDA 3SZYA 5L0EA 1K7HA 4GTXA 4CXUA 4YR1A 4LR9A 2W8DA 3ED4A 2GSOA 3WAXA 4CYRA 4LRDA 4CXSA 4LRBA 4MHXA 5IJSA 3NKRA 5AJ9A 1Y7AA 3IGZB 4MY4A 5EGHA 3CMRA 3UN3A 1KHLA 5EGEA 2GA3A 3UNYA 4ZGAA 3NKQA 1EJJA 1AJAA 1ELXA 3WAWA 3T01A 3Q3QA 4UORA 3UN2A 2VQRA 1E33P 1EW9A 4LR2A 5KXAA 2GLQA 2IUCA 1KH9A 3IGYB 1AJCA 5LRMA 1ZEFA 3TX0A 1EW2A 3OT9A 3E2DA 2W5WA 3UN5A 3BDHA 4UPHA 3M8WA 1URBA 1ZEBA 5C66A 3T02A 4NWXA 1ZEDA 4TN0A 1O99A 4UOOA 5DLWA 2QZUA 3MK2A 4FDJA 3M8YA 3TWZA 1EW8A 4GTZA 2X98A 3A52A 4FDIA 4ZG6A 1SHNA 3DPCA 1N2KA 2ZKTA 5L0BA 1O98A 1B8JA 1KH5A 3BDGA 4LR8A 4ZG9A 4UPIA 1AJBA 1HJKA 3NVLA 4KJDA 3NKMA 4LQYA 3WAYA 5LRNA 4LR7A 2IUCB 1ALHA 5HRTA 1ED9A 1N2LA 1ALKA 1EI6A 5K4PA 3BDGB 2IFYA 2ANHA 2RH6A 2D1GA 2W5TA 3NKNA 5LQQA 4N7TA 4CXKA 5GRRA 4LRFA 1ALJA 4MIVA 3IDDA 5DLTA 2W5SA 3WAVA 2W5VA 4UOPA 3DYCA 4LRCA 1ALIA 2GSUA 3M8ZA 3M7VA 1EQJA 5IJQA 1Y6VA 3NKOA 5GOVA 4KJGA 1URAA 4LRAA 5DLVA 2G9YA 2W5XA 2XR9A 4NWJA 1ED8A 1ANIA 3BDFA 4B56A 1ANJA 4GTWA 4KAVA 4GTYA 1SHQA 4UPLA 3MK0A
chains in the Genus database with same CATH superfamily
4X64F 1SJFA 3HKWA 3MEDA 5J2NA 1WKJA 3T9NA 3TW0A 4B3TJ 2K1RB 3AA8A 1B64A 4C3KA 2A1BA 5K8PA 4XPEA 1FTRA 1AZSB 3LAMA 4OYPA 3TUJC 1TAUA 5I4MA 5HL7Q 5E5NA 1XNQJ 5KAKA 5AE2A 4WP3A 2MGZB 4F26A 1HNZJ 2J0SD 3JSMA 2FYXA 2LCWA 3DOLB 4UOCA 1RT7B 2VG6B 2XWYA 3CJ5A 5KFDA 2AJ2A 3PTWA 1LK7A 4Y34A 3G71S 4LT6A 1S9GA 2YH0A 2DNGA 2PN6A 4Z37A 3BGUA 3MEGA 2C3PA 2Y3YA 1BY9A 4JOUA 4RNHA 4EFAC 4DV0J 2EFPA 5L1IA 1HMVA 4KQZA 2DIVA 5FLXY 2ALZA 1T7PA 1MWYA 4LF4F 3G86A 4WPAA 1GAOA 1OIAA 3C6TB 1T03A 1HR0J 1AYEA 1BWEA 4LRDA 4CTAB 3EGZA 1LW0B 2P8IA 1S6QA 2OPQA 5D78A 1U2CA 3PYEA 5LSOA 4DWIA 1CC7A 3CJQA 1DTQB 2KM8B 1KC8T 1TK0A 1V3SA 3DLGB 5AJ3J 3V6HA 3PW4A 1KVKA 4MIWA 2D74B 1I51B 1N54B 3H2VE 2AQ4A 3QSYB 1GX5A 3I0RB 4P7TA 3CJ3A 2DR9A 2KRRA 3T01A 3QO9B 5EGYA 2QL7B 4TYAA 2CDQA 2FJWA 3RRKA 1HBUB 2X1GA 3HFZB 1KH9A 2HVHA 1REVB 3ISNC 3TUIC 3BKTA 2MKYA 2WVCA 5BR8J 4DUZF 3EVWA 1VLOA 2WSEC 3MAAA 1TL7B 1ZZNA 3Q8QB 4ED1A 1B3TA 3CUNA 1EAYC 2VB6A 3CDEA 4GMKA 1WG5A 4IH5A 4A8QA 4CZCA 1U2FA 1VIXA 1SH0A 1NSAA 2MQOA 1KONA 1N5YB 4OYAA 4NWXA 5C66A 4Q7AA 4DX6A 4KHMA 5GMEA 2AV5A 2UZAA 4J9RA 2R7WA 2ACMA 3MTKA 3NNCA 2I38A 4X62J 4KJIA 4FDJA 4YEAA 3IO1A 3I4PA 3NWRA 1N34J 3FBEA 4MJKA 5DZ6A 3PX4A 4RW8A 4WFZA 1N33J 1Y9OA 2AX1A 2XHCA 3NOGA 3CF5Q 1UZHA 3MUVP 2QLXA 4WU2A 1T3NA 1LEOA 1S5ZA 3FDSA 3OTEA 4F25A 4KTQA 5EX3A 4P75A 2ZNYA 2GW8A 2I6WA 2F9JA 4BCAA 1S1VB 2FVCA 2QLBB 3GU0A 2YPYA 1ZETA 4KR0B 3DOLA 4FYWB 1XNRF 4RW7A 4D3GA 2KN4A 3FRYA 1KNZA 3OL9A 1TV6A 2D1GA 4ER8A 4F2RA 4HACA 2B9WA 4URQU 1RXOB 3PRVA 4NLRA 4YUDA 3GCXP 5E3AA 4ZMMA 1BQNA 3PRBA 4J9NA 3ISZA 4ED4A 2L9NA 4Q45A 3JSMB 4ELVA 2W5SA 4DX7A 1S59A 1YJNS 1QE1A 4USMA 4YP3A 3M9NB 3TEGA 2B7CB 1Q82T 1ZM9A 1N33F 1RI7A 1VQSA 1T9UA 1YKWA 2B51A 2QYCA 3A1YG 3NBPB 5FIIA 3FMBA 2I8EA 2ZD1B 1E6YB 2RDDA 3MMJA 1OWXA 3O8WA 1TELA 2EG2A 2IJRA 4WIIA 2FJAB 3V4IB 4LRAA 2W5XA 1JLAA 3IR7B 4ID5A 4LFCJ 1FD8A 3W5XA 2D3OR 3ZFVA 2AT1B 3PW0A 3DRSA 1BC6A 3QSIA 1FWKA 1DTQA 2QMXA 3SBMA 4OFZA 3D5MA 1SPBP 2OEMA 2A6MA 4O3SA 4ICLA 5A8RA 2J8SA 2BKOA 1MWZA 4KFBB 4N56A 1RADB 3OL6A 1BWVA 3GJSB 1T3OA 5IZHA 2X3DA 4ZCLA 2ZBQA 3RBDA 3BDPA 1ELYA 1L5UA 2F8MA 4OZ5A 5EUHA 2JEFA 1Q95G 1KOOA 2E1PA 3NG8A 4TQSA 3SV3A 4G3IA 5ETTA 5E3PA 5J2PA 3X3UA 2OELA 1KKHA 2CQGA 5BYQA 1K1QA 1N8RT 2QEXS 1FE0A 1V6HA 4M94A 3PW7A 4LREA 4DZ6A 3NMAA 1AJDA 3KWMA 4DR4J 2XQCA 4X2BA 4UOFA 2H54B 3PYGA 2GJFA 4DSEA 2C3MA 3MTJA 3QT7A 3WAXA 1JLBB 3GILA 3WX4A 5DLFA 5D0GA 3D3BJ 3SQGA 2MHNA 2CJBA 5HQ8A 2AKWB 2JHEA 3M6VA 4FXWA 1UPMB 1ITPA 1X4CA 2YWGA 5IS2A 2ROPA 3MM5B 2K8GA 1WEZA 1U1PA 3O44A 4OYIA 1VQ7S 3ZO7A 2GQCA 3D0GE 3QFWA 4OYOA 3ZZPA 2ZH3A 1NNDA 1TV6B 3ZNUA 2BKNA 2MMYA 2VBYA 3I0RA 4FKXA 4HACB 4OX7A 2XMWA 4BWJA 3NKQA 1S12A 5H9EK 2DCUB 5K14A 3BQ1A 3RBEA 1Q8IA 1E33P 3Q3QA 3H2UB 4DL2A 2VODA 4DSFA 2GLQA 4JI3J 3PFEA 3ZZTA 4BLGA 4NCGA 3VAGA 3ILOA 3OR1A 2HWTA 2XGPA 4LFAF 4IRCA 4IOAQ 2KKHA 2KL8A 1AT1B 2W25A 5D0EA 1AJCA 2PEHA 1QSYA 2ZH2A 1U2RA 2XSJB 4JI4J 3E2DA 2VG5B 3ET6B 3SXLA 1NKEA 2MLYA 3L7PA 3M32A 3RUBL 1LWXA 3O6QA 4CT8A 4NZ0A 2AJ0A 4IH6A 3EVOA 4CO2A 3HX9A 3RAXA 2IPOB 2OIHA 2E9ZA 1RKIA 4K59A 4LFBF 2JLFA 3AXKA 3V6JA 1TVRB 2B43A 5E3QA 4ETZA 3OJSA 2JFDA 5A6WA 1DZ5A 2WZ1A 5KG2A 1NLKL 1UW4A 2XC9A 3TAMA 2X98A 4J5OA 4KC5A 2VC0A 4Q44A 2DGQA 2DITA 3AOCA 3P96A 3QGGA 4P52A 5F8IA 2BMBA 3C19A 5H1SV 2XGQA 4ECRA 2G1HA 4TVAB 1YHQS 1N32J 2J76E 1CQMA 1EHWA 1Y4ZB 4IDKB 4C48A 1RT2B 2W7AA 3VTIA 4DPXA 2R2SA 4PG4A 1SJRA 4MFBA 1AJBA 2CPEA 4LF6F 1BGXT 1CJTB 5E7OB 3P6YC 5E2QA 3NL0A 5HRTA 4KAIA 4O3OA 2DY1A 1ALKA 1EI6A 2WVBA 2R7XA 2UXDJ 3BDGB 3CO0P 2OUGA 5KFLA 2OLWA 1SXLA 3CNQP 1TUWA 4PG7A 4EWTA 4OHVA 1WF0A 3DRPB 1QD1A 5L9XA 3W2VB 4UY85 2KFZA 4ZPTR 3HMJG 2CNOB 3QIDA 3IWNC 4PQAA 2YNFA 2GMHA 1VC6A 1N4LA 4LRCA 3OTOF 1U1QA 4C3LA 3IG1B 3Q8VA 1HR0F 3N5FA 4HL9A 1VQNS 5L39A 4K4TA 3QRQA 5EN1A 2I5JB 5JXSA 1Q53A 3DRSB 5GOVA 1ZAVA 4I64A 4Q0BB 3RJMB 3CJRA 4KJGA 3VAKA 1IR0A 2W7PA 5KG7A 3F44A 4ID5B 2FLPA 3FEYB 1RHUB 3M05A 4IG3A 4FS1A 2A10A 3BDFA 5K14B 5L1LA 4DV0F 1ANJA 5G4DA 2C2KB 3KK2A 2WBRA 4CLUA 4DV6J 4ECVA 2O66A 3F0NA 3EMTA 2YH1A 3DLBA 2ZE2B 2YBVA 2MJNA 1VIOA 3LWMA 2GHWA 4OV1A 1XERA 4C7QA 1X4FA 1BLUA 3LA0A 1NK4A 1WEXA 3BR9A 3FQKA 1U47A 2KDOA 1EARA 4L75A 4EBDA 1N34F 2WK4A 5IV3A 2HZVA 2ZH7A 4ECXA 1RGVA 2YKAA 4B56A 1N48A 4DR3J 2RQ4A 1GTEA 3L09A 1QUPA 2HNDB 5F8LA 1S6UA 4CLWA 1TFWA 4GKKJ 1AUKA 5C7PA 4OI0A 3R7NB 1FHTA 1JWWA 2QLWA 2VC1A 2VDIA 3B54A 4OZNA 2ZH9A 2CQ4A 1YLXA 3UD5A 4I7FA 2V68A 3KLHB 1L3VA 1TL5A 1JXEA 2XLJA 2CJQA 4HT5A 4Y6IA 3LW5C 3MF5A 1RTHB 2RILA 4ED3A 3ED4A 4IR9A 1EP4A 2BKPA 4DQPA 2OPRA 3DKDA 1XMQF 3N9UC 4U6PA 1WDTA 2NXJA 2M0GB 2GQQA 2VASA 3EXCX 3M1VB 3UN3A 1HBMB 2V2KA 4DDFA 2XY6A 3PO4A 3IR6B 3MR6A 2AZ3A 2LQ5A 4CQ1A 1XBWA 2B0GA 4WFYA 2UV8G 3BN7A 3B4DA 3C66A 5D15A 1XMOF 3IAS9 1FFWB 1FKAF 3HPOA 3ETOA 1VBXA 4OI2A 4UOHA 1Y00A 2X1AA 3V81B 8AT1B 2RKIA 4A8MP 2GMLA 2DNPA 5HVGA 4OYXA 1Y0HA 3IGYB 3ELHA 1EW2A 2X1BA 3CD5A 1TVRA 3FSXA 3BH7B 3OT9A 3QLHA 4PKDB 5DLGA 3CCMS 4LF4J 3TAQA 3SCLE 2QSWA 1XNRJ 1P9YA 3RU0A 4UPHA 1Q7LB 3NGDA 3FFIA 2BJ1A 4FF1A 3G8TA 2QTWA 5M2RA 2IIHA 3R5BA 1SIZA 2BJ9A 5BJRA 5IM0B 3EZ5A 3QT8A 3PXGa 3HSGA 2DCLA 4D3HA 4U67Q 4TNOA 2ZM6F 1HBOA 3OHAA 1HPZA 2FZKB 4NOHA 5LMUJ 2GS8A 2QE5A 3M6XA 2AJFE 4F36A 4ZA1A 2DR5A 3BDGA 3H42A 1P1TA 3MEGB 2IAJB 3J81Y 1PIEA 4LF9F 3GP9A 4HHHA 2MB0B 3W2WA 2ROGA 3CJ4A 4KBIA 5F9LA 5IWAJ 2CJYB 5I42A 5F8NA 4FF2A 2ZBRA 2BYCA 1U0HB 2PA3A 2AEFA 3D6MB 2XHWA 3DDNA 3EJMA 1WHXA 2JC0A 3HDSA 4LUBA 1HLWA 4DR2J 2R8KA 4ELUA 5DQGA 3J81j 2IJFA 1RTIA 3R6GB 2D3O1 4X84A 3IRWP 2R4FA 5GAHU 1T95A 2HNDA 2GGPA 4KH1B 3CCSS 1REVA 4UOPA 2GZOA 5KG1A 2DGWA 2GIRA 3WDOA 1UMJA 2W9CB 4X4VA 2IRUA 2WSCC 9RUBA 1YK9A 1HBUA 3THPA 1AUSL 2QL5B 4F0KA 2BR0A 2LKZA 1UA0A 2HQFA 3T5JA 1X5PA 2BJ8A 3M4XA 1URAA 4I56A 1J5EJ 4RW7B 4PG5A 4ES3A 4QBUA 4DI6A 3GIRA 3KLEA 4DBQA 1VK3A 3CCVS 2FHMA 5H9FK 1U02A 3QAEA 1NHKL 4NASA 3UDCA 4AQYJ 4QIEA 4GTYA 1L3KA 3LPYA 1H2UX 4JV1A 4U8VA 2NXNA 2H4WB 4F0HA 2GAHC 1IQTA 4IH7A 5HLFB 3FBCA 3QBCA 3DOMB 4KKOB 4IKAA 2K3IA 3GR1A 4EBCA 3TG0A 3AY0A 3NWGA 1FJEB 1S1XA 2FHJA 1FRKA 1WG4A 2VG7A 3H2LA 3T00A 6AT1B 4ZLJA 3BPDA 3T41A 5AE1A 1RBOB 2N82B 3BEGB 1D3WA 5F0UA 4UZBA 7FDRA 4QWEA 1YTYA 5IM0A 1UJ6A 1VS3A 2KT3A 1KQGB 3Q2SC 1TKXB 4P2MA 3ZNJ1 4YB6A 3ZZOA 1I1GA 1NCLA 2NXEA 3A12A 4DV6F 1CJKA 2DNYA 4Q2MA 3RAQA 5L0EA 1OMSA 1RT3B 1T94A 1WC3A 4YR1A 2ZUGA 3AQPA 4LR9A 4QPXA 2G0IA 3OFFA 1OY9A 1J27A 3OV7A 3HHLA 2YY3A 4ITSA 4ZVFA 2R8JA 2CQ0A 2JZ5A 1GNKA 2HHPA 2JWNA 4XDCA 5JJBA 3ZTRA 2DO0A 3G6VA 4DSJA 5GMKa 3UNGC 4BBYA 2JH3A 3GG1A 2CJ9A 1HHSA 1OQ6A 4FNIA 2KHDA 4OIXA 4C8OA 4P72A 1W25A 2Q6CA 3RG6A 2DGSA 3OTCA 1YBUA 4ZCIA 4AUKA 5KOWA 1QM9A 3DGPB 4HH1A 2MZ1A 4HT7A 3PJWA 1VC5A 4QCLA 4LSNA 2VQRA 4RBVA 3PJXA 5J2QA 4NZ7A 3D1HA 3CT9A 1G2EA 4ZPWR 2NPIA 2BOPA 4ILMA 1HFEL 4QU7A 1IM6A 4NPOA 4Q43A 1SV5B 1D1UA 4RW9A 1UPPA 4ZHRA 3W9IA 3QWPA 2H3EB 4KGMA 2R8HA 1PJ7A 2I0XA 5IT4A 2AMCB 3CJ2A 5A8RB 1ZEFA 1IN0A 2DISA 4DXLA 2W2PP 2GJ2A 2GHPA 4GRSA 2YWKA 3JSRA 4OI3A 2G4BA 3LF0A 1V3RA 2HHUA 1N32F 1S1TB 4QJVA 1Q5VA 3UWTA 1Q78A 1YGYA 5KFFA 3CJ8A 4LBIA 5D4OA 3T02A 2E1MC 4I2QB 5B0DA 4I2PB 1J5OB 2LLZA 2W2OP 4RUHA 1NB7A 1JLQB 2VDHA 2D7SA 4RU2A 2IY5B 1DRZA 3E8OA 2RS2A 1PYSB 2XY5A 4OHZA 2HQDA 4PPZA 3QT6A 4HR2A 4ED7A 2W5WA 2V69A 4FPIA 2AJQA 1JLBA 4ZN1A 3LH2S 2LQ9A 4B3MF 4M5DB 4Y2MA 1HW8A 1BE4A 2EK6A 2GVDA 5FD1A 3J7AN 3IBWA 1WHVA 4KPCA 2DR8A 4IQXA 4NCAA 3ZZUA 2AWZA 2F9DA 5FLXU 1RYSA 1HNZF 4RUCA 3KLFB 1YJTA 4CO5A 4I6WA 4OX8A 4RPFA 3P3DA 5BXIA 3MUMP 3JB9k 2C2EA 2XNRA 2BE7D 3FZBA 4OJ3A 2FJDB 2C42A 1EQMA 3EE3A 1ROFA 4HHUA 1RBLA 1S1XB 1U09A 5KFUA 1FFSB 1RWWB 4F3OA 2W9BB 4A8KA 5LQQA 2GX8A 1U4BA 4ANCA 2CPJA 2C3OA 2EBEA 4RKUC 5KFSA 4IR1A 1ZTTA 1R43A 3GLJA 1F1BB 3TVKA 2X51A 3ENQA 4OLOA 4YB1P 4U96A 4TKTA 3DI6A 3PM9A 2WCXA 3W66A 5C42A 1XEZA 4KHRA 1V9OA 2LEBA 5FJ4A 1RAOA 5CYJA 4A8XA 3UCUP 3ZTOA 1C4AA 4QU6A 2VZ9A 5EX0A 3OR1B 2MKJA 2XR9A 3PFOA 4ZP9A 4WZMA 4CH0S 4LF6J 1Y5NB 2DHSA 2IVMA 5KG0A 4IYQA 2ZH8A 4ECQA 3T3FA 5RUBA 3MD3A 1PJ6A 5CD4H 1VYAA 2M2BA 2YKQA 3PRDA 5L38A 4RU9A 2H65B 1HQAA 3MMCA 1DURA 1CSJA 1WG1A 4WXWA 3CE8A 3IM8A 5KT6A 3I32A 3H25A 1H72C 3PV8A 3SI8A 4F7VA 3FQLA 2E1CA 4Q8EA 3H4DA 4JI7J 3P49B 4O3RA 4R8UB 2MKKA 1S7HA 2A3JA 5D6GA 1HWUA 3UW1A 5CH7B 2E5HA 2J8AA 1KP6A 1VQ9S 3GE9A 2ASDA 5F0WA 3C6TA 2KO1A 3JSBA 1XN9A 1U6BA 3OUYA 2HBQB 1LK5A 5BYSA 2YKPA 5LMNF 1UFKA 4LF7F 1S1TA 3I31A 2ERRA 4K50A 5KG3A 4NCBA 4KSEB 3VVUA 3ZC4A 3AXMA 3W5YA 1IXKA 1FRLA 1QAXA 3BS9A 5B0CA 5IT0A 2MQQA 1S1WA 3T19A 1R27B 1DQ8A 2GJIA 1Q0NA 2HWHA 3KUEA 3VZIA 4AT1B 1MU2B 3GFZA 3MR2A 2RSQA 3W2VA 3KK3A 3EPGA 1HQUA 2RUSA 2M5YA 4NMLA 3I0SB 5KFIA 3CSKA 1M5PC 1JIHA 3KYLA 1VQKS 1O8BA 2DKOB 2GA7A 2ZDPA 4C98A 2DNKA 2J5AA 4EI2A 1Y11A 2QO3A 5A8KA 2J6SA 3QATA 3FMWA 1KN6A 1ELXA 1VDHA 3CMQA 2IRXA 4HDGA 2QA2A 5E3CA 2DXDA 4WP9A 4O3NA 2FHJD 2XMMA 3TQEA 4DV1F 3TANA 1IKWB 2DNZA 4ZVQB 1X9SA 1S0VA 2QGFB 3MAAB 4QIFA 4PYAA 1TZ0A 4FF4A 3RW7A 2KG1A 3PW2A 1XMOJ 4HI1A 3G4SS 2ZH6A 4K0KJ 3MOZA 4TY8B 2OO4A 5DQIA 2BJ7A 2MKCA 3CC2S 1ZPWX 3FJ2A 1X7VA 2HK3A 2KZMA 3MM9B 4A48A 3KMQA 4I2PA 3R5CA 4ZVGA 4DV4F 1J5OA 2D3UA 5CABA 3VHQA 1YZ7A 4LIWA 5BYRA 4DPUA 5DG9A 1U24A 3W60A 3MFIA 4ZCKA 2A2CA 2BJ3A 2KVIA 2ZH1A 3K59A 4UUXA 3CTRA 3Q0AA 4FYVB 1F5AA 1FX2A 4EO6A 2V9WA 1WI6A 2YKOA 1RHKB 4URSA 3B4MA 3EZUA 1HNIA 2WBMA 1NDLA 2ZBCA 4Y2KA 3MM7A 3ENVA 4JI8J 3GJTB 3KLGA 2ZM6J 1B7YB 4LQ3A 1RYRA 5LRNA 3U1LA 1H7WA 4W98A 1W7WA 3NP5A 1DQ9A 5KFMA 3IFEA 2BJDA 3HHNB 4OZ0A 1S48A 2AX0A 1FT8A 5DG7A 2B4PA 4FN5A 4H4MA 2M8DB 5A2QY 5J2MA 1OY8A 3AJDA 4LF9J 5LT5A 3CPWR 3MHYA 4DR5J 4USTA 2LQ8A 4LF5F 1FKPB 2FJBB 3IXQA 3MEEB 1NHUA 3FCHA 5I3UB 3K5OA 1K0VA 4E8UA 2PMHA 4UQGA 1SUQB 3V81A 1Y3JA 2M70A 3KXDA 5IC4B 4J9UE 2V8DA 4WYWA 3NGUA 1YX2A 1ZAXA 4NLSA 3V2UC 5IJQA 1ELOA 3I55S 1A6LA 2KI2A 2Y9HA 4ED2A 4C8ZA 4QOTA 4YS2A 2R8IA 1U0HA 1HWKA 3GMGA 1U1RA 2OFHX 2VF3A 2Y1RI 2YTCA 3C6UB 3TZZA 3C16A 3RBXA 1A0OB 1U1OA 1NK9A 2OP5A 2PFFB 1RSCA 2C2ZB 3NKYA 5DDOC 1MU2A 5ETRA 2LA4A 2V67A 4LF8J 4KAVA 2BUNA 1KHVA 3DYAB 4M1KA 5CYQB 4CH1A 2IM0A 1RTDB 3MCOA 2UUCJ 2W5QA 1DLOB 2VFSA 1Y5LB 1KQFB 5LIAA 2B6AB 2XRGA 1QDUB 1IM4A 4G1PA 1V3ZA 3HVAA 4G65A 1WJ9A 1JLGA 2ZHOA 2A0FB 5C25A 3IP0A 4WK3A 1QY7A 1HBOB 3N6MA 3OUYB 1YJUA 1SC1B 4IFYA 2DGXA 5IWAF 5IT9U 1NJXA 4XAKA 2GNKA 1BUXA 2V2QA 4IOCQ 4GKKF 1OYDA 3B6BA 2OTLS 5KFPA 2ILZA 4U7UD 1VBYA 2MLZA 3LGNA 4I1TA 2I9SA 2QIFA 3CJSA 5IOLA 3I9ZA 3KG0A 4U7UK 1U1KA 2OH2A 4GTXA 1DQAA 4QYZK 1JLFB 3D67A 1SCJB 1XR5A 2XNQA 3DFEA 3MM9A 3THVA 4WXOA 4V19X 1JQGA 1S0OA 4YY3F 1VGYA 2PI4A 4CYRA 4CXSA 3G6YA 4C9DA 2P6SA 5CQGA 5F8MA 5KFBA 3GV8B 2UU9J 1BXNA 1C1CA 4U9RA 2BW2A 4ZVHA 1LNQA 3W3SA 2G2OA 3A8JA 1Q16B 5HP1A 4N41A 4NYZA 1K8AT 3I0SA 2GO9A 3I4HX 4CCHA 1D9AA 8RUCA 4DL6A 1HBNA 2OHDA 1LFWA 1S4FA 2HURA 3HVTA 4PZVA 4CO0A 4LFCF 1EJJA 4X4OA 1P9QC 4NI2A 3LO3A 3TJAA 1FNMA 2FTRA 3IS9A 4ED5A 2JNJA 4RWWA 2VG5A 3T1YF 2OEKA 4OHYA 4FF3A 1YITS 3R6LB 1YG0A 2CPZA 2HEKA 3FCVA 3HD1A 2XSFA 4DUYF 1S97A 3VGTA 3EYZA 2OTJS 2HFSA 5HLFA 1GXTA 4DR1J 3TQ1A 2AEMA 1QVFR 2Q3PA 4AQYF 1SB6A 3D1QA 3WC2A 1I5OB 2LXUA 1ZM3A 2BM1A 3IBCB 3TZWA 4QWBA 4JI5F 4FKYA 2O5DA 3FZ2A 2W24A 3NGRA 4QW8A 2IDLA 1Q8BA 4NE9C 3MK2A 2KYXA 3ZTQA 1F5BA 1ZBTA 1RWUA 1YIJS 1WOPA 2CQPA 4IDKA 5D77A 4CP5A 5KTQA 3T6JA 3QJLA 2NZCA 1X9MA 2IM1A 3MR7A 2E5GA 3E2EA 2HKEA 2AJ4A 3DPCA 4ZIVA 3UR3C 2CZ4A 4M5MA 1SQFA 2K1RA 2UV8A 1O98A 1PJ5A 1WKLA 1P6TA 2E1RA 3KUHA 5J1NA 5KFVA 2LU2A 3HD2A 3MPUB 4DCJB 3OL7A 1ZTWA 1N36F 4EZ6A 2ZEJA 4QWCA 4ZG9A 3A3OB 3T1YJ 2HS4A 1X9WA 3THTA 2Z2ZA 1RWVB 4DR3F 2Y1LB 3UDEA 3C2PA 3TVZA 3HHLB 2UXBF 1L3SA 3OD2A 5IC6B 5K5MA 1NKCA 4I2QA 2ZC4A 4H4MB 2XG8A 4J9VA 2H51B 5KFHA 1JLQA 2WB1D 3J80Y 5C25B 1BQMA 3G6XA 2GIQA 5HQLA 2ASLA 2KT2A 4RBTA 3CJKB 1RAEB 1RB0A 2BRKA 3VVTA 2VKZG 5I3PA 1HNXF 1IBMJ 4DV2F 3HXMA 2MHEA 2XEXA 3PEJA 4ZVSB 1B99A 4LFAJ 4JV5J 1R6VA 3ADAC 3PY8A 3PR4A 3TUZC 2AGQA 1VI7A 2FDNA 3QPIA 2WTFA 4B17A 4I7FB 4FYYB 4CO1A 3BKFA 4J91A 1CJUA 4J37A 2VA3A 2B4VA 1QSSA 4ATNA 4WYLA 3C6UA 3Q89A 1IBKF 3MWBA 4TU9A 4USKA 3TVYA 1APSA 1BQXA 1R8PA 2K7KA 3BGLA 6FDRA 3EVMA 3CD7A 4BC9A 2V9KA 3HHKA 3M9MB 3TAPA 4FXVA 2GSNA 4KM4A 1G3OA 2CA9A 1NDCA 3IRXA 3NS7B 5KFAA 2RD5C 5KFOA 2KZZA 1T02A 2F8EX 3IM9A 4O4RA 3KD8A 5ETLA 3OL8A 2BOAA 3K5NA 4BDPA 3EICA 3SYZA 2B5JA 4NLPA 2ZZMA 4CM2A 3KLIA 3QGHA 3K17A 1KH4A 4KAYA 3U1MA 2CQ3A 4ED6A 4EBEA 1FRIA 4F3MA 2D41A 5CD4A 1G4CA 2M88A 4WE1B 2PIIA 3CCLS 1OO0B 2AHOB 3GCWP 4CTAA 1E1ZP 1X0PA 3OVAA 2HZCA 3H5UA 4UZCA 1RHQB 3OVBA 4QYZJ 4KHPJ 3TJ8A 4IRKA 1HYSA 4CXUA 2G9OA 4Y0FA 2GV1A 1X31C 4M5NA 2I2YA 2XB2D 4CO3A 3SQOP 1JJ2R 3OPKA 3TOQA 2MY7A 2PA8D 1OYEA 1FK9A 1FEHA 3PKYA 1L3TA 4X64J 4HYKA 3S01A 2B8QA 1HI1A 1FESA 4USIA 1KVIA 4DSKA 2B3TB 1MLAA 2MQPA 1KHLA 1WC5A 3A8IA 3AB4B 3DLEA 1X60A 2JFKA 4DEZA 2RRNA 1KWMA 2OAUA 1W26A 2JJ4D 2DH9A 5KFXA 3MCNA 1IBCB 4KT0C 4NI2B 3HI9A 1FRXA 2A2DA 2J7UA 5D4PA 3IS9B 1RTJA 3DLKB 4CM0A 2ADCA 4I6YA 3FVYA 2ZD1A 3UN2A 5A6PA 2J7KA 2M52A 1FDDA 5KT5A 3GFYA 4H4KA 3HT3A 1NK5A 4NXNF 5ETPA 4DSIA 4KB7A 3EDQB 4URGA 2GMJA 2LQBA 4QIWD 5ETNA 4NYPA 1LOUA 1NEEA 3K58A 1C2PA 1GXUA 2E66A 1CJVB 2APOA 4B3SJ 2LEPA 4BWMA 2HNZA 3D4JA 1UA1A 5C2GA 4TU7A 1QTMA 2PO4A 4P2FA 3EZOA 3PW5A 4USHA 3T1HF 2P6TA 4CLZA 4F4WA 4F50A 2EPIA 3SIPB 4TN0A 1WHWA 2MYFA 3NEKA 3IMQJ 1GQEA 1U7LA 3M8YA 1XR7A 5F8HA 3D2WA 4GTZA 2IAJA 1GMUA 1P8GA 2NUUG 1KBRA 3RAMA 1UJ4A 4P73A 2HVIA 5DM6Q 9ATCB 3F41A 3M2RA 4EK2A 1S1UB 2CNNB 1NAQA 2R3VA 2M8HA 3QZ8A 4FXDA 3NVLA 3GSIA 3KK3B 2DH7A 1Y5IB 1RAGB 4RW4A 2OPSA 3B78A 2XMAA 1C0TB 3SZ2A 1ED9A 4ZCMA 2CQDA 5ETMA 5L8RC 4EEYA 4ZGAA 1IKYA 2WOMA 4I0WA 1IKVA 4E0DA 1R8BA 3FCWA 3JAMY 1RBAA 2WW8A 3KLIB 2HRYA 3A8EA 1RLCL 3AJ1A 3UE2A 5L9NA 2YQ3A 1FA0A 4LRFA 1UVNA 5B08A 3BYPA 4OHWA 1ICEB 4WE1A 1TL1A 4CLSA 2RIJA 5MLCV 5BR8F 1ALIA 2CPHA 2W9CA 3KG4A 3FBFA 2DHXA 2MQLA 3FSYA 2HBZB 5L1KA 3VR1A 3UR0A 1TUGB 1EQJA 2DRBA 1YJ7A 2IHR1 5KFJA 2CJKA 1JKHB 1SQGA 4F67A 1Q79A 2PMWA 1GMWA 4ZVEA 4BHQA 2DHGA 1CBKA 3FEXB 4OI4A 4DL3A 1S0MA 2PMZD 2KXFA 1R0CB 4XPCA 4BS2A 2KJVA 5AJ9A 4ZVUB 4DL5A 2Y8WA 1DJ0A 1F0XA 1LWCA 4DCOB 3K5LA 3MK0A 4UPLA 1CQNA 4LMZA 3KK1A 3TX8A 3T1HJ 5T14A 1LWFA 1XMBA 5IQQA 3DGPA 2WHOA 1PBUA 3W7BA 1HNIB 4B3RF 2VFUA 2I5JA 5DG8A 4KGVB 1U1MA 2FQQB 1JX4A 3LGMA 5CYMA 5B0BA 1REGX 1IJFB 2AGPA 4HHJA 1RLDA 3HF5A 2YNHB 1M1GA 4AXJA 5TJ3A 2DHAA 4DR7F 2MSSA 1TU0B 5AJ3F 2RF2A 2XZDB 2ZBPA 3SQGB 3C16B 3QIPA 4DR2F 2N4DA 3FRZA 3MECA 2LA6A 4YOEA 2CRLA 1CJTA 3AFGA 2DYAA 3R5AA 4ZJOA 3FEZA 2G1DA 3DN9A 3HLUA 4G1QA 4L3KA 5SZTA 4J9LA 3MEEA 3GYXB 4GTWA 1XK8A 3CW2C 4P7VA 5ETSA 3DC2A 1SUQA 2QJ3A 3SSRA 4DN0A 2E44A 5J2MB 4RNOA 4LRBA 4YR2A 4PUOB 1GT8A 4O23A 5CCMA 2BQ3A 4NA3A 4QYRA 4MY4A 1WC1A 1SBRA 4M5KA 3M30B 2ZVIA 4MTPA 3ISND 1FI4A 2W4PA 2XLIA 4KGKA 2ZH5A 2V8VA 1NDPA 2VQFJ 5AXMA 2E7XA 3JYTA 1SVDA 4DR6J 3VGVA 1CS4A 1HHQA 4ECYA 1AJAA 5U47A 3OFGA 1S6QB 2B4OA 5HJYA 1B4SA 2W2QP 4TQRA 2CQ2A 4RW4B 3GPAA 5E3RA 5KXAA 1M5HA 2EKYA 3HP6A 5FDLA 2DNRA 1NXIA 4ZHRB 3Q24A 1M5VC 4F0MA 4EMDA 3BV8A 3BZQA 2DGOA 2YNIB 3K7RA 3QMQA 3LTOA 4OZJA 4C6AA 4DN9A 4WFNQ 2RU3A 1FJCA 3HSDA 4MMOA 4ELTA 2J9EA 3AD7C 4TXSA 3DYAA 1PKUA 4PXCA 1MROB 5B0AA 5KT2A 3G96A 3VAIA 2IRYA 3W9HA 2AYBA 4NLTA 1VJWA 3TA0A 3KJQB 1ZEBA 2F8HA 1HBNB 3GWCA 3KJVA 3IBFB 3PR5B 1S9EB 3WZ0A 4CLYA 1N6QB 2R7OA 1R8HA 3SEOA 3O3LA 3HHLD 2CZVC 2GO8A 3HHDA 2ANHA 3ONQA 1EW8A 4QIGA 4K2JA 1D9DA 2UVVA 4DV5F 1ZOTA 4WBFA 4DV3F 1XIQA 2YQ1A 3UFCX 3VALA 4DHVA 5L0BA 3GSDA 5AXLA 2AP6A 5HVFA 3VGUA 5GAGU 3BSCA 1AFJA 1EETA 3UCGA 5DETA 1NM2A 1C0TA 2FVSA 1U6FA 2ZFHA 3AD8C 4DUTA 2E9TA 2OFGX 3BO4A 3ZZ0A 1IKYB 2WOMB 3K8VA 1JLCA 2AF6A 1R0BG 1DBDA 3P5BP 5M2UA 4MK9A 2GQ2A 1KLNA 1JXVA 3G8QA 2I1RA 2N3LA 5CYMB 3VZHA 4NLGA 1HBMA 4C0BA 2B56A 2MXYA 1GMVA 3T1AA 2UXBJ 1HWJA 3SDEA 3BO3A 5DLTA 3WAVA 2MQNA 1EP4B 2YX1A 1GEHA 4P71A 4A8YA 5GADI 3C46A 2HHSA 1PILA 3Q8UA 4QPTA 1MMDA 2QZ8A 4L3NA 2E5LF 4WK1A 2U2FA 3HKZD 2UVRA 2IVYA 2HAFA 1ULRA 3EGVA 4JP8A 4JI6F 1RT1A 3S1TA 4B3OB 3I5CA 1RTZA 4DL0C 4EUVA 1E6VA 2BEFA 2WVEA 1YSJA 3NBPA 2BW7A 3TRGA 5HN0A 4NA1A 2HFNA 3CCJS 3HK2A 1OPZA 2AEJA 2WB4A 3HZGA 3PDNA 1VHIA 4Y00A 3O1LA 4DUZJ 3PHEA 1WC0A 2GGPB 2OPPB 2EFGA 3H5SA 1HD0A 2PGCA 3MMCB 3MFHA 1JJ4A 4JV2A 1E2SP 1C0UB 1DY3A 4UPKA 1NUEA 2XMJA 4M5JA 3P8BB 3OTOJ 1B0VA 1TFYA 3VCDA 3MECB 5A76A 5DDQC 1NJYA 3V6DB 4A46A 4X4TA 2XYHB 3EGWB 3ENAA 2Y1JA 2H4YB 1R6YA 2X7IA 4MKVA 1GK8A 4OYZA 4RBUA 2RF2B 1NO8A 3DGVA 2FB0A 2ZH4A 2VFRA 4OMFG 1WKKA 4C8KA 4W92B 3G8SA 5H9FJ 2RH3A 2YXLA 1KD1T 4B02A 1NU4A 3QQCD 2V5HG 2Z30B 1K7HA 4JB8B 4CT9A 2W4DA 3R7BB 1FEEA 2K2PA 1L3UA 2V8PA 1SC6A 2CQCA 4OZ2A 5J2PB 4N77A 2W8DA 1S77D 1RT4A 2FY8A 3SFGA 3K89A 3RB6A 2JL9A 3M2VB 4ZDNA 3PCOB 3AOAA 1GMWD 1ACMB 3LGHA 4B9UA 5KFCA 3MD1A 3W65A 2BANA 3FC9A 4OX9F 5GAGI 4IO9Q 1PBAA 1RCOB 2C2MB 4ED8A 1VQ8S 2J6TA 3GIIA 1DHMA 3KFWX 1RWOB 5EHHA 1N0UA 1JLAB 3GIMA 3PZPA 3WBZA 2DNOA 3J7Z5 4DFJA 3NNAA 3C14B 4NEYA 4DR6F 2R42A 3BF4A 3TP2A 3GJRB 1AFIA 1HD1A 3US5A 1PYOB 4Y3CA 1NH7A 3DCAA 2Q66A 2JVRA 4WTYA 1TKTB 4JI2J 3NGSA 4KH0B 1ZA2B 4B3TF 4X4PA 2CZ9A 3DDKA 2NREA 3ZTPA 5F3ZA 3A3NB 2CG8A 2Z8QA 4PG8A 1VJQA 3KG1A 5HI7A 2YVSA 5DS7A 3KHLA 1HYSB 3R2DJ 1KS2A 2HK2A 1U26A 4G6VB 3PIOQ 1MMLA 4ERDA 4DU8A 2OMLA 3PEHA 1LV5A 4NXMF 4IUFA 4ZIWA 2IFXA 1RT1B 2OI2A 3KHHA 1K9MT 3ITHA 2BQUA 4B3OA 2DH8A 3OR2A 3T6BA 2RHSB 4O3QA 3H4BA 3DM2B 4ECUA 2VG7B 2IA6A 1K0TA 4TU8A 2UUBF 3MMBB 2GFFA 3MM7B 2Y8YA 2AYMA 2DGTA 3EUNA 4I4BA 1NHVA 3KLGB 4NMXA 1SHNA 3G2XA 2HLTA 3MM8B 2BE9B 3C3LA 2W7OA 3GONA 2J0QD 3CWJA 4KJDA 1F9FA 3CDWA 2F4VF 1RK8A 2GVZA 4H4OB 5HBMA 4MYTA 4PWUA 5D4LA 1IUJA 1EQ0A 4ZS6A 3D0IE 2WVDA 2PD1A 2FC8A 4DU7A 1GFWB 1SH2A 3SCKE 4EYIB 4TLRA 1TMMA 1FVSA 2F63A 4HKQA 4B9SA 3UPFA 1MG7A 2CPDA 1RJJA 2VQEJ 2CJAA 1WWHA 3DU6A 3RR7A 3CULA 2LDYA 2C3UA 1NPKA 1TTHB 2YQ0A 5D0HA 2N3OA 1UWBA 4J9PA 3NGKA 3W5ZA 3G9CA 2CPFA 3DHWC 1AROP 1FDNA 1JLEA 4FBTA 5C24A 5L1JA 1FTCA 2F40A 5GADU 2GSUA 4M5DA 4IQMA 4I67A 3VGSA 1CJVA 1VBKA 3EXYA 3G82A 3LP0A 2MSTA 2DR6A 2IYIA 3P5TL 3PX6A 4DSLA 1RWXB 2MZJA 4DS4A 1JLFA 3DMJB 2F3JA 3UDVA 1Q86T 5HATA 2FGCA 4C8LA 1OQ3A 2BM0A 2IBOA 2G9YA 4IRDA 3C14A 2L3MA 3D28A 4O44B 3GB0A 3LALA 2C2DA 4UQTA 4B9VA 1ZYQA 2V6AA 4LF1A 2PE8A 3I6PA 4ALZA 4DV7F 1YWXA 3D68A 4Y65A 4P2XA 4JI4F 4O3PA 4R25A 3PX0A 1TK8A 3R97A 3DU5A 4HVZA 3KLVA 4F4XA 2L48A 1U8WA 2N7CA 4TY9A 2FPHX 4FS2A 1GX6A 2WSFC 3C15A 4AD6A 1ZA1B 2UUCF 4DR4F 2VONA 4L74A 1TKZA 1HDHA 1YBTA 3B5QA 2E7VA 1RWKB 2OGUA 3OVSA 1QUVA 4B9LA 4EU0A 3KJFB 3LP2A 1TUVA 3DM2A 4LSZB 3CXCR 4U95A 1FDAA 1RABB 2M4MA 4B3RJ 1QAJA 3UO0A 3MXHP 5KFNA 1HQEA 2JX2A 2IVFB 4DFKA 5AE3A 3BN4A 4LBPA 3SV4A 2C28A 2KFYA 3DRRB 4DPWA 5L46A 2HRTA 4RUBA 4OL8A 1T9YA 3R1HA 1UVJA 2ZBIA 1YZ6A 1R0AB 3M8PB 4NLQA 2HIQA 1TL1B 3E51A 1TR0A 2AJ1A 1RCXB 2MQMA 3HFVA 4O0NA 4QIVA 3CMES 2KHCA 5HMYA 4AL5A 3MEKA 3RR8A 2B9EA 1M5KC 4F02A 1QAIA 4WFAQ 4PQUA 3CMRA 3IGZB 4GO5X 5EGHA 1WTBA 3NLCA 4DPTA 5D8HB 5ETVA 3NAIA 4USWA 2D3ZA 2G0JA 2HBRB 2L41A 1TL4A 2XI2A 3QIPB 5THWA 5B7WA 1N5VA 1OJ4A 1A7GE 2CKWA 2OPRB 3HULA 5K8NA 4IG0B 2VIHA 2VPWB 4YN3B 1V5VA 2GVZB 2VH7A 4MK8A 2L9WA 2YPZA 1PO6A 1LWCB 1T11A 4LQ9A 5MAOA 4F4KA 1IVZA 3D6FB 1Q4RA 4MIAA 3DOKB 2RJZA 3TNVA 2FVRA 5IQ6A 1XQIA 1S1WB 2QA4G 4TYBA 3H98A 1KDNA 5C42B 1F9EB 1BQMB 1C4CA 1NH8A 1H0HB 3JTNA 4PR6A 2KM8C 1U1LA 3A8KA 1SQEA 4RW8B 4K4SA 1V5IB 3UD4P 2HHHJ 2KTQA 3OR2B 1WUUA 2CQBA 2KT5A 1X4BA 3HSZA 5DLWA 5A8WA 3TUPA 2JVOA 1H73A 2Z2LA 3HZEA 2QG9B 3L7OA 3HVRA 1KLMB 3A52A 4FDIA 2BX6A 3DMJA 1HWLA 3EGNA 3KLFA 3QNWB 2ZKTA 2HFVA 3P4UB 4DUYJ 2HFZA 4Z7CA 3R8YA 4IFVA 1N0VC 3W62A 1HJKA 1T05A 4JI3F 4K5SA 1UP1A 4NLDA 2CQHA 1F2HA 2CNLB 4YDXA 2VPYB 2MKSA 1QAYA 2HG4A 4H54A 4KGZB 4TLQA 4X4NA 3KJVB 2UXDF 3V5RA 1S9EA 4PXEA 4BC7A 4RNFA 5LJ5Y 1N6QA 2P5VA 2HVEA 1UTAA 2KVQE 4B3SF 3MCSA 5F41A 1XR6A 4CRJA 1RWNB 1Y7PA 3EWGA 3W2WB 1FXLA 3W63A 1CJUB 1JJCB 3ILJA 2RQKA 1KR4A 1SKUB 3M2UA 5FDLB 1UVMA 3OFEA 2HGLA 2MLXA 3KDNA 1YJRA 4JI0F 1KFSA 2MZSA 3M8ZA 4DX8H 1RDRA 1FD2A 2VPZB 1YJWS 4OX9J 1RA6A 2R7UA 2JEGA 1VQPS 1M1KT 1P1LA 3AQOA 4CH7A 4N8OA 1IBMF 3SCIE 5CCLA 1LW2A 4HH0A 3CD6S 3BM7A 3U02A 2G2ZA 1WC4A 4O44A 5DO2A 3WHIA 2LQJA 1T8EA 4LFBJ 4JI1F 3WAWA 4P10A 1JLCB 1TAQA 2CPIA 2DXEA 4ZJQA 5C2CA 2NYIA 1PSDA 2XS2A 1YJVA 5ETOA 4P9SA 4PQUB 1SHQA 5L0KA 1IWGA 2J0XA 2JSXA 4XO0A 4K4YA 4R8UA 3ENWA 3PKMA 3MCMA 3OTBA 2OD4A 3MI7X 4QWDA 5DJBA 3TARA 3FBBA 2FLOA 5KG5A 3R9LA 4J9MA 4QAXA 4DS5A 5A0YB 3BREA 1LXNA 4DF8A 3SSSA 4K4XA 2UUBJ 2W5RA 1HQEB 2XM3A 5IXUA 3HVWA 3M8QB 3H7HB 3PIPQ 2BACA 1TMJA 2PFDA 4F04B 3BDEA 1XTZA 4ES1A 3W64A 1KHJA 1LWEA 2FJEB 2IM2A 1TQLA 3FKBA 4PXBA 2RB7A 2XWXA 4WKYA 5HMZA 2K3KA 2RH6A 3RB4A 1FKOA 1FVQA 5IV4A 3OHBA 4DQQA 1LKZA 2DNNA 3S7RA 2OJ3A 1OS5A 2FC9A 2GSOA 1VRUA 3NOCA 3WX8A 1FJGF 2B6AA 3J7A1 4CNYA 4Y2AA 4K2XA 4LF5J 5IFMA 5F9NA 2AU0A 2EKNA 1JLGB 2IC3A 3ETMA 4ZVTB 1RACB 2HVDA 3GTYX 3KUGA 5B0GA 2GAGC 3NRBA 1B70B 3E3XA 4DR5F 4WF9Q 4JI2F 1HI8A 3MZIA 4ENOA 3AH6A 4NCGB 1B0TA 3KTQA 4DOZA 4RW6A 5K20B 4FPRA 4X62F 1MSWD 1IWAA 2QL9B 2EFVA 2W8LA 1EJ7L 1K47A 2QMUB 3VAFA 1RU2A 4X4QA 3DXBA 3QAUA 5K9FA 2EFQA 1OPIA 1VQMS 5LXYA 4OI1A 2HMIA 2KH9A 3HHEA 2VBZA 2FLLA 2DNHA 3H5YA 3K0JA 2DPIA 7FD1A 4M5GA 1S7IA 4YR0A 2DXFA 4AXIA 1RQ0A 2RS8A 2EBGA 2HWIA 3TX0A 5A8WB 2HNZB 1G7CB 3RTVA 3QO9A 3KDOA 1LW2B 2WW4A 3JAMU 2RT3A 2DHHA 4TY8A 3QJJA 1FX4A 2ZOMA 5ETKA 2VBWA 1ZEDA 4RO0A 4IG3B 1VQ5S 1M5SA 3GFXA 5KFZA 2DY9A 2XMTA 3NXZA 3HSJA 2EWHA 3J7YU 1S9FA 2IJNA 2DBBA 3R2CJ 4ECZA 4QW9A 3NS5A 3M2RB 3CMAS 2JEJA 1DLOA 2J0WA 3D6TB 3CCTA 2MZQA 4KV8B 5HSPA 1C1BB 2XO7A 1T03B 1RT4B 4J9KA 4AL6A 4N8NA 3DYCA 4L73A 2J9CA 1M5OC 1VQYA 1WELA 3IWXA 4F2SA 4UPIA 3H5XA 3JXOA 4WFBQ 1S9GB 3DRPA 4J9QA 2YKMB 4EZ9A 5AXKA 2FVQA 4ZPCA 4NLVA 3ZTSA 3ITHB 2M9KA 4RX6A 1TP7A 3RGIA 3JSYA 1J2VA 1NDKA 1AUDA 4CYUA 3QRRA 2KFNA 2DR7A 3MAQA 1H98A 3CO9A 5HAOA 2M3DA 2RAQA 3K2YA 1W2BR 3CEDA 2Y0BB 4ZPDA 1JKHA 2ZUAA 4PABA 1Z1ZA 4LF8F 1M0SA 2VOPA 2K7JA 1U48A 1SH3A 1HA1A 1MN7A 3EDRB 3TA2A 2QSFA 1SL1A 2F5GA 4NLWA 5E33A 3N0VA 1O6XA 3KK2B 1TKTA 5LMNJ 1HKAA 3T5HA 1WNEA 4OYWA 4DPYA 3G6ES 2EVZA 3M9OB 5CXTA 1A9NB 1WF1A 1BQNB 4RWXA 5DLVA 2FIUA 1T9WA 2E29A 1ANIA 4R5PB 1Q8LA 1UETA 4ECWA 2ZWOA 5HMWA 2WVFA 4ES2A 2N7YA 2VD3A 2EG1A 1U45A 4M8LA 2W2MP 3WC0A 3KOAA 3R3TA 4PEOA 4CIOA 1YDLA 4B9MA 2GIFA 2V8GA 1HWIA 5D3GA 4IO1A 1R89A 1P49A 2QX0A 1Q5YA 4DR7J 5K8MA 3DXSX 1Q7YT 2LEAA 4B9NA 1CS4B 4X66J 4DQSA 1WEYA 2OPQB 3MMBA 3W8GA 5INHA 4Q8FA 3J80U 1FKOB 5B0EA 3KLHA 1RAIB 1KHNA 3IR5B 3ICLA 1FERA 4M5IA 5GAEI 1WSVA 1NKBA 2W8SA 3FFIB 4L6V3 4FYXB 2IYGA 2V4RA 4DLGA 5HROA 1GTHA 2DD8S 2MDAA 1H38A 1UFWA 1TL3A 3V4MA 2FHKA 2ATCB 1AXQA 1RT6B 2Q1LA 2VBXA 2MPUA 3AB2B 1VK8A 2L08A 1T0TV 1VRTB 1FF2A 5CHCB 1MN9A 5HP1B 4KY3A 1DAXA 4X4UA 1KRPA 5CAAA 2DGUA 1QE1B 1N52B 1UAWA 1NZ8A 2KYZA 3MPWA 1TL7A 5SUHA 5LM7E 3H8YA 4OJ1A 4JI6J 1FRMA 2AW0A 2PSZA 2HNYB 3N4WA 1UWBB 3Q8SB 4UY8T 1B0PA 2QYGA 1SI9A 3NCPA 1VISA 2G2YA 3GV5B 2GA3A 2BBEA 2A18A 4C97A 4USJC 4NXMJ 1KOHA 3LP2B 4X65J 5JVHQ 3N28A 4CYUB 2CVEA 2MZRA 1DFDA 1T9TA 2B4UA 4DJBA 4FNHA 4DQRA 2Q6BA 2DGVA 2YKMA 1YQHA 1HQUB 1X5SA 5HJXA 3T9ZA 3P45B 2FJXA 2Z58B 1KEKA 4I6AA 3S6EA 3MR5A 2IM3A 3E01A 1FNOA 1N5QA 3IC1A 3OXGA 4QQBA 1N56A 4WIQA 1FK9B 1K44A 4K4VA 5HMXA 1OY6A 2C22A 2GC8A 2YWHA 2RNEA 1X5TA 4Q2LA 5F8JA 2AYGA 2VJUA 1YVFA 2UUWA 2MKHA 3I56S 2R8GA 4DG1A 2W8KA 4M63A 4R5PA 3KMSA 4UOOA 2IMWP 2CWXA 3KLEB 4JV0A 2B5JB 2XMUA 4I69A 3GIKA 2IBKA 2IDEA 4DPOA 3CDAA 4IG0A 4C8MA 2BRLA 1P27B 4A4JA 2E5JA 1R8AA 4NRUA 4F4YA 2Q43A 3MPYA 3GFHA 2Y0SD 4OHXA 1UJ5A 3S8SA 1UVLA 2Z57B 3IRXB 1PAUB 2NCKL 2FD2A 3OXLA 1KH5A 1E6VB 4LR8A 1EKSA 1Y10A 3EPIA 2RE1A 3WIUA 3NNHA 1PGZA 2K06A 4EYHB 2ZWPA 2CQIA 1M90T 3N6NA 1NSKL 4EO8A 4WU3A 3M8SA 5J1PA 3N01A 2EXUA 2F7VA 4A8WA 3GYNA 2R7SA 3HJVA 1RHMB 1I94F 1FXDA 1S6PB 4L72B 4GKJJ 3PG9A 3D66A 2ZOGA 3N79A 4WJBA 4CXKA 4J7CA 3SDEB 2O67A 4PYDA 1RKJA 3BQ0A 4G1IA 3AAWB 1CEZA 5HROB 1ALJA 3T5KA 4C11B 1QVGR 3Q22A 1S1UA 2QLFB 1D9FA 2BE2A 2L9DA 1URNA 1VCTA 4N47A 3UVJB 1X4EA 1YRTA 1N36J 4PCQA 3CIMA 3SSQA 1VQOS 4ZJLA 3W1YC 1U0SA 3Q8PB 4OX6A 5KOXA 5JMNA 1NJIT 4YQWA 1ED8A 2V34A 2G13A 3D0HE 4L76A 4PXDA 1AA1B 5EWFA 2XTJP 1RP5A 1UW9A 1C0UA 1UEVA 4K5RA 3I5AA 1NSPA 1ZZFA 2YNGA 4WFXA 2DEIA 3U1NA 2CDRB 1FWLA 2YX4A 4QR1A 3VF0B 2OSRA 1S6OA 1H2VZ 3V6DA 2JRSA 3MEDB 5J2NB 2BQRA 3RW6A 2ZITA 3L9ZA 3R27A 4E98A 1FFGB 3CVKA 3O5TB 1FRHA 1HW9A 3POTB 4ANEA 1O51A 5DM7Q 2HHTA 4IFVB 1CJKB 5EWEA 2O1PA 4CLTA 1TL3B 1RT3A 3PVXA 3MK1A 1RT6A 2W1BA 3IA0A 4DG1B 2HVZA 2NPFA 4J9OA 3J7YI 3R7SB 3MOJB 3PNIA 2B8PA 4KO0B 4DCPB 4KE5A 3UCZP 1BMQB 2V4QA 4ZLNA 2EC0A 2UUAJ 1OSCA 2WONB 4RJVA 3M2VA 2LYVA 2CFXA 2QN6B 3BSAA 3MMAB 4HI2A 3OSPA 1IKXB 2QFIA 3IGNA 1VOMA 4O4GB 2X3GA 1ZPVA 3EM1A 4PWWA 4IFYB 3JQMA 3BJYA 2BZ2A 2DEJA 4RR5A 1Z2ZA 3CIZA 4M5LA 3MR3A 4N76A 1AW0A 3BH6B 3IG1A 1R31A 3DHXA 1RE1B 4FVCA 4Y2CA 2UU9F 3NKRA 4LSNB 2QC3A 1PYTA 4ID8A 3ULHA 4WKRA 2ACYA 1Y7AA 3OJUA 1HMVB 2MQ8A 3KJNB 5KFEA 1Y3KA 3BPSP 3ZZYA 2JDJA 1S0NA 2HAIA 2DB1A 4DV2J 1UZDA 1LWEB 1HNWF 2DT9A 2Y1IA 4JI1J 2E5IA 2XS7A 1SJ1A 5J1EB 4PWDA 1C1CB 2XCAA 1KHWA 5LXRA 5M2PA 2ZE2A 2VPXB 1JXLA 1WC6A 2VUGA 3OFHA 4CI0B 4YB5A 4CLPA 1HIYA 1UWAA 4ZVRB 4A47A 1VC0A 2BJEA 2F4VJ 2VU5A 5LSRA 3I96A 3TR5A 2VFVA 3I9V9 2F4FA 2CPXA 2NXUA 1NPPA 2XMVA 2H9ZA 3M8WA 3VQTA 2DNQA 3PYFA 5T7LB 3RB3A 1FJ7A 4QR0A 4RW6B 1URBA 3HHLC 2ADBA 2OEJA 2GCFA 1RAFB 3HCXA 3HT0A 1WOOA 2V94A 3BR8A 4LJMA 2IA0A 2PC6A 2ZDOA 4V1Ak 1UEKA 1X4AA 3WQPA 5C5JA 2FVPA 3HO1A 2EI5A 2YWWA 4DL7A 1U25A 2BA9A 2P9GA 3AJ2A 4XIUA 4NL5A 2YNHA 1HNVB 3KK1B 3D1OA 1LWFB 1RA7A 4YHHF 1YRUA 2CPYA 2C2OB 2N4CA 3VAMA 4OYMA 1SKRA 1VR6A 2LDIA 5B09A 2HS3A 3HM9A 1U8SA 2Z4PA 4NA2A 1N5TA 2CJXB 2ILYA 3LQVA 3QWUA 4CNZA 5ITHA 2W9BA 5G0RB 4MK7A 3GV7B 4LR7A 3BGRB 2RQMA 1ALHA 2V8HA 1U6ZA 2RDIA 1N2LA 5KFWA 3DDIA 1SKSA 3HVTB 2HS0A 3QRPA 2CADA 1TKDA 4B9TA 2YKNA 3QYYA 5H9EJ 4FZVA 2XYGB 3R5DA 5HANA 3HJFA 1BHNA 1CULB 4ZPVR 3F73A 3X1LB 3JTPA 4GVBB 4N7TA 4JUZA 4ZLLA 2YWEA 2XMKA 4NLOA 3D3CJ 4G1QB 2RVJA 4ZOSA 3TYTA 1HQ2A 3QT5A 4KO0A 2R7VA 4AFFA 4RUAA 2ABYA 4OJHA 3DRYA 4NYOA 3W61A 4FDFA 4JV5F 1D0EA 4OV6A 3QGIA 4N5SA 4C4WA 4Q5VA 4F4AA 2V2ZA 1LXJA 3I5BA 2E7WA 1VBZA 3F56A 1WI8A 4GC6A 4ECTA 1DTTB 1X4HA 1YBAA 3D7SB 1SIWB 4WWSA 4NWJA 3M8RA 3LAKA 4B08A 2KB2A 1WOSA 3LOUA 4W90B 2CUYA 4PWDB 2XS5A 4CWBA 2ATLA 1FE4A 2YNGB 2DTJA 1R8CA 3TZYA 2QA4S 3V6KA 2H1YA 3R5JB 5EDWA 4DF4A 4X4SA 3LXQA 4ILRA 4IOBA 5KT7A 2DNMA 2W9AA 4A8FA 2HHVA 4K4ZA 2ASYA 1QJHA 1CLFA 2IMOA 3C15B 4HTIA 4ICLB 2YNIA 1VMBA 4U7CA 4K4WA 1F60B 4DFMA 4YB7A 5KFQA 2PDAA 4ZLPA 2MTLA 4UW2A 2X1FA 3CGIA 3H90A 5KT3A 1IKXA 5D0RA 3SZZA 4DV1J 4QWAA 2W2NP 1UKUA 3GZ7A 2HQIA 3ZXWA 3CCZA 4NLYA 4YMEA 5DDRC 2FGOA 3ZZZA 1ZM2A 1Q8KA 2RU9A 3Q23A 1VQ4S 2UUAF 2CXEA 2QLJB 2W4CA 3M8PA 3MMAA 1SJ3P 1T9XA 2UVUA 3LPEA 4RNNA 2Q79A 2UXCF 2OKQA 3M30A 1MW7A 4ZPBA 3BYRA 3DRRA 3ILIA 4C8YA 1RAJA 4DV5J 1UFLA 2HRUA 2P9CA 5T7LA 2B7BB 3PACA 3SFUA 2OPPA 2RKIB 1WF2A 1RT5A 2R9LA 3TEHB 4Y2IA 1FXRA 4DR1F 4ED0A 2BDPA 5CA5A 1FJGJ 4P74A 3QJPA 5A8KB 2ASJA 1IBKJ 1PC5A 3FSIA 2OMOA 3AD9C 1EETB 4A8OA 4GC7A 1D8ZA 1KLMA 4GO7X 2AGOA 2FLNA 1RTIB 5KFTA 1S49A 2H5JB 3QZ7A 4NEZA 4NX9A 2YWFA 5JVGQ 3H20A 2XY7A 1X0FA 4HDHA 3NMRA 3NKPA 2OSQA 5EGEA 3CB4A 1HHTP 3CD0A 3AT1B 3GQCA 3J7ZT 1S99A 4KFBA 5KFYA 5J1EA 1RU1A 4CLFA 1Q81T 4UORA 4U8YA 1UVKA 1MROA 5G0RA 3L7UA 4NWBA 4C2MA 2C2RA 2Z2YB 3B8HA 3CCRS 2VICA 1FO1A 1HPZB 2NSBA 3DLEB 3DOKA 3OSNA 1HI0P 1S79A 2CG4A 3DOMA 1IQZA 3BGOP 1F9HA 1PG5B 1RISA 2EFOA 1XWLA 2BV3A 4YY3J 2FZCB 4DLEA 3SMZA 4F4ZA 1KQSR 2XSJA 4XK8C 3BDHA 3I87A 1NK7A 1LFPA 1Z4UA 2FZGB 4ANDA 5GAHI 4X4RA 2R2UA 4GKJF 2LP4A 3K57A 1FWPA 2RHQB 1WORA 3MPVA 4CO4A 4MKYA 3I82A 3Q8YA 1ZH5A 2LFVA 1AZSA 3TWZA 2VOOA 1IR1A 1MMNA 3MM5A 1NSQA 1JB0C 2R7RA 4ZG6A 3A3PB 1UEUA 1NMEB 1VQ6S 1PAEX 2EFNA 4CLLA 1CVJA 2KJWA 4JBCA 2WRMA 4USVA 2J9DA 3MUTP 3IN5A 2VHGA 2BVZA 1I3OB 2B9YA 2M7SA 4ZN3A 2UVWA 1VRQC 1OSDA 3AHPA 5CZXA 3K8WA 4AE5A 4E2FB 3NKMA 3TAMB 3RYLA 1VRTA 2UP1A 4LQYA 2XZTB 1CULA 3BGRA 3PHTA 1RWMB 1SC3B 4OZ1A 3VQSA 2F65A 4PRFA 2DK2A 2VJVA 3FNNA 3IAM9 5KFRA 3CCES 3PO5A 1EX8A 5GVQA 5A2QU 5K4PA 2GHVC 2D9OA 1NPRA 2PEBA 2UUTA 3CJTA 4K7QA 2HHHF 4KGXB 1S57A 5IT9Y 1JNZB 2AIRB 1LW0A 1W2IA 3VWSA 2MKIA 1QSLA 4M5HA 4PPDA 2W5TA 2VKRA 3JS9A 2OPSB 4KHPF 2C3YA 2AYEA 1RUSA 4OI6A 4MIVA 3MDFA 4RW9B 7AT1B 2HYIB 3MM8A 4KKOA 5LSLA 1K1SA 1FCAA 1SKWA 2C1EB 3LUYA 2XLKA 2HFUA 4XDDA 2R2RA 1EKRA 4B3MJ 4MYUA 1Y6VA 1URRA 3KHGA 4R0JA 5J2QB 1XJWB 2CNKB 2D1CA 2YNFB 1G6BA 3RBZA 1ZM4A 3BBCA 1S10A 4NZ6A 2LXIA 2VL1A 2V4JA 1EZZB 2NXCA 2ZJPQ 1HNWJ 3RZAA 3Q8RB 2OD6A 3CCQS 1KQKA 1R3NA 2KRBA 3DLJA 2XCPA 4CDIA 3GG0A 3MM6A 5KT4A 1QLNA 3DNCA 2Z56B 3NGTA 4OZLA 1YJ9S 4JI8F 1BD6A 3BQ2A 3GYGA 1XNQF 3DLLQ 2P9EA 3D9BA 4C0HA 1H3DA 5ADZA 2F1FA 5C24B 4MT1A 4DV3J 1QTNB 2COLA 1ELZA 2JC1A 1K73T 5HVHA 1SL2A 4CYSA 2DO4A 1YI2S 2E9RX 1KH7A 3VAHA 8ATCB 1NB2A 4AYBD 1JMTA 2KU7A 3L95X 1JK9B 4ZVPB 3JQJA 1AB8A 4ZP8A 1NJWA 1KHKA 3AODA 2HMIB 4EGLA 4DMZA 2E1AA 4DV4J 3R5GA 4F8RA 2HQCA 2JLEA 3DRXA 4QR2A 5T41A 1ZAWA 5KG4A 4S0MA 1HARA 3Q83A 1X4GA 4K8RA 4WCEQ 2QRRA 3SZYA 2HPUA 4H4OA 5HBMB 2A6OA 2AD9A 4V19J 4MAKA 4ZPAA 4Q0BA 4YFUA 4K0KF 3OLBA 4WZQA 4MKBA 3W8PA 1KSPA 2ZKUA 2QV6A 2P2CB 4A8SA 4X66F 5ETQA 4C11A 5AXNA 3BKUA 4W4MA 2BE2B 2QFJA 4MHXA 3QFHA 2XBPA 1PC4A 5LOQA 1IBLJ 1EB0A 4DV7J 3WIVA 1T9VA 2NSCA 2HGNA 1NK6A 1F5CA 4C0OC 2ALYB 2CWKA 2RMLA 2V0NA 2PT0A 2KG0A 3BSOA 2VQFF 1H74A 3UNYA 2RQCA 3R1LA 3RRHA 1N5YA 4ILLA 2WONA 1RHRB 2V2VA 4J9SA 5DGBA 4PUOA 3LP0B 1FNXH 2MEWA 3MPDA 2NQPA 1EW9A 1WDDA 4LF2A 2KXHA 1DARA 3NS6A 4FP9A 2E5LJ 4I68A 5K8OA 3V4IA 1JLEB 1SJQA 2O01C 5DZ7A 3HFKA 2HW3A 1KFDA 2CVIA 2KXNB 4OQJA 2G0CA 1F3VA 2CQ1A 4YR3A 3IWLA 3N5BA 3UN5A 1B7FA 2PI5A 5B0FA 3TZXA 2EW9A 4R0EA 3D54A 4RLEA 3DLHA 1O99A 4DQIA 3LWLA 2ZZNA 1H7XA 2MJUA 4Z2XA 5KFKA 4JI7F 5LJ3Y 4RNMA 2FHOB 4Y28C 4F3QA 1X4DA 4PG6A 4C8NA 2ZJQQ 1UCNA 5HK4A 3UDLA 2HHQA 1LQ9A 2LXFA 4KV8A 1GH8A 1N2KA 4UUWA 2B9XA 3H0PA 4TN2A 2JLGA 1D09B 1TK5A 1EIYB 3MGJA 1RWPB 1KTQA 3RRGA 2HGMA 1S76D 1KTVA 3BBFA 3WAYA 3CJKA 5D3GB 2BABA 4ZP7A 2IUCB 4DZDA 1X8DA 1S4EA 3JTOA 3NCRA 2ZNZA 4MIBA 3UI3A 5KFGA 3KNGA 2DJWA 3G82B 2CYYA 3QLHB 3NKNA 3TO8A 5HO4A 4P6QA 5GRRA 5F8GA 2FUG9 5CZVA 1SL0A 1G1XA 2YX7A 2H48B 2NLWA 5JUMA 3FGVA 1WTFA 2H5EA 4OYBA 3TA1A 4ZK7M 2J6UA 5GAEU 1R0AA 2XZWA 4KYZA 1XC9A 3BBBA 1NK8A 3T5LA 3CC7S 3VAJA 1R7IA 5HQMA 4FYDA 3Q2TC 3MM6B 2XI3A 2HZAA 2ZHBA 3RB0A 2ZHAA 1JJHA 2HFOA 3GR0A 5LMUF 2UXCJ 3OBIA 2FJVA 2DNLA 4WP8A 1RHJB 2V4JB 5I3UA 1F6TA 2V50A 5KG6A 2NR0A 4JYAJ 4HLBA 1IR2A 3D6HB 3PJ9A 1WACA 2YKNB 2VFTA 3EX7B 4LSLA 4K4UA 5GMDA 1SJ4P 1RTJB 3DLKA 4MH8A 3LP1A 4ZKAA 3K5PA 3ET6A 2R2TA 1NZAA 1TKZB 1HNXJ 5I42B 3M32B 2FY1A 4ZG7A 4LF7J 2HLUA 1O5JA 4NRTA 2EEYA 4UT4A 1NK0A 1I6JA 2ZVSA 3MAHA 2XYPB 3A4TA 1PCAA 2VQEF 2DPJA 2J9DE 2J7WA 1JNRB 1UL3A 1RZMA 4KIAA 3GJQB 3G87A 5E0OA 4MKAA 4HEA9 1VQLS 4LIRA 1HNVA 3QGPA 2DVIA 2RRBA 4YDDB 1DTTA 1N88A 2LMIA 2R7QA 3NAHA 4OZ3A 4Z7YA 4ZITA 4X65F 3L3CA 3N6LA 2MGZA 3MURP 3L4BC 2LECA 1HL6A 1VLYA 2VA2A 4NLXA 1E3CP 3OLAA 4JYAF 1FSUA 3AA9A 2QMWA 2W01A 5I3QA 4QZVB 1WSRA 3TJ9A 1RT2A 1VFJA 2POKA 2QA1A 2D69A 2NYHA 2HNYA 4J90A 1IKWA 1KVJA 1SC4B 4NXNJ 1TKXA 2QT7A 5DGAA 1UVIA 3CC4S 1RAHB 2Z2MA 1XMQJ 5IJSA 3JQKA 3CJ0A 4H4KC 4MFBB 1H6KX 4GVBA 2LVWA 4OJGA 3OW2R 4JI5J 4RL1A 1D8YA 1FKPA 2NZ4A 3M6UA 2SXLA 5DDPC 3NCQA 4DFPA 4ETXA 2D9PA 2ROEA 3FUYA 2CIMA 2BANB 4OLPA 4O0IA 4LR2A 3WBHA 2Z0GA 2IUCA 3DLGA 5DQHA 5LL6d 4CLKA 3KHRA 1VRUB 2H5IB 4P2SA 2HQGA 1SV5A 3E01B 2U1AA 3W9JA 3CDUA 3M2UB 4YHHJ 4JI0J 2HHWA 3GIJA 5LRMA 4ECSA 2HSEB 5EWGA 3FK4A 2IC3B 1U49A 3OXFA 1FDBA 3BO2A 1M1HA 1S6PA 2MZTA 2VV5A 2O3DA 2C2NA 2DRDA 2EC2A 4FVMA 2HBYB 4ZP6A 5CYQA 4UOGA 3BGFA 1RTDA 1ZS6A 2XO6A 1NJZA 2DIUA 2NUHA 2XULA 4PAAA 3BB5A 3OTDA 2HIYA 4LSLB 2MY8A 2QZUA 5A0YA 1RT7A 2VG6A 3U27A 3NY0A 1IJEB 1T05B 3BSNA 2R7TA 2V63A 2NS1B 5E41A 1Z2LA 2RRAA 3M8QA 3Q86A 3A13A 3M6WA 4DL4A 3KNAA 5D4NA 2ZC3A 3UD3P 3OQ2A 1B8JA 1MNEA 1IKVB 1RT5B 1YRXA 1CG2A 1S72S 4M95A 1RAAB 1WD6A 1I94J 3H40A 2HHXA 4AL7A 1CPZA 4RZRA 2JEIA 4UF4A 2AZ1A 2LU1A 3H59A 1H2TZ 3LANA 3PYDA 4LVNP 1J5EF 1NRKA 1VHFA 3U7JA 2IFYA 1Q1KA 1U1NA 1CC8A 2CAJA 4XTTA 3UVJA 1S1VA 2EK1A 4UTGA 1IBLF 1O0PA 5AT1B 3UQSA 1MWQA 1RTHA 3M1VA 1FRJA 2BXJA 3CDBA 4LBHA 3VV2B 3J81U 3IDDA 4LVOP 3SCJE 1X5OA 2WAQD 2RDJA 2W5VA 1C1BA 4WTOB 1F3FA 5F3TA 1NBEB 2ZOFA 3AOBA 2ZJRQ 3CCUS 4FBUA 3DI6B 1WHYA 3C8YA 3TI0A 4KPYA 3M7VA 4KRWA 5DRKA 4DX5A 3NKOA 4O4GA 4GVLA 1N5SA 3ZZRA 2DRAA 2ZZTA 2HQ3A 3ILLA 1GXLA 4USUA 3JYTB 1F2GA 2JOQA 4ZVOB 2RUGA 4NLUA 2GVDB 3KKFA 3LP1B 3POTA 6FD1A 1E6YA 4HTJA 3K5MA 3IGVA 3B82A 3CCWA 3O2IA 4C3MA
chains in the Genus database with same CATH topology
4ZG7A 2W5QA 3LXQA 2GSNA 1P49A 4KM4A 5LIAA 1HQAA 1ELZA 1E2SP 2XRGA 3KD8A 3WBHA 4CYSA 4QAXA 4UPKA 1KH7A 3TG0A 1ELYA 5INHA 3NKPA 1KHKA 1KHNA 1KH4A 3MK1A 4KAYA 3T00A 2W5RA 3SZZA 2W8SA 1HDHA 3B5QA 5TJ3A 1KHJA 1E3CP 5L0KA 1AUKA 1FSUA 1E1ZP 4LREA 3UO0A 1AJDA 3SZYA 5L0EA 1K7HA 4GTXA 4CXUA 4YR1A 4LR9A 2W8DA 3ED4A 2GSOA 3WAXA 4CYRA 4LRDA 4CXSA 4LRBA 4MHXA 5IJSA 3NKRA 5AJ9A 1Y7AA 3IGZB 4MY4A 5EGHA 3CMRA 3UN3A 1KHLA 5EGEA 2GA3A 3UNYA 4ZGAA 3NKQA 1EJJA 1AJAA 1ELXA 3WAWA 3T01A 3Q3QA 4UORA 3UN2A 2VQRA 1E33P 1EW9A 4LR2A 5KXAA 2GLQA 2IUCA 1KH9A 3IGYB 1AJCA 5LRMA 1ZEFA 3TX0A 1EW2A 3OT9A 3E2DA 2W5WA 3UN5A 3BDHA 4UPHA 3M8WA 1URBA 1ZEBA 5C66A 3T02A 4NWXA 1ZEDA 4TN0A 1O99A 4UOOA 5DLWA 2QZUA 3MK2A 4FDJA 3M8YA 3TWZA 1EW8A 4GTZA 2X98A 3A52A 4FDIA 4ZG6A 1SHNA 3DPCA 1N2KA 2ZKTA 5L0BA 1O98A 1B8JA 1KH5A 3BDGA 4LR8A 4ZG9A 4UPIA 1AJBA 1HJKA 3NVLA 4KJDA 3NKMA 4LQYA 3WAYA 5LRNA 4LR7A 2IUCB 1ALHA 5HRTA 1ED9A 1N2LA 1ALKA 1EI6A 5K4PA 3BDGB 2IFYA 2ANHA 2RH6A 2D1GA 2W5TA 3NKNA 5LQQA 4N7TA 4CXKA 5GRRA 4LRFA 1ALJA 4MIVA 3IDDA 5DLTA 2W5SA 3WAVA 2W5VA 4UOPA 3DYCA 4LRCA 1ALIA 2GSUA 3M8ZA 3M7VA 1EQJA 5IJQA 1Y6VA 3NKOA 5GOVA 4KJGA 1URAA 4LRAA 5DLVA 2G9YA 2W5XA 2XR9A 4NWJA 1ED8A 1ANIA 3BDFA 4B56A 1ANJA 4GTWA 4KAVA 4GTYA 1SHQA 4UPLA 3MK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG7 A;  2W5Q A;  3LXQ A;  2GSN A;  1P49 A;  4KM4 A;  5LIA A;  1HQA A;  1ELZ A;  1E2S P;  2XRG A;  3KD8 A;  3WBH A;  4CYS A;  4QAX A;  4UPK A;  1KH7 A;  3TG0 A;  1ELY A;  5INH A;  3NKP A;  1KHK A;  1KHN A;  1KH4 A;  3MK1 A;  4KAY A;  3T00 A;  2W5R A;  3SZZ A;  2W8S A;  1HDH A;  3B5Q A;  5TJ3 A;  1KHJ A;  1E3C P;  5L0K A;  1AUK A;  1FSU A;  1E1Z P;  4LRE A;  3UO0 A;  1AJD A;  3SZY A;  5L0E A;  1K7H A;  4GTX A;  4CXU A;  4YR1 A;  4LR9 A;  2W8D A;  3ED4 A;  2GSO A;  3WAX A;  4CYR A;  4LRD A;  4CXS A;  4LRB A;  4MHX A;  5IJS A;  3NKR A;  5AJ9 A;  1Y7A A;  3IGZ B;  4MY4 A;  5EGH A;  3CMR A;  3UN3 A;  1KHL A;  5EGE A;  2GA3 A;  3UNY A;  4ZGA A;  3NKQ A;  1EJJ A;  1AJA A;  1ELX A;  3WAW A;  3T01 A;  3Q3Q A;  4UOR A;  3UN2 A;  2VQR A;  1E33 P;  1EW9 A;  4LR2 A;  5KXA A;  2GLQ A;  2IUC A;  1KH9 A;  3IGY B;  1AJC A;  5LRM A;  1ZEF A;  3TX0 A;  1EW2 A;  3OT9 A;  3E2D A;  2W5W A;  3UN5 A;  3BDH A;  4UPH A;  3M8W A;  1URB A;  1ZEB A;  5C66 A;  3T02 A;  4NWX A;  1ZED A;  4TN0 A;  1O99 A;  4UOO A;  5DLW A;  2QZU A;  3MK2 A;  4FDJ A;  3M8Y A;  3TWZ A;  1EW8 A;  4GTZ A;  2X98 A;  3A52 A;  4FDI A;  4ZG6 A;  1SHN A;  3DPC A;  1N2K A;  2ZKT A;  5L0B A;  1O98 A;  1B8J A;  1KH5 A;  3BDG A;  4LR8 A;  4ZG9 A;  4UPI A;  1AJB A;  1HJK A;  3NVL A;  4KJD A;  3NKM A;  4LQY A;  3WAY A;  5LRN A;  4LR7 A;  2IUC B;  1ALH A;  5HRT A;  1ED9 A;  1N2L A;  1ALK A;  1EI6 A;  5K4P A;  3BDG B;  2IFY A;  2ANH A;  2RH6 A;  2D1G A;  2W5T A;  3NKN A;  5LQQ A;  4N7T A;  4CXK A;  5GRR A;  4LRF A;  1ALJ A;  4MIV A;  3IDD A;  5DLT A;  2W5S A;  3WAV A;  2W5V A;  4UOP A;  3DYC A;  4LRC A;  1ALI A;  2GSU A;  3M8Z A;  3M7V A;  1EQJ A;  5IJQ A;  1Y6V A;  3NKO A;  5GOV A;  4KJG A;  1URA A;  4LRA A;  5DLV A;  2G9Y A;  2W5X A;  2XR9 A;  4NWJ A;  1ED8 A;  1ANI A;  3BDF A;  4B56 A;  1ANJ A;  4GTW A;  4KAV A;  4GTY A;  1SHQ A;  4UPL A;  3MK0 A; 
#chains in the Genus database with same CATH topology
 4X64 F;  1SJF A;  3HKW A;  3MED A;  5J2N A;  1WKJ A;  3T9N A;  3TW0 A;  4B3T J;  2K1R B;  3AA8 A;  1B64 A;  4C3K A;  2A1B A;  5K8P A;  4XPE A;  1FTR A;  1AZS B;  3LAM A;  4OYP A;  3TUJ C;  1TAU A;  5I4M A;  5HL7 Q;  5E5N A;  1XNQ J;  5KAK A;  5AE2 A;  4WP3 A;  2MGZ B;  4F26 A;  1HNZ J;  2J0S D;  3JSM A;  2FYX A;  2LCW A;  3DOL B;  4UOC A;  1RT7 B;  2VG6 B;  2XWY A;  3CJ5 A;  5KFD A;  2AJ2 A;  3PTW A;  1LK7 A;  4Y34 A;  3G71 S;  4LT6 A;  1S9G A;  2YH0 A;  2DNG A;  2PN6 A;  4Z37 A;  3BGU A;  3MEG A;  2C3P A;  2Y3Y A;  1BY9 A;  4JOU A;  4RNH A;  4EFA C;  4DV0 J;  2EFP A;  5L1I A;  1HMV A;  4KQZ A;  2DIV A;  5FLX Y;  2ALZ A;  1T7P A;  1MWY A;  4LF4 F;  3G86 A;  4WPA A;  1GAO A;  1OIA A;  3C6T B;  1T03 A;  1HR0 J;  1AYE A;  1BWE A;  4LRD A;  4CTA B;  3EGZ A;  1LW0 B;  2P8I A;  1S6Q A;  2OPQ A;  5D78 A;  1U2C A;  3PYE A;  5LSO A;  4DWI A;  1CC7 A;  3CJQ A;  1DTQ B;  2KM8 B;  1KC8 T;  1TK0 A;  1V3S A;  3DLG B;  5AJ3 J;  3V6H A;  3PW4 A;  1KVK A;  4MIW A;  2D74 B;  1I51 B;  1N54 B;  3H2V E;  2AQ4 A;  3QSY B;  1GX5 A;  3I0R B;  4P7T A;  3CJ3 A;  2DR9 A;  2KRR A;  3T01 A;  3QO9 B;  5EGY A;  2QL7 B;  4TYA A;  2CDQ A;  2FJW A;  3RRK A;  1HBU B;  2X1G A;  3HFZ B;  1KH9 A;  2HVH A;  1REV B;  3ISN C;  3TUI C;  3BKT A;  2MKY A;  2WVC A;  5BR8 J;  4DUZ F;  3EVW A;  1VLO A;  2WSE C;  3MAA A;  1TL7 B;  1ZZN A;  3Q8Q B;  4ED1 A;  1B3T A;  3CUN A;  1EAY C;  2VB6 A;  3CDE A;  4GMK A;  1WG5 A;  4IH5 A;  4A8Q A;  4CZC A;  1U2F A;  1VIX A;  1SH0 A;  1NSA A;  2MQO A;  1KON A;  1N5Y B;  4OYA A;  4NWX A;  5C66 A;  4Q7A A;  4DX6 A;  4KHM A;  5GME A;  2AV5 A;  2UZA A;  4J9R A;  2R7W A;  2ACM A;  3MTK A;  3NNC A;  2I38 A;  4X62 J;  4KJI A;  4FDJ A;  4YEA A;  3IO1 A;  3I4P A;  3NWR A;  1N34 J;  3FBE A;  4MJK A;  5DZ6 A;  3PX4 A;  4RW8 A;  4WFZ A;  1N33 J;  1Y9O A;  2AX1 A;  2XHC A;  3NOG A;  3CF5 Q;  1UZH A;  3MUV P;  2QLX A;  4WU2 A;  1T3N A;  1LEO A;  1S5Z A;  3FDS A;  3OTE A;  4F25 A;  4KTQ A;  5EX3 A;  4P75 A;  2ZNY A;  2GW8 A;  2I6W A;  2F9J A;  4BCA A;  1S1V B;  2FVC A;  2QLB B;  3GU0 A;  2YPY A;  1ZET A;  4KR0 B;  3DOL A;  4FYW B;  1XNR F;  4RW7 A;  4D3G A;  2KN4 A;  3FRY A;  1KNZ A;  3OL9 A;  1TV6 A;  2D1G A;  4ER8 A;  4F2R A;  4HAC A;  2B9W A;  4URQ U;  1RXO B;  3PRV A;  4NLR A;  4YUD A;  3GCX P;  5E3A A;  4ZMM A;  1BQN A;  3PRB A;  4J9N A;  3ISZ A;  4ED4 A;  2L9N A;  4Q45 A;  3JSM B;  4ELV A;  2W5S A;  4DX7 A;  1S59 A;  1YJN S;  1QE1 A;  4USM A;  4YP3 A;  3M9N B;  3TEG A;  2B7C B;  1Q82 T;  1ZM9 A;  1N33 F;  1RI7 A;  1VQS A;  1T9U A;  1YKW A;  2B51 A;  2QYC A;  3A1Y G;  3NBP B;  5FII A;  3FMB A;  2I8E A;  2ZD1 B;  1E6Y B;  2RDD A;  3MMJ A;  1OWX A;  3O8W A;  1TEL A;  2EG2 A;  2IJR A;  4WII A;  2FJA B;  3V4I B;  4LRA A;  2W5X A;  1JLA A;  3IR7 B;  4ID5 A;  4LFC J;  1FD8 A;  3W5X A;  2D3O R;  3ZFV A;  2AT1 B;  3PW0 A;  3DRS A;  1BC6 A;  3QSI A;  1FWK A;  1DTQ A;  2QMX A;  3SBM A;  4OFZ A;  3D5M A;  1SPB P;  2OEM A;  2A6M A;  4O3S A;  4ICL A;  5A8R A;  2J8S A;  2BKO A;  1MWZ A;  4KFB B;  4N56 A;  1RAD B;  3OL6 A;  1BWV A;  3GJS B;  1T3O A;  5IZH A;  2X3D A;  4ZCL A;  2ZBQ A;  3RBD A;  3BDP A;  1ELY A;  1L5U A;  2F8M A;  4OZ5 A;  5EUH A;  2JEF A;  1Q95 G;  1KOO A;  2E1P A;  3NG8 A;  4TQS A;  3SV3 A;  4G3I A;  5ETT A;  5E3P A;  5J2P A;  3X3U A;  2OEL A;  1KKH A;  2CQG A;  5BYQ A;  1K1Q A;  1N8R T;  2QEX S;  1FE0 A;  1V6H A;  4M94 A;  3PW7 A;  4LRE A;  4DZ6 A;  3NMA A;  1AJD A;  3KWM A;  4DR4 J;  2XQC A;  4X2B A;  4UOF A;  2H54 B;  3PYG A;  2GJF A;  4DSE A;  2C3M A;  3MTJ A;  3QT7 A;  3WAX A;  1JLB B;  3GIL A;  3WX4 A;  5DLF A;  5D0G A;  3D3B J;  3SQG A;  2MHN A;  2CJB A;  5HQ8 A;  2AKW B;  2JHE A;  3M6V A;  4FXW A;  1UPM B;  1ITP A;  1X4C A;  2YWG A;  5IS2 A;  2ROP A;  3MM5 B;  2K8G A;  1WEZ A;  1U1P A;  3O44 A;  4OYI A;  1VQ7 S;  3ZO7 A;  2GQC A;  3D0G E;  3QFW A;  4OYO A;  3ZZP A;  2ZH3 A;  1NND A;  1TV6 B;  3ZNU A;  2BKN A;  2MMY A;  2VBY A;  3I0R A;  4FKX A;  4HAC B;  4OX7 A;  2XMW A;  4BWJ A;  3NKQ A;  1S12 A;  5H9E K;  2DCU B;  5K14 A;  3BQ1 A;  3RBE A;  1Q8I A;  1E33 P;  3Q3Q A;  3H2U B;  4DL2 A;  2VOD A;  4DSF A;  2GLQ A;  4JI3 J;  3PFE A;  3ZZT A;  4BLG A;  4NCG A;  3VAG A;  3ILO A;  3OR1 A;  2HWT A;  2XGP A;  4LFA F;  4IRC A;  4IOA Q;  2KKH A;  2KL8 A;  1AT1 B;  2W25 A;  5D0E A;  1AJC A;  2PEH A;  1QSY A;  2ZH2 A;  1U2R A;  2XSJ B;  4JI4 J;  3E2D A;  2VG5 B;  3ET6 B;  3SXL A;  1NKE A;  2MLY A;  3L7P A;  3M32 A;  3RUB L;  1LWX A;  3O6Q A;  4CT8 A;  4NZ0 A;  2AJ0 A;  4IH6 A;  3EVO A;  4CO2 A;  3HX9 A;  3RAX A;  2IPO B;  2OIH A;  2E9Z A;  1RKI A;  4K59 A;  4LFB F;  2JLF A;  3AXK A;  3V6J A;  1TVR B;  2B43 A;  5E3Q A;  4ETZ A;  3OJS A;  2JFD A;  5A6W A;  1DZ5 A;  2WZ1 A;  5KG2 A;  1NLK L;  1UW4 A;  2XC9 A;  3TAM A;  2X98 A;  4J5O A;  4KC5 A;  2VC0 A;  4Q44 A;  2DGQ A;  2DIT A;  3AOC A;  3P96 A;  3QGG A;  4P52 A;  5F8I A;  2BMB A;  3C19 A;  5H1S V;  2XGQ A;  4ECR A;  2G1H A;  4TVA B;  1YHQ S;  1N32 J;  2J76 E;  1CQM A;  1EHW A;  1Y4Z B;  4IDK B;  4C48 A;  1RT2 B;  2W7A A;  3VTI A;  4DPX A;  2R2S A;  4PG4 A;  1SJR A;  4MFB A;  1AJB A;  2CPE A;  4LF6 F;  1BGX T;  1CJT B;  5E7O B;  3P6Y C;  5E2Q A;  3NL0 A;  5HRT A;  4KAI A;  4O3O A;  2DY1 A;  1ALK A;  1EI6 A;  2WVB A;  2R7X A;  2UXD J;  3BDG B;  3CO0 P;  2OUG A;  5KFL A;  2OLW A;  1SXL A;  3CNQ P;  1TUW A;  4PG7 A;  4EWT A;  4OHV A;  1WF0 A;  3DRP B;  1QD1 A;  5L9X A;  3W2V B;  4UY8 5;  2KFZ A;  4ZPT R;  3HMJ G;  2CNO B;  3QID A;  3IWN C;  4PQA A;  2YNF A;  2GMH A;  1VC6 A;  1N4L A;  4LRC A;  3OTO F;  1U1Q A;  4C3L A;  3IG1 B;  3Q8V A;  1HR0 F;  3N5F A;  4HL9 A;  1VQN S;  5L39 A;  4K4T A;  3QRQ A;  5EN1 A;  2I5J B;  5JXS A;  1Q53 A;  3DRS B;  5GOV A;  1ZAV A;  4I64 A;  4Q0B B;  3RJM B;  3CJR A;  4KJG A;  3VAK A;  1IR0 A;  2W7P A;  5KG7 A;  3F44 A;  4ID5 B;  2FLP A;  3FEY B;  1RHU B;  3M05 A;  4IG3 A;  4FS1 A;  2A10 A;  3BDF A;  5K14 B;  5L1L A;  4DV0 F;  1ANJ A;  5G4D A;  2C2K B;  3KK2 A;  2WBR A;  4CLU A;  4DV6 J;  4ECV A;  2O66 A;  3F0N A;  3EMT A;  2YH1 A;  3DLB A;  2ZE2 B;  2YBV A;  2MJN A;  1VIO A;  3LWM A;  2GHW A;  4OV1 A;  1XER A;  4C7Q A;  1X4F A;  1BLU A;  3LA0 A;  1NK4 A;  1WEX A;  3BR9 A;  3FQK A;  1U47 A;  2KDO A;  1EAR A;  4L75 A;  4EBD A;  1N34 F;  2WK4 A;  5IV3 A;  2HZV A;  2ZH7 A;  4ECX A;  1RGV A;  2YKA A;  4B56 A;  1N48 A;  4DR3 J;  2RQ4 A;  1GTE A;  3L09 A;  1QUP A;  2HND B;  5F8L A;  1S6U A;  4CLW A;  1TFW A;  4GKK J;  1AUK A;  5C7P A;  4OI0 A;  3R7N B;  1FHT A;  1JWW A;  2QLW A;  2VC1 A;  2VDI A;  3B54 A;  4OZN A;  2ZH9 A;  2CQ4 A;  1YLX A;  3UD5 A;  4I7F A;  2V68 A;  3KLH B;  1L3V A;  1TL5 A;  1JXE A;  2XLJ A;  2CJQ A;  4HT5 A;  4Y6I A;  3LW5 C;  3MF5 A;  1RTH B;  2RIL A;  4ED3 A;  3ED4 A;  4IR9 A;  1EP4 A;  2BKP A;  4DQP A;  2OPR A;  3DKD A;  1XMQ F;  3N9U C;  4U6P A;  1WDT A;  2NXJ A;  2M0G B;  2GQQ A;  2VAS A;  3EXC X;  3M1V B;  3UN3 A;  1HBM B;  2V2K A;  4DDF A;  2XY6 A;  3PO4 A;  3IR6 B;  3MR6 A;  2AZ3 A;  2LQ5 A;  4CQ1 A;  1XBW A;  2B0G A;  4WFY A;  2UV8 G;  3BN7 A;  3B4D A;  3C66 A;  5D15 A;  1XMO F;  3IAS 9;  1FFW B;  1FKA F;  3HPO A;  3ETO A;  1VBX A;  4OI2 A;  4UOH A;  1Y00 A;  2X1A A;  3V81 B;  8AT1 B;  2RKI A;  4A8M P;  2GML A;  2DNP A;  5HVG A;  4OYX A;  1Y0H A;  3IGY B;  3ELH A;  1EW2 A;  2X1B A;  3CD5 A;  1TVR A;  3FSX A;  3BH7 B;  3OT9 A;  3QLH A;  4PKD B;  5DLG A;  3CCM S;  4LF4 J;  3TAQ A;  3SCL E;  2QSW A;  1XNR J;  1P9Y A;  3RU0 A;  4UPH A;  1Q7L B;  3NGD A;  3FFI A;  2BJ1 A;  4FF1 A;  3G8T A;  2QTW A;  5M2R A;  2IIH A;  3R5B A;  1SIZ A;  2BJ9 A;  5BJR A;  5IM0 B;  3EZ5 A;  3QT8 A;  3PXG a;  3HSG A;  2DCL A;  4D3H A;  4U67 Q;  4TNO A;  2ZM6 F;  1HBO A;  3OHA A;  1HPZ A;  2FZK B;  4NOH A;  5LMU J;  2GS8 A;  2QE5 A;  3M6X A;  2AJF E;  4F36 A;  4ZA1 A;  2DR5 A;  3BDG A;  3H42 A;  1P1T A;  3MEG B;  2IAJ B;  3J81 Y;  1PIE A;  4LF9 F;  3GP9 A;  4HHH A;  2MB0 B;  3W2W A;  2ROG A;  3CJ4 A;  4KBI A;  5F9L A;  5IWA J;  2CJY B;  5I42 A;  5F8N A;  4FF2 A;  2ZBR A;  2BYC A;  1U0H B;  2PA3 A;  2AEF A;  3D6M B;  2XHW A;  3DDN A;  3EJM A;  1WHX A;  2JC0 A;  3HDS A;  4LUB A;  1HLW A;  4DR2 J;  2R8K A;  4ELU A;  5DQG A;  3J81 j;  2IJF A;  1RTI A;  3R6G B;  2D3O 1;  4X84 A;  3IRW P;  2R4F A;  5GAH U;  1T95 A;  2HND A;  2GGP A;  4KH1 B;  3CCS S;  1REV A;  4UOP A;  2GZO A;  5KG1 A;  2DGW A;  2GIR A;  3WDO A;  1UMJ A;  2W9C B;  4X4V A;  2IRU A;  2WSC C;  9RUB A;  1YK9 A;  1HBU A;  3THP A;  1AUS L;  2QL5 B;  4F0K A;  2BR0 A;  2LKZ A;  1UA0 A;  2HQF A;  3T5J A;  1X5P A;  2BJ8 A;  3M4X A;  1URA A;  4I56 A;  1J5E J;  4RW7 B;  4PG5 A;  4ES3 A;  4QBU A;  4DI6 A;  3GIR A;  3KLE A;  4DBQ A;  1VK3 A;  3CCV S;  2FHM A;  5H9F K;  1U02 A;  3QAE A;  1NHK L;  4NAS A;  3UDC A;  4AQY J;  4QIE A;  4GTY A;  1L3K A;  3LPY A;  1H2U X;  4JV1 A;  4U8V A;  2NXN A;  2H4W B;  4F0H A;  2GAH C;  1IQT A;  4IH7 A;  5HLF B;  3FBC A;  3QBC A;  3DOM B;  4KKO B;  4IKA A;  2K3I A;  3GR1 A;  4EBC A;  3TG0 A;  3AY0 A;  3NWG A;  1FJE B;  1S1X A;  2FHJ A;  1FRK A;  1WG4 A;  2VG7 A;  3H2L A;  3T00 A;  6AT1 B;  4ZLJ A;  3BPD A;  3T41 A;  5AE1 A;  1RBO B;  2N82 B;  3BEG B;  1D3W A;  5F0U A;  4UZB A;  7FDR A;  4QWE A;  1YTY A;  5IM0 A;  1UJ6 A;  1VS3 A;  2KT3 A;  1KQG B;  3Q2S C;  1TKX B;  4P2M A;  3ZNJ 1;  4YB6 A;  3ZZO A;  1I1G A;  1NCL A;  2NXE A;  3A12 A;  4DV6 F;  1CJK A;  2DNY A;  4Q2M A;  3RAQ A;  5L0E A;  1OMS A;  1RT3 B;  1T94 A;  1WC3 A;  4YR1 A;  2ZUG A;  3AQP A;  4LR9 A;  4QPX A;  2G0I A;  3OFF A;  1OY9 A;  1J27 A;  3OV7 A;  3HHL A;  2YY3 A;  4ITS A;  4ZVF A;  2R8J A;  2CQ0 A;  2JZ5 A;  1GNK A;  2HHP A;  2JWN A;  4XDC A;  5JJB A;  3ZTR A;  2DO0 A;  3G6V A;  4DSJ A;  5GMK a;  3UNG C;  4BBY A;  2JH3 A;  3GG1 A;  2CJ9 A;  1HHS A;  1OQ6 A;  4FNI A;  2KHD A;  4OIX A;  4C8O A;  4P72 A;  1W25 A;  2Q6C A;  3RG6 A;  2DGS A;  3OTC A;  1YBU A;  4ZCI A;  4AUK A;  5KOW A;  1QM9 A;  3DGP B;  4HH1 A;  2MZ1 A;  4HT7 A;  3PJW A;  1VC5 A;  4QCL A;  4LSN A;  2VQR A;  4RBV A;  3PJX A;  5J2Q A;  4NZ7 A;  3D1H A;  3CT9 A;  1G2E A;  4ZPW R;  2NPI A;  2BOP A;  4ILM A;  1HFE L;  4QU7 A;  1IM6 A;  4NPO A;  4Q43 A;  1SV5 B;  1D1U A;  4RW9 A;  1UPP A;  4ZHR A;  3W9I A;  3QWP A;  2H3E B;  4KGM A;  2R8H A;  1PJ7 A;  2I0X A;  5IT4 A;  2AMC B;  3CJ2 A;  5A8R B;  1ZEF A;  1IN0 A;  2DIS A;  4DXL A;  2W2P P;  2GJ2 A;  2GHP A;  4GRS A;  2YWK A;  3JSR A;  4OI3 A;  2G4B A;  3LF0 A;  1V3R A;  2HHU A;  1N32 F;  1S1T B;  4QJV A;  1Q5V A;  3UWT A;  1Q78 A;  1YGY A;  5KFF A;  3CJ8 A;  4LBI A;  5D4O A;  3T02 A;  2E1M C;  4I2Q B;  5B0D A;  4I2P B;  1J5O B;  2LLZ A;  2W2O P;  4RUH A;  1NB7 A;  1JLQ B;  2VDH A;  2D7S A;  4RU2 A;  2IY5 B;  1DRZ A;  3E8O A;  2RS2 A;  1PYS B;  2XY5 A;  4OHZ A;  2HQD A;  4PPZ A;  3QT6 A;  4HR2 A;  4ED7 A;  2W5W A;  2V69 A;  4FPI A;  2AJQ A;  1JLB A;  4ZN1 A;  3LH2 S;  2LQ9 A;  4B3M F;  4M5D B;  4Y2M A;  1HW8 A;  1BE4 A;  2EK6 A;  2GVD A;  5FD1 A;  3J7A N;  3IBW A;  1WHV A;  4KPC A;  2DR8 A;  4IQX A;  4NCA A;  3ZZU A;  2AWZ A;  2F9D A;  5FLX U;  1RYS A;  1HNZ F;  4RUC A;  3KLF B;  1YJT A;  4CO5 A;  4I6W A;  4OX8 A;  4RPF A;  3P3D A;  5BXI A;  3MUM P;  3JB9 k;  2C2E A;  2XNR A;  2BE7 D;  3FZB A;  4OJ3 A;  2FJD B;  2C42 A;  1EQM A;  3EE3 A;  1ROF A;  4HHU A;  1RBL A;  1S1X B;  1U09 A;  5KFU A;  1FFS B;  1RWW B;  4F3O A;  2W9B B;  4A8K A;  5LQQ A;  2GX8 A;  1U4B A;  4ANC A;  2CPJ A;  2C3O A;  2EBE A;  4RKU C;  5KFS A;  4IR1 A;  1ZTT A;  1R43 A;  3GLJ A;  1F1B B;  3TVK A;  2X51 A;  3ENQ A;  4OLO A;  4YB1 P;  4U96 A;  4TKT A;  3DI6 A;  3PM9 A;  2WCX A;  3W66 A;  5C42 A;  1XEZ A;  4KHR A;  1V9O A;  2LEB A;  5FJ4 A;  1RAO A;  5CYJ A;  4A8X A;  3UCU P;  3ZTO A;  1C4A A;  4QU6 A;  2VZ9 A;  5EX0 A;  3OR1 B;  2MKJ A;  2XR9 A;  3PFO A;  4ZP9 A;  4WZM A;  4CH0 S;  4LF6 J;  1Y5N B;  2DHS A;  2IVM A;  5KG0 A;  4IYQ A;  2ZH8 A;  4ECQ A;  3T3F A;  5RUB A;  3MD3 A;  1PJ6 A;  5CD4 H;  1VYA A;  2M2B A;  2YKQ A;  3PRD A;  5L38 A;  4RU9 A;  2H65 B;  1HQA A;  3MMC A;  1DUR A;  1CSJ A;  1WG1 A;  4WXW A;  3CE8 A;  3IM8 A;  5KT6 A;  3I32 A;  3H25 A;  1H72 C;  3PV8 A;  3SI8 A;  4F7V A;  3FQL A;  2E1C A;  4Q8E A;  3H4D A;  4JI7 J;  3P49 B;  4O3R A;  4R8U B;  2MKK A;  1S7H A;  2A3J A;  5D6G A;  1HWU A;  3UW1 A;  5CH7 B;  2E5H A;  2J8A A;  1KP6 A;  1VQ9 S;  3GE9 A;  2ASD A;  5F0W A;  3C6T A;  2KO1 A;  3JSB A;  1XN9 A;  1U6B A;  3OUY A;  2HBQ B;  1LK5 A;  5BYS A;  2YKP A;  5LMN F;  1UFK A;  4LF7 F;  1S1T A;  3I31 A;  2ERR A;  4K50 A;  5KG3 A;  4NCB A;  4KSE B;  3VVU A;  3ZC4 A;  3AXM A;  3W5Y A;  1IXK A;  1FRL A;  1QAX A;  3BS9 A;  5B0C A;  5IT0 A;  2MQQ A;  1S1W A;  3T19 A;  1R27 B;  1DQ8 A;  2GJI A;  1Q0N A;  2HWH A;  3KUE A;  3VZI A;  4AT1 B;  1MU2 B;  3GFZ A;  3MR2 A;  2RSQ A;  3W2V A;  3KK3 A;  3EPG A;  1HQU A;  2RUS A;  2M5Y A;  4NML A;  3I0S B;  5KFI A;  3CSK A;  1M5P C;  1JIH A;  3KYL A;  1VQK S;  1O8B A;  2DKO B;  2GA7 A;  2ZDP A;  4C98 A;  2DNK A;  2J5A A;  4EI2 A;  1Y11 A;  2QO3 A;  5A8K A;  2J6S A;  3QAT A;  3FMW A;  1KN6 A;  1ELX A;  1VDH A;  3CMQ A;  2IRX A;  4HDG A;  2QA2 A;  5E3C A;  2DXD A;  4WP9 A;  4O3N A;  2FHJ D;  2XMM A;  3TQE A;  4DV1 F;  3TAN A;  1IKW B;  2DNZ A;  4ZVQ B;  1X9S A;  1S0V A;  2QGF B;  3MAA B;  4QIF A;  4PYA A;  1TZ0 A;  4FF4 A;  3RW7 A;  2KG1 A;  3PW2 A;  1XMO J;  4HI1 A;  3G4S S;  2ZH6 A;  4K0K J;  3MOZ A;  4TY8 B;  2OO4 A;  5DQI A;  2BJ7 A;  2MKC A;  3CC2 S;  1ZPW X;  3FJ2 A;  1X7V A;  2HK3 A;  2KZM A;  3MM9 B;  4A48 A;  3KMQ A;  4I2P A;  3R5C A;  4ZVG A;  4DV4 F;  1J5O A;  2D3U A;  5CAB A;  3VHQ A;  1YZ7 A;  4LIW A;  5BYR A;  4DPU A;  5DG9 A;  1U24 A;  3W60 A;  3MFI A;  4ZCK A;  2A2C A;  2BJ3 A;  2KVI A;  2ZH1 A;  3K59 A;  4UUX A;  3CTR A;  3Q0A A;  4FYV B;  1F5A A;  1FX2 A;  4EO6 A;  2V9W A;  1WI6 A;  2YKO A;  1RHK B;  4URS A;  3B4M A;  3EZU A;  1HNI A;  2WBM A;  1NDL A;  2ZBC A;  4Y2K A;  3MM7 A;  3ENV A;  4JI8 J;  3GJT B;  3KLG A;  2ZM6 J;  1B7Y B;  4LQ3 A;  1RYR A;  5LRN A;  3U1L A;  1H7W A;  4W98 A;  1W7W A;  3NP5 A;  1DQ9 A;  5KFM A;  3IFE A;  2BJD A;  3HHN B;  4OZ0 A;  1S48 A;  2AX0 A;  1FT8 A;  5DG7 A;  2B4P A;  4FN5 A;  4H4M A;  2M8D B;  5A2Q Y;  5J2M A;  1OY8 A;  3AJD A;  4LF9 J;  5LT5 A;  3CPW R;  3MHY A;  4DR5 J;  4UST A;  2LQ8 A;  4LF5 F;  1FKP B;  2FJB B;  3IXQ A;  3MEE B;  1NHU A;  3FCH A;  5I3U B;  3K5O A;  1K0V A;  4E8U A;  2PMH A;  4UQG A;  1SUQ B;  3V81 A;  1Y3J A;  2M70 A;  3KXD A;  5IC4 B;  4J9U E;  2V8D A;  4WYW A;  3NGU A;  1YX2 A;  1ZAX A;  4NLS A;  3V2U C;  5IJQ A;  1ELO A;  3I55 S;  1A6L A;  2KI2 A;  2Y9H A;  4ED2 A;  4C8Z A;  4QOT A;  4YS2 A;  2R8I A;  1U0H A;  1HWK A;  3GMG A;  1U1R A;  2OFH X;  2VF3 A;  2Y1R I;  2YTC A;  3C6U B;  3TZZ A;  3C16 A;  3RBX A;  1A0O B;  1U1O A;  1NK9 A;  2OP5 A;  2PFF B;  1RSC A;  2C2Z B;  3NKY A;  5DDO C;  1MU2 A;  5ETR A;  2LA4 A;  2V67 A;  4LF8 J;  4KAV A;  2BUN A;  1KHV A;  3DYA B;  4M1K A;  5CYQ B;  4CH1 A;  2IM0 A;  1RTD B;  3MCO A;  2UUC J;  2W5Q A;  1DLO B;  2VFS A;  1Y5L B;  1KQF B;  5LIA A;  2B6A B;  2XRG A;  1QDU B;  1IM4 A;  4G1P A;  1V3Z A;  3HVA A;  4G65 A;  1WJ9 A;  1JLG A;  2ZHO A;  2A0F B;  5C25 A;  3IP0 A;  4WK3 A;  1QY7 A;  1HBO B;  3N6M A;  3OUY B;  1YJU A;  1SC1 B;  4IFY A;  2DGX A;  5IWA F;  5IT9 U;  1NJX A;  4XAK A;  2GNK A;  1BUX A;  2V2Q A;  4IOC Q;  4GKK F;  1OYD A;  3B6B A;  2OTL S;  5KFP A;  2ILZ A;  4U7U D;  1VBY A;  2MLZ A;  3LGN A;  4I1T A;  2I9S A;  2QIF A;  3CJS A;  5IOL A;  3I9Z A;  3KG0 A;  4U7U K;  1U1K A;  2OH2 A;  4GTX A;  1DQA A;  4QYZ K;  1JLF B;  3D67 A;  1SCJ B;  1XR5 A;  2XNQ A;  3DFE A;  3MM9 A;  3THV A;  4WXO A;  4V19 X;  1JQG A;  1S0O A;  4YY3 F;  1VGY A;  2PI4 A;  4CYR A;  4CXS A;  3G6Y A;  4C9D A;  2P6S A;  5CQG A;  5F8M A;  5KFB A;  3GV8 B;  2UU9 J;  1BXN A;  1C1C A;  4U9R A;  2BW2 A;  4ZVH A;  1LNQ A;  3W3S A;  2G2O A;  3A8J A;  1Q16 B;  5HP1 A;  4N41 A;  4NYZ A;  1K8A T;  3I0S A;  2GO9 A;  3I4H X;  4CCH A;  1D9A A;  8RUC A;  4DL6 A;  1HBN A;  2OHD A;  1LFW A;  1S4F A;  2HUR A;  3HVT A;  4PZV A;  4CO0 A;  4LFC F;  1EJJ A;  4X4O A;  1P9Q C;  4NI2 A;  3LO3 A;  3TJA A;  1FNM A;  2FTR A;  3IS9 A;  4ED5 A;  2JNJ A;  4RWW A;  2VG5 A;  3T1Y F;  2OEK A;  4OHY A;  4FF3 A;  1YIT S;  3R6L B;  1YG0 A;  2CPZ A;  2HEK A;  3FCV A;  3HD1 A;  2XSF A;  4DUY F;  1S97 A;  3VGT A;  3EYZ A;  2OTJ S;  2HFS A;  5HLF A;  1GXT A;  4DR1 J;  3TQ1 A;  2AEM A;  1QVF R;  2Q3P A;  4AQY F;  1SB6 A;  3D1Q A;  3WC2 A;  1I5O B;  2LXU A;  1ZM3 A;  2BM1 A;  3IBC B;  3TZW A;  4QWB A;  4JI5 F;  4FKY A;  2O5D A;  3FZ2 A;  2W24 A;  3NGR A;  4QW8 A;  2IDL A;  1Q8B A;  4NE9 C;  3MK2 A;  2KYX A;  3ZTQ A;  1F5B A;  1ZBT A;  1RWU A;  1YIJ S;  1WOP A;  2CQP A;  4IDK A;  5D77 A;  4CP5 A;  5KTQ A;  3T6J A;  3QJL A;  2NZC A;  1X9M A;  2IM1 A;  3MR7 A;  2E5G A;  3E2E A;  2HKE A;  2AJ4 A;  3DPC A;  4ZIV A;  3UR3 C;  2CZ4 A;  4M5M A;  1SQF A;  2K1R A;  2UV8 A;  1O98 A;  1PJ5 A;  1WKL A;  1P6T A;  2E1R A;  3KUH A;  5J1N A;  5KFV A;  2LU2 A;  3HD2 A;  3MPU B;  4DCJ B;  3OL7 A;  1ZTW A;  1N36 F;  4EZ6 A;  2ZEJ A;  4QWC A;  4ZG9 A;  3A3O B;  3T1Y J;  2HS4 A;  1X9W A;  3THT A;  2Z2Z A;  1RWV B;  4DR3 F;  2Y1L B;  3UDE A;  3C2P A;  3TVZ A;  3HHL B;  2UXB F;  1L3S A;  3OD2 A;  5IC6 B;  5K5M A;  1NKC A;  4I2Q A;  2ZC4 A;  4H4M B;  2XG8 A;  4J9V A;  2H51 B;  5KFH A;  1JLQ A;  2WB1 D;  3J80 Y;  5C25 B;  1BQM A;  3G6X A;  2GIQ A;  5HQL A;  2ASL A;  2KT2 A;  4RBT A;  3CJK B;  1RAE B;  1RB0 A;  2BRK A;  3VVT A;  2VKZ G;  5I3P A;  1HNX F;  1IBM J;  4DV2 F;  3HXM A;  2MHE A;  2XEX A;  3PEJ A;  4ZVS B;  1B99 A;  4LFA J;  4JV5 J;  1R6V A;  3ADA C;  3PY8 A;  3PR4 A;  3TUZ C;  2AGQ A;  1VI7 A;  2FDN A;  3QPI A;  2WTF A;  4B17 A;  4I7F B;  4FYY B;  4CO1 A;  3BKF A;  4J91 A;  1CJU A;  4J37 A;  2VA3 A;  2B4V A;  1QSS A;  4ATN A;  4WYL A;  3C6U A;  3Q89 A;  1IBK F;  3MWB A;  4TU9 A;  4USK A;  3TVY A;  1APS A;  1BQX A;  1R8P A;  2K7K A;  3BGL A;  6FDR A;  3EVM A;  3CD7 A;  4BC9 A;  2V9K A;  3HHK A;  3M9M B;  3TAP A;  4FXV A;  2GSN A;  4KM4 A;  1G3O A;  2CA9 A;  1NDC A;  3IRX A;  3NS7 B;  5KFA A;  2RD5 C;  5KFO A;  2KZZ A;  1T02 A;  2F8E X;  3IM9 A;  4O4R A;  3KD8 A;  5ETL A;  3OL8 A;  2BOA A;  3K5N A;  4BDP A;  3EIC A;  3SYZ A;  2B5J A;  4NLP A;  2ZZM A;  4CM2 A;  3KLI A;  3QGH A;  3K17 A;  1KH4 A;  4KAY A;  3U1M A;  2CQ3 A;  4ED6 A;  4EBE A;  1FRI A;  4F3M A;  2D41 A;  5CD4 A;  1G4C A;  2M88 A;  4WE1 B;  2PII A;  3CCL S;  1OO0 B;  2AHO B;  3GCW P;  4CTA A;  1E1Z P;  1X0P A;  3OVA A;  2HZC A;  3H5U A;  4UZC A;  1RHQ B;  3OVB A;  4QYZ J;  4KHP J;  3TJ8 A;  4IRK A;  1HYS A;  4CXU A;  2G9O A;  4Y0F A;  2GV1 A;  1X31 C;  4M5N A;  2I2Y A;  2XB2 D;  4CO3 A;  3SQO P;  1JJ2 R;  3OPK A;  3TOQ A;  2MY7 A;  2PA8 D;  1OYE A;  1FK9 A;  1FEH A;  3PKY A;  1L3T A;  4X64 J;  4HYK A;  3S01 A;  2B8Q A;  1HI1 A;  1FES A;  4USI A;  1KVI A;  4DSK A;  2B3T B;  1MLA A;  2MQP A;  1KHL A;  1WC5 A;  3A8I A;  3AB4 B;  3DLE A;  1X60 A;  2JFK A;  4DEZ A;  2RRN A;  1KWM A;  2OAU A;  1W26 A;  2JJ4 D;  2DH9 A;  5KFX A;  3MCN A;  1IBC B;  4KT0 C;  4NI2 B;  3HI9 A;  1FRX A;  2A2D A;  2J7U A;  5D4P A;  3IS9 B;  1RTJ A;  3DLK B;  4CM0 A;  2ADC A;  4I6Y A;  3FVY A;  2ZD1 A;  3UN2 A;  5A6P A;  2J7K A;  2M52 A;  1FDD A;  5KT5 A;  3GFY A;  4H4K A;  3HT3 A;  1NK5 A;  4NXN F;  5ETP A;  4DSI A;  4KB7 A;  3EDQ B;  4URG A;  2GMJ A;  2LQB A;  4QIW D;  5ETN A;  4NYP A;  1LOU A;  1NEE A;  3K58 A;  1C2P A;  1GXU A;  2E66 A;  1CJV B;  2APO A;  4B3S J;  2LEP A;  4BWM A;  2HNZ A;  3D4J A;  1UA1 A;  5C2G A;  4TU7 A;  1QTM A;  2PO4 A;  4P2F A;  3EZO A;  3PW5 A;  4USH A;  3T1H F;  2P6T A;  4CLZ A;  4F4W A;  4F50 A;  2EPI A;  3SIP B;  4TN0 A;  1WHW A;  2MYF A;  3NEK A;  3IMQ J;  1GQE A;  1U7L A;  3M8Y A;  1XR7 A;  5F8H A;  3D2W A;  4GTZ A;  2IAJ A;  1GMU A;  1P8G A;  2NUU G;  1KBR A;  3RAM A;  1UJ4 A;  4P73 A;  2HVI A;  5DM6 Q;  9ATC B;  3F41 A;  3M2R A;  4EK2 A;  1S1U B;  2CNN B;  1NAQ A;  2R3V A;  2M8H A;  3QZ8 A;  4FXD A;  3NVL A;  3GSI A;  3KK3 B;  2DH7 A;  1Y5I B;  1RAG B;  4RW4 A;  2OPS A;  3B78 A;  2XMA A;  1C0T B;  3SZ2 A;  1ED9 A;  4ZCM A;  2CQD A;  5ETM A;  5L8R C;  4EEY A;  4ZGA A;  1IKY A;  2WOM A;  4I0W A;  1IKV A;  4E0D A;  1R8B A;  3FCW A;  3JAM Y;  1RBA A;  2WW8 A;  3KLI B;  2HRY A;  3A8E A;  1RLC L;  3AJ1 A;  3UE2 A;  5L9N A;  2YQ3 A;  1FA0 A;  4LRF A;  1UVN A;  5B08 A;  3BYP A;  4OHW A;  1ICE B;  4WE1 A;  1TL1 A;  4CLS A;  2RIJ A;  5MLC V;  5BR8 F;  1ALI A;  2CPH A;  2W9C A;  3KG4 A;  3FBF A;  2DHX A;  2MQL A;  3FSY A;  2HBZ B;  5L1K A;  3VR1 A;  3UR0 A;  1TUG B;  1EQJ A;  2DRB A;  1YJ7 A;  2IHR 1;  5KFJ A;  2CJK A;  1JKH B;  1SQG A;  4F67 A;  1Q79 A;  2PMW A;  1GMW A;  4ZVE A;  4BHQ A;  2DHG A;  1CBK A;  3FEX B;  4OI4 A;  4DL3 A;  1S0M A;  2PMZ D;  2KXF A;  1R0C B;  4XPC A;  4BS2 A;  2KJV A;  5AJ9 A;  4ZVU B;  4DL5 A;  2Y8W A;  1DJ0 A;  1F0X A;  1LWC A;  4DCO B;  3K5L A;  3MK0 A;  4UPL A;  1CQN A;  4LMZ A;  3KK1 A;  3TX8 A;  3T1H J;  5T14 A;  1LWF A;  1XMB A;  5IQQ A;  3DGP A;  2WHO A;  1PBU A;  3W7B A;  1HNI B;  4B3R F;  2VFU A;  2I5J A;  5DG8 A;  4KGV B;  1U1M A;  2FQQ B;  1JX4 A;  3LGM A;  5CYM A;  5B0B A;  1REG X;  1IJF B;  2AGP A;  4HHJ A;  1RLD A;  3HF5 A;  2YNH B;  1M1G A;  4AXJ A;  5TJ3 A;  2DHA A;  4DR7 F;  2MSS A;  1TU0 B;  5AJ3 F;  2RF2 A;  2XZD B;  2ZBP A;  3SQG B;  3C16 B;  3QIP A;  4DR2 F;  2N4D A;  3FRZ A;  3MEC A;  2LA6 A;  4YOE A;  2CRL A;  1CJT A;  3AFG A;  2DYA A;  3R5A A;  4ZJO A;  3FEZ A;  2G1D A;  3DN9 A;  3HLU A;  4G1Q A;  4L3K A;  5SZT A;  4J9L A;  3MEE A;  3GYX B;  4GTW A;  1XK8 A;  3CW2 C;  4P7V A;  5ETS A;  3DC2 A;  1SUQ A;  2QJ3 A;  3SSR A;  4DN0 A;  2E44 A;  5J2M B;  4RNO A;  4LRB A;  4YR2 A;  4PUO B;  1GT8 A;  4O23 A;  5CCM A;  2BQ3 A;  4NA3 A;  4QYR A;  4MY4 A;  1WC1 A;  1SBR A;  4M5K A;  3M30 B;  2ZVI A;  4MTP A;  3ISN D;  1FI4 A;  2W4P A;  2XLI A;  4KGK A;  2ZH5 A;  2V8V A;  1NDP A;  2VQF J;  5AXM A;  2E7X A;  3JYT A;  1SVD A;  4DR6 J;  3VGV A;  1CS4 A;  1HHQ A;  4ECY A;  1AJA A;  5U47 A;  3OFG A;  1S6Q B;  2B4O A;  5HJY A;  1B4S A;  2W2Q P;  4TQR A;  2CQ2 A;  4RW4 B;  3GPA A;  5E3R A;  5KXA A;  1M5H A;  2EKY A;  3HP6 A;  5FDL A;  2DNR A;  1NXI A;  4ZHR B;  3Q24 A;  1M5V C;  4F0M A;  4EMD A;  3BV8 A;  3BZQ A;  2DGO A;  2YNI B;  3K7R A;  3QMQ A;  3LTO A;  4OZJ A;  4C6A A;  4DN9 A;  4WFN Q;  2RU3 A;  1FJC A;  3HSD A;  4MMO A;  4ELT A;  2J9E A;  3AD7 C;  4TXS A;  3DYA A;  1PKU A;  4PXC A;  1MRO B;  5B0A A;  5KT2 A;  3G96 A;  3VAI A;  2IRY A;  3W9H A;  2AYB A;  4NLT A;  1VJW A;  3TA0 A;  3KJQ B;  1ZEB A;  2F8H A;  1HBN B;  3GWC A;  3KJV A;  3IBF B;  3PR5 B;  1S9E B;  3WZ0 A;  4CLY A;  1N6Q B;  2R7O A;  1R8H A;  3SEO A;  3O3L A;  3HHL D;  2CZV C;  2GO8 A;  3HHD A;  2ANH A;  3ONQ A;  1EW8 A;  4QIG A;  4K2J A;  1D9D A;  2UVV A;  4DV5 F;  1ZOT A;  4WBF A;  4DV3 F;  1XIQ A;  2YQ1 A;  3UFC X;  3VAL A;  4DHV A;  5L0B A;  3GSD A;  5AXL A;  2AP6 A;  5HVF A;  3VGU A;  5GAG U;  3BSC A;  1AFJ A;  1EET A;  3UCG A;  5DET A;  1NM2 A;  1C0T A;  2FVS A;  1U6F A;  2ZFH A;  3AD8 C;  4DUT A;  2E9T A;  2OFG X;  3BO4 A;  3ZZ0 A;  1IKY B;  2WOM B;  3K8V A;  1JLC A;  2AF6 A;  1R0B G;  1DBD A;  3P5B P;  5M2U A;  4MK9 A;  2GQ2 A;  1KLN A;  1JXV A;  3G8Q A;  2I1R A;  2N3L A;  5CYM B;  3VZH A;  4NLG A;  1HBM A;  4C0B A;  2B56 A;  2MXY A;  1GMV A;  3T1A A;  2UXB J;  1HWJ A;  3SDE A;  3BO3 A;  5DLT A;  3WAV A;  2MQN A;  1EP4 B;  2YX1 A;  1GEH A;  4P71 A;  4A8Y A;  5GAD I;  3C46 A;  2HHS A;  1PIL A;  3Q8U A;  4QPT A;  1MMD A;  2QZ8 A;  4L3N A;  2E5L F;  4WK1 A;  2U2F A;  3HKZ D;  2UVR A;  2IVY A;  2HAF A;  1ULR A;  3EGV A;  4JP8 A;  4JI6 F;  1RT1 A;  3S1T A;  4B3O B;  3I5C A;  1RTZ A;  4DL0 C;  4EUV A;  1E6V A;  2BEF A;  2WVE A;  1YSJ A;  3NBP A;  2BW7 A;  3TRG A;  5HN0 A;  4NA1 A;  2HFN A;  3CCJ S;  3HK2 A;  1OPZ A;  2AEJ A;  2WB4 A;  3HZG A;  3PDN A;  1VHI A;  4Y00 A;  3O1L A;  4DUZ J;  3PHE A;  1WC0 A;  2GGP B;  2OPP B;  2EFG A;  3H5S A;  1HD0 A;  2PGC A;  3MMC B;  3MFH A;  1JJ4 A;  4JV2 A;  1E2S P;  1C0U B;  1DY3 A;  4UPK A;  1NUE A;  2XMJ A;  4M5J A;  3P8B B;  3OTO J;  1B0V A;  1TFY A;  3VCD A;  3MEC B;  5A76 A;  5DDQ C;  1NJY A;  3V6D B;  4A46 A;  4X4T A;  2XYH B;  3EGW B;  3ENA A;  2Y1J A;  2H4Y B;  1R6Y A;  2X7I A;  4MKV A;  1GK8 A;  4OYZ A;  4RBU A;  2RF2 B;  1NO8 A;  3DGV A;  2FB0 A;  2ZH4 A;  2VFR A;  4OMF G;  1WKK A;  4C8K A;  4W92 B;  3G8S A;  5H9F J;  2RH3 A;  2YXL A;  1KD1 T;  4B02 A;  1NU4 A;  3QQC D;  2V5H G;  2Z30 B;  1K7H A;  4JB8 B;  4CT9 A;  2W4D A;  3R7B B;  1FEE A;  2K2P A;  1L3U A;  2V8P A;  1SC6 A;  2CQC A;  4OZ2 A;  5J2P B;  4N77 A;  2W8D A;  1S77 D;  1RT4 A;  2FY8 A;  3SFG A;  3K89 A;  3RB6 A;  2JL9 A;  3M2V B;  4ZDN A;  3PCO B;  3AOA A;  1GMW D;  1ACM B;  3LGH A;  4B9U A;  5KFC A;  3MD1 A;  3W65 A;  2BAN A;  3FC9 A;  4OX9 F;  5GAG I;  4IO9 Q;  1PBA A;  1RCO B;  2C2M B;  4ED8 A;  1VQ8 S;  2J6T A;  3GII A;  1DHM A;  3KFW X;  1RWO B;  5EHH A;  1N0U A;  1JLA B;  3GIM A;  3PZP A;  3WBZ A;  2DNO A;  3J7Z 5;  4DFJ A;  3NNA A;  3C14 B;  4NEY A;  4DR6 F;  2R42 A;  3BF4 A;  3TP2 A;  3GJR B;  1AFI A;  1HD1 A;  3US5 A;  1PYO B;  4Y3C A;  1NH7 A;  3DCA A;  2Q66 A;  2JVR A;  4WTY A;  1TKT B;  4JI2 J;  3NGS A;  4KH0 B;  1ZA2 B;  4B3T F;  4X4P A;  2CZ9 A;  3DDK A;  2NRE A;  3ZTP A;  5F3Z A;  3A3N B;  2CG8 A;  2Z8Q A;  4PG8 A;  1VJQ A;  3KG1 A;  5HI7 A;  2YVS A;  5DS7 A;  3KHL A;  1HYS B;  3R2D J;  1KS2 A;  2HK2 A;  1U26 A;  4G6V B;  3PIO Q;  1MML A;  4ERD A;  4DU8 A;  2OML A;  3PEH A;  1LV5 A;  4NXM F;  4IUF A;  4ZIW A;  2IFX A;  1RT1 B;  2OI2 A;  3KHH A;  1K9M T;  3ITH A;  2BQU A;  4B3O A;  2DH8 A;  3OR2 A;  3T6B A;  2RHS B;  4O3Q A;  3H4B A;  3DM2 B;  4ECU A;  2VG7 B;  2IA6 A;  1K0T A;  4TU8 A;  2UUB F;  3MMB B;  2GFF A;  3MM7 B;  2Y8Y A;  2AYM A;  2DGT A;  3EUN A;  4I4B A;  1NHV A;  3KLG B;  4NMX A;  1SHN A;  3G2X A;  2HLT A;  3MM8 B;  2BE9 B;  3C3L A;  2W7O A;  3GON A;  2J0Q D;  3CWJ A;  4KJD A;  1F9F A;  3CDW A;  2F4V F;  1RK8 A;  2GVZ A;  4H4O B;  5HBM A;  4MYT A;  4PWU A;  5D4L A;  1IUJ A;  1EQ0 A;  4ZS6 A;  3D0I E;  2WVD A;  2PD1 A;  2FC8 A;  4DU7 A;  1GFW B;  1SH2 A;  3SCK E;  4EYI B;  4TLR A;  1TMM A;  1FVS A;  2F63 A;  4HKQ A;  4B9S A;  3UPF A;  1MG7 A;  2CPD A;  1RJJ A;  2VQE J;  2CJA A;  1WWH A;  3DU6 A;  3RR7 A;  3CUL A;  2LDY A;  2C3U A;  1NPK A;  1TTH B;  2YQ0 A;  5D0H A;  2N3O A;  1UWB A;  4J9P A;  3NGK A;  3W5Z A;  3G9C A;  2CPF A;  3DHW C;  1ARO P;  1FDN A;  1JLE A;  4FBT A;  5C24 A;  5L1J A;  1FTC A;  2F40 A;  5GAD U;  2GSU A;  4M5D A;  4IQM A;  4I67 A;  3VGS A;  1CJV A;  1VBK A;  3EXY A;  3G82 A;  3LP0 A;  2MST A;  2DR6 A;  2IYI A;  3P5T L;  3PX6 A;  4DSL A;  1RWX B;  2MZJ A;  4DS4 A;  1JLF A;  3DMJ B;  2F3J A;  3UDV A;  1Q86 T;  5HAT A;  2FGC A;  4C8L A;  1OQ3 A;  2BM0 A;  2IBO A;  2G9Y A;  4IRD A;  3C14 A;  2L3M A;  3D28 A;  4O44 B;  3GB0 A;  3LAL A;  2C2D A;  4UQT A;  4B9V A;  1ZYQ A;  2V6A A;  4LF1 A;  2PE8 A;  3I6P A;  4ALZ A;  4DV7 F;  1YWX A;  3D68 A;  4Y65 A;  4P2X A;  4JI4 F;  4O3P A;  4R25 A;  3PX0 A;  1TK8 A;  3R97 A;  3DU5 A;  4HVZ A;  3KLV A;  4F4X A;  2L48 A;  1U8W A;  2N7C A;  4TY9 A;  2FPH X;  4FS2 A;  1GX6 A;  2WSF C;  3C15 A;  4AD6 A;  1ZA1 B;  2UUC F;  4DR4 F;  2VON A;  4L74 A;  1TKZ A;  1HDH A;  1YBT A;  3B5Q A;  2E7V A;  1RWK B;  2OGU A;  3OVS A;  1QUV A;  4B9L A;  4EU0 A;  3KJF B;  3LP2 A;  1TUV A;  3DM2 A;  4LSZ B;  3CXC R;  4U95 A;  1FDA A;  1RAB B;  2M4M A;  4B3R J;  1QAJ A;  3UO0 A;  3MXH P;  5KFN A;  1HQE A;  2JX2 A;  2IVF B;  4DFK A;  5AE3 A;  3BN4 A;  4LBP A;  3SV4 A;  2C28 A;  2KFY A;  3DRR B;  4DPW A;  5L46 A;  2HRT A;  4RUB A;  4OL8 A;  1T9Y A;  3R1H A;  1UVJ A;  2ZBI A;  1YZ6 A;  1R0A B;  3M8P B;  4NLQ A;  2HIQ A;  1TL1 B;  3E51 A;  1TR0 A;  2AJ1 A;  1RCX B;  2MQM A;  3HFV A;  4O0N A;  4QIV A;  3CME S;  2KHC A;  5HMY A;  4AL5 A;  3MEK A;  3RR8 A;  2B9E A;  1M5K C;  4F02 A;  1QAI A;  4WFA Q;  4PQU A;  3CMR A;  3IGZ B;  4GO5 X;  5EGH A;  1WTB A;  3NLC A;  4DPT A;  5D8H B;  5ETV A;  3NAI A;  4USW A;  2D3Z A;  2G0J A;  2HBR B;  2L41 A;  1TL4 A;  2XI2 A;  3QIP B;  5THW A;  5B7W A;  1N5V A;  1OJ4 A;  1A7G E;  2CKW A;  2OPR B;  3HUL A;  5K8N A;  4IG0 B;  2VIH A;  2VPW B;  4YN3 B;  1V5V A;  2GVZ B;  2VH7 A;  4MK8 A;  2L9W A;  2YPZ A;  1PO6 A;  1LWC B;  1T11 A;  4LQ9 A;  5MAO A;  4F4K A;  1IVZ A;  3D6F B;  1Q4R A;  4MIA A;  3DOK B;  2RJZ A;  3TNV A;  2FVR A;  5IQ6 A;  1XQI A;  1S1W B;  2QA4 G;  4TYB A;  3H98 A;  1KDN A;  5C42 B;  1F9E B;  1BQM B;  1C4C A;  1NH8 A;  1H0H B;  3JTN A;  4PR6 A;  2KM8 C;  1U1L A;  3A8K A;  1SQE A;  4RW8 B;  4K4S A;  1V5I B;  3UD4 P;  2HHH J;  2KTQ A;  3OR2 B;  1WUU A;  2CQB A;  2KT5 A;  1X4B A;  3HSZ A;  5DLW A;  5A8W A;  3TUP A;  2JVO A;  1H73 A;  2Z2L A;  3HZE A;  2QG9 B;  3L7O A;  3HVR A;  1KLM B;  3A52 A;  4FDI A;  2BX6 A;  3DMJ A;  1HWL A;  3EGN A;  3KLF A;  3QNW B;  2ZKT A;  2HFV A;  3P4U B;  4DUY J;  2HFZ A;  4Z7C A;  3R8Y A;  4IFV A;  1N0V C;  3W62 A;  1HJK A;  1T05 A;  4JI3 F;  4K5S A;  1UP1 A;  4NLD A;  2CQH A;  1F2H A;  2CNL B;  4YDX A;  2VPY B;  2MKS A;  1QAY A;  2HG4 A;  4H54 A;  4KGZ B;  4TLQ A;  4X4N A;  3KJV B;  2UXD F;  3V5R A;  1S9E A;  4PXE A;  4BC7 A;  4RNF A;  5LJ5 Y;  1N6Q A;  2P5V A;  2HVE A;  1UTA A;  2KVQ E;  4B3S F;  3MCS A;  5F41 A;  1XR6 A;  4CRJ A;  1RWN B;  1Y7P A;  3EWG A;  3W2W B;  1FXL A;  3W63 A;  1CJU B;  1JJC B;  3ILJ A;  2RQK A;  1KR4 A;  1SKU B;  3M2U A;  5FDL B;  1UVM A;  3OFE A;  2HGL A;  2MLX A;  3KDN A;  1YJR A;  4JI0 F;  1KFS A;  2MZS A;  3M8Z A;  4DX8 H;  1RDR A;  1FD2 A;  2VPZ B;  1YJW S;  4OX9 J;  1RA6 A;  2R7U A;  2JEG A;  1VQP S;  1M1K T;  1P1L A;  3AQO A;  4CH7 A;  4N8O A;  1IBM F;  3SCI E;  5CCL A;  1LW2 A;  4HH0 A;  3CD6 S;  3BM7 A;  3U02 A;  2G2Z A;  1WC4 A;  4O44 A;  5DO2 A;  3WHI A;  2LQJ A;  1T8E A;  4LFB J;  4JI1 F;  3WAW A;  4P10 A;  1JLC B;  1TAQ A;  2CPI A;  2DXE A;  4ZJQ A;  5C2C A;  2NYI A;  1PSD A;  2XS2 A;  1YJV A;  5ETO A;  4P9S A;  4PQU B;  1SHQ A;  5L0K A;  1IWG A;  2J0X A;  2JSX A;  4XO0 A;  4K4Y A;  4R8U A;  3ENW A;  3PKM A;  3MCM A;  3OTB A;  2OD4 A;  3MI7 X;  4QWD A;  5DJB A;  3TAR A;  3FBB A;  2FLO A;  5KG5 A;  3R9L A;  4J9M A;  4QAX A;  4DS5 A;  5A0Y B;  3BRE A;  1LXN A;  4DF8 A;  3SSS A;  4K4X A;  2UUB J;  2W5R A;  1HQE B;  2XM3 A;  5IXU A;  3HVW A;  3M8Q B;  3H7H B;  3PIP Q;  2BAC A;  1TMJ A;  2PFD A;  4F04 B;  3BDE A;  1XTZ A;  4ES1 A;  3W64 A;  1KHJ A;  1LWE A;  2FJE B;  2IM2 A;  1TQL A;  3FKB A;  4PXB A;  2RB7 A;  2XWX A;  4WKY A;  5HMZ A;  2K3K A;  2RH6 A;  3RB4 A;  1FKO A;  1FVQ A;  5IV4 A;  3OHB A;  4DQQ A;  1LKZ A;  2DNN A;  3S7R A;  2OJ3 A;  1OS5 A;  2FC9 A;  2GSO A;  1VRU A;  3NOC A;  3WX8 A;  1FJG F;  2B6A A;  3J7A 1;  4CNY A;  4Y2A A;  4K2X A;  4LF5 J;  5IFM A;  5F9N A;  2AU0 A;  2EKN A;  1JLG B;  2IC3 A;  3ETM A;  4ZVT B;  1RAC B;  2HVD A;  3GTY X;  3KUG A;  5B0G A;  2GAG C;  3NRB A;  1B70 B;  3E3X A;  4DR5 F;  4WF9 Q;  4JI2 F;  1HI8 A;  3MZI A;  4ENO A;  3AH6 A;  4NCG B;  1B0T A;  3KTQ A;  4DOZ A;  4RW6 A;  5K20 B;  4FPR A;  4X62 F;  1MSW D;  1IWA A;  2QL9 B;  2EFV A;  2W8L A;  1EJ7 L;  1K47 A;  2QMU B;  3VAF A;  1RU2 A;  4X4Q A;  3DXB A;  3QAU A;  5K9F A;  2EFQ A;  1OPI A;  1VQM S;  5LXY A;  4OI1 A;  2HMI A;  2KH9 A;  3HHE A;  2VBZ A;  2FLL A;  2DNH A;  3H5Y A;  3K0J A;  2DPI A;  7FD1 A;  4M5G A;  1S7I A;  4YR0 A;  2DXF A;  4AXI A;  1RQ0 A;  2RS8 A;  2EBG A;  2HWI A;  3TX0 A;  5A8W B;  2HNZ B;  1G7C B;  3RTV A;  3QO9 A;  3KDO A;  1LW2 B;  2WW4 A;  3JAM U;  2RT3 A;  2DHH A;  4TY8 A;  3QJJ A;  1FX4 A;  2ZOM A;  5ETK A;  2VBW A;  1ZED A;  4RO0 A;  4IG3 B;  1VQ5 S;  1M5S A;  3GFX A;  5KFZ A;  2DY9 A;  2XMT A;  3NXZ A;  3HSJ A;  2EWH A;  3J7Y U;  1S9F A;  2IJN A;  2DBB A;  3R2C J;  4ECZ A;  4QW9 A;  3NS5 A;  3M2R B;  3CMA S;  2JEJ A;  1DLO A;  2J0W A;  3D6T B;  3CCT A;  2MZQ A;  4KV8 B;  5HSP A;  1C1B B;  2XO7 A;  1T03 B;  1RT4 B;  4J9K A;  4AL6 A;  4N8N A;  3DYC A;  4L73 A;  2J9C A;  1M5O C;  1VQY A;  1WEL A;  3IWX A;  4F2S A;  4UPI A;  3H5X A;  3JXO A;  4WFB Q;  1S9G B;  3DRP A;  4J9Q A;  2YKM B;  4EZ9 A;  5AXK A;  2FVQ A;  4ZPC A;  4NLV A;  3ZTS A;  3ITH B;  2M9K A;  4RX6 A;  1TP7 A;  3RGI A;  3JSY A;  1J2V A;  1NDK A;  1AUD A;  4CYU A;  3QRR A;  2KFN A;  2DR7 A;  3MAQ A;  1H98 A;  3CO9 A;  5HAO A;  2M3D A;  2RAQ A;  3K2Y A;  1W2B R;  3CED A;  2Y0B B;  4ZPD A;  1JKH A;  2ZUA A;  4PAB A;  1Z1Z A;  4LF8 F;  1M0S A;  2VOP A;  2K7J A;  1U48 A;  1SH3 A;  1HA1 A;  1MN7 A;  3EDR B;  3TA2 A;  2QSF A;  1SL1 A;  2F5G A;  4NLW A;  5E33 A;  3N0V A;  1O6X A;  3KK2 B;  1TKT A;  5LMN J;  1HKA A;  3T5H A;  1WNE A;  4OYW A;  4DPY A;  3G6E S;  2EVZ A;  3M9O B;  5CXT A;  1A9N B;  1WF1 A;  1BQN B;  4RWX A;  5DLV A;  2FIU A;  1T9W A;  2E29 A;  1ANI A;  4R5P B;  1Q8L A;  1UET A;  4ECW A;  2ZWO A;  5HMW A;  2WVF A;  4ES2 A;  2N7Y A;  2VD3 A;  2EG1 A;  1U45 A;  4M8L A;  2W2M P;  3WC0 A;  3KOA A;  3R3T A;  4PEO A;  4CIO A;  1YDL A;  4B9M A;  2GIF A;  2V8G A;  1HWI A;  5D3G A;  4IO1 A;  1R89 A;  1P49 A;  2QX0 A;  1Q5Y A;  4DR7 J;  5K8M A;  3DXS X;  1Q7Y T;  2LEA A;  4B9N A;  1CS4 B;  4X66 J;  4DQS A;  1WEY A;  2OPQ B;  3MMB A;  3W8G A;  5INH A;  4Q8F A;  3J80 U;  1FKO B;  5B0E A;  3KLH A;  1RAI B;  1KHN A;  3IR5 B;  3ICL A;  1FER A;  4M5I A;  5GAE I;  1WSV A;  1NKB A;  2W8S A;  3FFI B;  4L6V 3;  4FYX B;  2IYG A;  2V4R A;  4DLG A;  5HRO A;  1GTH A;  2DD8 S;  2MDA A;  1H38 A;  1UFW A;  1TL3 A;  3V4M A;  2FHK A;  2ATC B;  1AXQ A;  1RT6 B;  2Q1L A;  2VBX A;  2MPU A;  3AB2 B;  1VK8 A;  2L08 A;  1T0T V;  1VRT B;  1FF2 A;  5CHC B;  1MN9 A;  5HP1 B;  4KY3 A;  1DAX A;  4X4U A;  1KRP A;  5CAA A;  2DGU A;  1QE1 B;  1N52 B;  1UAW A;  1NZ8 A;  2KYZ A;  3MPW A;  1TL7 A;  5SUH A;  5LM7 E;  3H8Y A;  4OJ1 A;  4JI6 J;  1FRM A;  2AW0 A;  2PSZ A;  2HNY B;  3N4W A;  1UWB B;  3Q8S B;  4UY8 T;  1B0P A;  2QYG A;  1SI9 A;  3NCP A;  1VIS A;  2G2Y A;  3GV5 B;  2GA3 A;  2BBE A;  2A18 A;  4C97 A;  4USJ C;  4NXM J;  1KOH A;  3LP2 B;  4X65 J;  5JVH Q;  3N28 A;  4CYU B;  2CVE A;  2MZR A;  1DFD A;  1T9T A;  2B4U A;  4DJB A;  4FNH A;  4DQR A;  2Q6B A;  2DGV A;  2YKM A;  1YQH A;  1HQU B;  1X5S A;  5HJX A;  3T9Z A;  3P45 B;  2FJX A;  2Z58 B;  1KEK A;  4I6A A;  3S6E A;  3MR5 A;  2IM3 A;  3E01 A;  1FNO A;  1N5Q A;  3IC1 A;  3OXG A;  4QQB A;  1N56 A;  4WIQ A;  1FK9 B;  1K44 A;  4K4V A;  5HMX A;  1OY6 A;  2C22 A;  2GC8 A;  2YWH A;  2RNE A;  1X5T A;  4Q2L A;  5F8J A;  2AYG A;  2VJU A;  1YVF A;  2UUW A;  2MKH A;  3I56 S;  2R8G A;  4DG1 A;  2W8K A;  4M63 A;  4R5P A;  3KMS A;  4UOO A;  2IMW P;  2CWX A;  3KLE B;  4JV0 A;  2B5J B;  2XMU A;  4I69 A;  3GIK A;  2IBK A;  2IDE A;  4DPO A;  3CDA A;  4IG0 A;  4C8M A;  2BRL A;  1P27 B;  4A4J A;  2E5J A;  1R8A A;  4NRU A;  4F4Y A;  2Q43 A;  3MPY A;  3GFH A;  2Y0S D;  4OHX A;  1UJ5 A;  3S8S A;  1UVL A;  2Z57 B;  3IRX B;  1PAU B;  2NCK L;  2FD2 A;  3OXL A;  1KH5 A;  1E6V B;  4LR8 A;  1EKS A;  1Y10 A;  3EPI A;  2RE1 A;  3WIU A;  3NNH A;  1PGZ A;  2K06 A;  4EYH B;  2ZWP A;  2CQI A;  1M90 T;  3N6N A;  1NSK L;  4EO8 A;  4WU3 A;  3M8S A;  5J1P A;  3N01 A;  2EXU A;  2F7V A;  4A8W A;  3GYN A;  2R7S A;  3HJV A;  1RHM B;  1I94 F;  1FXD A;  1S6P B;  4L72 B;  4GKJ J;  3PG9 A;  3D66 A;  2ZOG A;  3N79 A;  4WJB A;  4CXK A;  4J7C A;  3SDE B;  2O67 A;  4PYD A;  1RKJ A;  3BQ0 A;  4G1I A;  3AAW B;  1CEZ A;  5HRO B;  1ALJ A;  3T5K A;  4C11 B;  1QVG R;  3Q22 A;  1S1U A;  2QLF B;  1D9F A;  2BE2 A;  2L9D A;  1URN A;  1VCT A;  4N47 A;  3UVJ B;  1X4E A;  1YRT A;  1N36 J;  4PCQ A;  3CIM A;  3SSQ A;  1VQO S;  4ZJL A;  3W1Y C;  1U0S A;  3Q8P B;  4OX6 A;  5KOX A;  5JMN A;  1NJI T;  4YQW A;  1ED8 A;  2V34 A;  2G13 A;  3D0H E;  4L76 A;  4PXD A;  1AA1 B;  5EWF A;  2XTJ P;  1RP5 A;  1UW9 A;  1C0U A;  1UEV A;  4K5R A;  3I5A A;  1NSP A;  1ZZF A;  2YNG A;  4WFX A;  2DEI A;  3U1N A;  2CDR B;  1FWL A;  2YX4 A;  4QR1 A;  3VF0 B;  2OSR A;  1S6O A;  1H2V Z;  3V6D A;  2JRS A;  3MED B;  5J2N B;  2BQR A;  3RW6 A;  2ZIT A;  3L9Z A;  3R27 A;  4E98 A;  1FFG B;  3CVK A;  3O5T B;  1FRH A;  1HW9 A;  3POT B;  4ANE A;  1O51 A;  5DM7 Q;  2HHT A;  4IFV B;  1CJK B;  5EWE A;  2O1P A;  4CLT A;  1TL3 B;  1RT3 A;  3PVX A;  3MK1 A;  1RT6 A;  2W1B A;  3IA0 A;  4DG1 B;  2HVZ A;  2NPF A;  4J9O A;  3J7Y I;  3R7S B;  3MOJ B;  3PNI A;  2B8P A;  4KO0 B;  4DCP B;  4KE5 A;  3UCZ P;  1BMQ B;  2V4Q A;  4ZLN A;  2EC0 A;  2UUA J;  1OSC A;  2WON B;  4RJV A;  3M2V A;  2LYV A;  2CFX A;  2QN6 B;  3BSA A;  3MMA B;  4HI2 A;  3OSP A;  1IKX B;  2QFI A;  3IGN A;  1VOM A;  4O4G B;  2X3G A;  1ZPV A;  3EM1 A;  4PWW A;  4IFY B;  3JQM A;  3BJY A;  2BZ2 A;  2DEJ A;  4RR5 A;  1Z2Z A;  3CIZ A;  4M5L A;  3MR3 A;  4N76 A;  1AW0 A;  3BH6 B;  3IG1 A;  1R31 A;  3DHX A;  1RE1 B;  4FVC A;  4Y2C A;  2UU9 F;  3NKR A;  4LSN B;  2QC3 A;  1PYT A;  4ID8 A;  3ULH A;  4WKR A;  2ACY A;  1Y7A A;  3OJU A;  1HMV B;  2MQ8 A;  3KJN B;  5KFE A;  1Y3K A;  3BPS P;  3ZZY A;  2JDJ A;  1S0N A;  2HAI A;  2DB1 A;  4DV2 J;  1UZD A;  1LWE B;  1HNW F;  2DT9 A;  2Y1I A;  4JI1 J;  2E5I A;  2XS7 A;  1SJ1 A;  5J1E B;  4PWD A;  1C1C B;  2XCA A;  1KHW A;  5LXR A;  5M2P A;  2ZE2 A;  2VPX B;  1JXL A;  1WC6 A;  2VUG A;  3OFH A;  4CI0 B;  4YB5 A;  4CLP A;  1HIY A;  1UWA A;  4ZVR B;  4A47 A;  1VC0 A;  2BJE A;  2F4V J;  2VU5 A;  5LSR A;  3I96 A;  3TR5 A;  2VFV A;  3I9V 9;  2F4F A;  2CPX A;  2NXU A;  1NPP A;  2XMV A;  2H9Z A;  3M8W A;  3VQT A;  2DNQ A;  3PYF A;  5T7L B;  3RB3 A;  1FJ7 A;  4QR0 A;  4RW6 B;  1URB A;  3HHL C;  2ADB A;  2OEJ A;  2GCF A;  1RAF B;  3HCX A;  3HT0 A;  1WOO A;  2V94 A;  3BR8 A;  4LJM A;  2IA0 A;  2PC6 A;  2ZDO A;  4V1A k;  1UEK A;  1X4A A;  3WQP A;  5C5J A;  2FVP A;  3HO1 A;  2EI5 A;  2YWW A;  4DL7 A;  1U25 A;  2BA9 A;  2P9G A;  3AJ2 A;  4XIU A;  4NL5 A;  2YNH A;  1HNV B;  3KK1 B;  3D1O A;  1LWF B;  1RA7 A;  4YHH F;  1YRU A;  2CPY A;  2C2O B;  2N4C A;  3VAM A;  4OYM A;  1SKR A;  1VR6 A;  2LDI A;  5B09 A;  2HS3 A;  3HM9 A;  1U8S A;  2Z4P A;  4NA2 A;  1N5T A;  2CJX B;  2ILY A;  3LQV A;  3QWU A;  4CNZ A;  5ITH A;  2W9B A;  5G0R B;  4MK7 A;  3GV7 B;  4LR7 A;  3BGR B;  2RQM A;  1ALH A;  2V8H A;  1U6Z A;  2RDI A;  1N2L A;  5KFW A;  3DDI A;  1SKS A;  3HVT B;  2HS0 A;  3QRP A;  2CAD A;  1TKD A;  4B9T A;  2YKN A;  3QYY A;  5H9E J;  4FZV A;  2XYG B;  3R5D A;  5HAN A;  3HJF A;  1BHN A;  1CUL B;  4ZPV R;  3F73 A;  3X1L B;  3JTP A;  4GVB B;  4N7T A;  4JUZ A;  4ZLL A;  2YWE A;  2XMK A;  4NLO A;  3D3C J;  4G1Q B;  2RVJ A;  4ZOS A;  3TYT A;  1HQ2 A;  3QT5 A;  4KO0 A;  2R7V A;  4AFF A;  4RUA A;  2ABY A;  4OJH A;  3DRY A;  4NYO A;  3W61 A;  4FDF A;  4JV5 F;  1D0E A;  4OV6 A;  3QGI A;  4N5S A;  4C4W A;  4Q5V A;  4F4A A;  2V2Z A;  1LXJ A;  3I5B A;  2E7W A;  1VBZ A;  3F56 A;  1WI8 A;  4GC6 A;  4ECT A;  1DTT B;  1X4H A;  1YBA A;  3D7S B;  1SIW B;  4WWS A;  4NWJ A;  3M8R A;  3LAK A;  4B08 A;  2KB2 A;  1WOS A;  3LOU A;  4W90 B;  2CUY A;  4PWD B;  2XS5 A;  4CWB A;  2ATL A;  1FE4 A;  2YNG B;  2DTJ A;  1R8C A;  3TZY A;  2QA4 S;  3V6K A;  2H1Y A;  3R5J B;  5EDW A;  4DF4 A;  4X4S A;  3LXQ A;  4ILR A;  4IOB A;  5KT7 A;  2DNM A;  2W9A A;  4A8F A;  2HHV A;  4K4Z A;  2ASY A;  1QJH A;  1CLF A;  2IMO A;  3C15 B;  4HTI A;  4ICL B;  2YNI A;  1VMB A;  4U7C A;  4K4W A;  1F60 B;  4DFM A;  4YB7 A;  5KFQ A;  2PDA A;  4ZLP A;  2MTL A;  4UW2 A;  2X1F A;  3CGI A;  3H90 A;  5KT3 A;  1IKX A;  5D0R A;  3SZZ A;  4DV1 J;  4QWA A;  2W2N P;  1UKU A;  3GZ7 A;  2HQI A;  3ZXW A;  3CCZ A;  4NLY A;  4YME A;  5DDR C;  2FGO A;  3ZZZ A;  1ZM2 A;  1Q8K A;  2RU9 A;  3Q23 A;  1VQ4 S;  2UUA F;  2CXE A;  2QLJ B;  2W4C A;  3M8P A;  3MMA A;  1SJ3 P;  1T9X A;  2UVU A;  3LPE A;  4RNN A;  2Q79 A;  2UXC F;  2OKQ A;  3M30 A;  1MW7 A;  4ZPB A;  3BYR A;  3DRR A;  3ILI A;  4C8Y A;  1RAJ A;  4DV5 J;  1UFL A;  2HRU A;  2P9C A;  5T7L A;  2B7B B;  3PAC A;  3SFU A;  2OPP A;  2RKI B;  1WF2 A;  1RT5 A;  2R9L A;  3TEH B;  4Y2I A;  1FXR A;  4DR1 F;  4ED0 A;  2BDP A;  5CA5 A;  1FJG J;  4P74 A;  3QJP A;  5A8K B;  2ASJ A;  1IBK J;  1PC5 A;  3FSI A;  2OMO A;  3AD9 C;  1EET B;  4A8O A;  4GC7 A;  1D8Z A;  1KLM A;  4GO7 X;  2AGO A;  2FLN A;  1RTI B;  5KFT A;  1S49 A;  2H5J B;  3QZ7 A;  4NEZ A;  4NX9 A;  2YWF A;  5JVG Q;  3H20 A;  2XY7 A;  1X0F A;  4HDH A;  3NMR A;  3NKP A;  2OSQ A;  5EGE A;  3CB4 A;  1HHT P;  3CD0 A;  3AT1 B;  3GQC A;  3J7Z T;  1S99 A;  4KFB A;  5KFY A;  5J1E A;  1RU1 A;  4CLF A;  1Q81 T;  4UOR A;  4U8Y A;  1UVK A;  1MRO A;  5G0R A;  3L7U A;  4NWB A;  4C2M A;  2C2R A;  2Z2Y B;  3B8H A;  3CCR S;  2VIC A;  1FO1 A;  1HPZ B;  2NSB A;  3DLE B;  3DOK A;  3OSN A;  1HI0 P;  1S79 A;  2CG4 A;  3DOM A;  1IQZ A;  3BGO P;  1F9H A;  1PG5 B;  1RIS A;  2EFO A;  1XWL A;  2BV3 A;  4YY3 J;  2FZC B;  4DLE A;  3SMZ A;  4F4Z A;  1KQS R;  2XSJ A;  4XK8 C;  3BDH A;  3I87 A;  1NK7 A;  1LFP A;  1Z4U A;  2FZG B;  4AND A;  5GAH I;  4X4R A;  2R2U A;  4GKJ F;  2LP4 A;  3K57 A;  1FWP A;  2RHQ B;  1WOR A;  3MPV A;  4CO4 A;  4MKY A;  3I82 A;  3Q8Y A;  1ZH5 A;  2LFV A;  1AZS A;  3TWZ A;  2VOO A;  1IR1 A;  1MMN A;  3MM5 A;  1NSQ A;  1JB0 C;  2R7R A;  4ZG6 A;  3A3P B;  1UEU A;  1NME B;  1VQ6 S;  1PAE X;  2EFN A;  4CLL A;  1CVJ A;  2KJW A;  4JBC A;  2WRM A;  4USV A;  2J9D A;  3MUT P;  3IN5 A;  2VHG A;  2BVZ A;  1I3O B;  2B9Y A;  2M7S A;  4ZN3 A;  2UVW A;  1VRQ C;  1OSD A;  3AHP A;  5CZX A;  3K8W A;  4AE5 A;  4E2F B;  3NKM A;  3TAM B;  3RYL A;  1VRT A;  2UP1 A;  4LQY A;  2XZT B;  1CUL A;  3BGR A;  3PHT A;  1RWM B;  1SC3 B;  4OZ1 A;  3VQS A;  2F65 A;  4PRF A;  2DK2 A;  2VJV A;  3FNN A;  3IAM 9;  5KFR A;  3CCE S;  3PO5 A;  1EX8 A;  5GVQ A;  5A2Q U;  5K4P A;  2GHV C;  2D9O A;  1NPR A;  2PEB A;  2UUT A;  3CJT A;  4K7Q A;  2HHH F;  4KGX B;  1S57 A;  5IT9 Y;  1JNZ B;  2AIR B;  1LW0 A;  1W2I A;  3VWS A;  2MKI A;  1QSL A;  4M5H A;  4PPD A;  2W5T A;  2VKR A;  3JS9 A;  2OPS B;  4KHP F;  2C3Y A;  2AYE A;  1RUS A;  4OI6 A;  4MIV A;  3MDF A;  4RW9 B;  7AT1 B;  2HYI B;  3MM8 A;  4KKO A;  5LSL A;  1K1S A;  1FCA A;  1SKW A;  2C1E B;  3LUY A;  2XLK A;  2HFU A;  4XDD A;  2R2R A;  1EKR A;  4B3M J;  4MYU A;  1Y6V A;  1URR A;  3KHG A;  4R0J A;  5J2Q B;  1XJW B;  2CNK B;  2D1C A;  2YNF B;  1G6B A;  3RBZ A;  1ZM4 A;  3BBC A;  1S10 A;  4NZ6 A;  2LXI A;  2VL1 A;  2V4J A;  1EZZ B;  2NXC A;  2ZJP Q;  1HNW J;  3RZA A;  3Q8R B;  2OD6 A;  3CCQ S;  1KQK A;  1R3N A;  2KRB A;  3DLJ A;  2XCP A;  4CDI A;  3GG0 A;  3MM6 A;  5KT4 A;  1QLN A;  3DNC A;  2Z56 B;  3NGT A;  4OZL A;  1YJ9 S;  4JI8 F;  1BD6 A;  3BQ2 A;  3GYG A;  1XNQ F;  3DLL Q;  2P9E A;  3D9B A;  4C0H A;  1H3D A;  5ADZ A;  2F1F A;  5C24 B;  4MT1 A;  4DV3 J;  1QTN B;  2COL A;  1ELZ A;  2JC1 A;  1K73 T;  5HVH A;  1SL2 A;  4CYS A;  2DO4 A;  1YI2 S;  2E9R X;  1KH7 A;  3VAH A;  8ATC B;  1NB2 A;  4AYB D;  1JMT A;  2KU7 A;  3L95 X;  1JK9 B;  4ZVP B;  3JQJ A;  1AB8 A;  4ZP8 A;  1NJW A;  1KHK A;  3AOD A;  2HMI B;  4EGL A;  4DMZ A;  2E1A A;  4DV4 J;  3R5G A;  4F8R A;  2HQC A;  2JLE A;  3DRX A;  4QR2 A;  5T41 A;  1ZAW A;  5KG4 A;  4S0M A;  1HAR A;  3Q83 A;  1X4G A;  4K8R A;  4WCE Q;  2QRR A;  3SZY A;  2HPU A;  4H4O A;  5HBM B;  2A6O A;  2AD9 A;  4V19 J;  4MAK A;  4ZPA A;  4Q0B A;  4YFU A;  4K0K F;  3OLB A;  4WZQ A;  4MKB A;  3W8P A;  1KSP A;  2ZKU A;  2QV6 A;  2P2C B;  4A8S A;  4X66 F;  5ETQ A;  4C11 A;  5AXN A;  3BKU A;  4W4M A;  2BE2 B;  2QFJ A;  4MHX A;  3QFH A;  2XBP A;  1PC4 A;  5LOQ A;  1IBL J;  1EB0 A;  4DV7 J;  3WIV A;  1T9V A;  2NSC A;  2HGN A;  1NK6 A;  1F5C A;  4C0O C;  2ALY B;  2CWK A;  2RML A;  2V0N A;  2PT0 A;  2KG0 A;  3BSO A;  2VQF F;  1H74 A;  3UNY A;  2RQC A;  3R1L A;  3RRH A;  1N5Y A;  4ILL A;  2WON A;  1RHR B;  2V2V A;  4J9S A;  5DGB A;  4PUO A;  3LP0 B;  1FNX H;  2MEW A;  3MPD A;  2NQP A;  1EW9 A;  1WDD A;  4LF2 A;  2KXH A;  1DAR A;  3NS6 A;  4FP9 A;  2E5L J;  4I68 A;  5K8O A;  3V4I A;  1JLE B;  1SJQ A;  2O01 C;  5DZ7 A;  3HFK A;  2HW3 A;  1KFD A;  2CVI A;  2KXN B;  4OQJ A;  2G0C A;  1F3V A;  2CQ1 A;  4YR3 A;  3IWL A;  3N5B A;  3UN5 A;  1B7F A;  2PI5 A;  5B0F A;  3TZX A;  2EW9 A;  4R0E A;  3D54 A;  4RLE A;  3DLH A;  1O99 A;  4DQI A;  3LWL A;  2ZZN A;  1H7X A;  2MJU A;  4Z2X A;  5KFK A;  4JI7 F;  5LJ3 Y;  4RNM A;  2FHO B;  4Y28 C;  4F3Q A;  1X4D A;  4PG6 A;  4C8N A;  2ZJQ Q;  1UCN A;  5HK4 A;  3UDL A;  2HHQ A;  1LQ9 A;  2LXF A;  4KV8 A;  1GH8 A;  1N2K A;  4UUW A;  2B9X A;  3H0P A;  4TN2 A;  2JLG A;  1D09 B;  1TK5 A;  1EIY B;  3MGJ A;  1RWP B;  1KTQ A;  3RRG A;  2HGM A;  1S76 D;  1KTV A;  3BBF A;  3WAY A;  3CJK A;  5D3G B;  2BAB A;  4ZP7 A;  2IUC B;  4DZD A;  1X8D A;  1S4E A;  3JTO A;  3NCR A;  2ZNZ A;  4MIB A;  3UI3 A;  5KFG A;  3KNG A;  2DJW A;  3G82 B;  2CYY A;  3QLH B;  3NKN A;  3TO8 A;  5HO4 A;  4P6Q A;  5GRR A;  5F8G A;  2FUG 9;  5CZV A;  1SL0 A;  1G1X A;  2YX7 A;  2H48 B;  2NLW A;  5JUM A;  3FGV A;  1WTF A;  2H5E A;  4OYB A;  3TA1 A;  4ZK7 M;  2J6U A;  5GAE U;  1R0A A;  2XZW A;  4KYZ A;  1XC9 A;  3BBB A;  1NK8 A;  3T5L A;  3CC7 S;  3VAJ A;  1R7I A;  5HQM A;  4FYD A;  3Q2T C;  3MM6 B;  2XI3 A;  2HZA A;  2ZHB A;  3RB0 A;  2ZHA A;  1JJH A;  2HFO A;  3GR0 A;  5LMU F;  2UXC J;  3OBI A;  2FJV A;  2DNL A;  4WP8 A;  1RHJ B;  2V4J B;  5I3U A;  1F6T A;  2V50 A;  5KG6 A;  2NR0 A;  4JYA J;  4HLB A;  1IR2 A;  3D6H B;  3PJ9 A;  1WAC A;  2YKN B;  2VFT A;  3EX7 B;  4LSL A;  4K4U A;  5GMD A;  1SJ4 P;  1RTJ B;  3DLK A;  4MH8 A;  3LP1 A;  4ZKA A;  3K5P A;  3ET6 A;  2R2T A;  1NZA A;  1TKZ B;  1HNX J;  5I42 B;  3M32 B;  2FY1 A;  4ZG7 A;  4LF7 J;  2HLU A;  1O5J A;  4NRT A;  2EEY A;  4UT4 A;  1NK0 A;  1I6J A;  2ZVS A;  3MAH A;  2XYP B;  3A4T A;  1PCA A;  2VQE F;  2DPJ A;  2J9D E;  2J7W A;  1JNR B;  1UL3 A;  1RZM A;  4KIA A;  3GJQ B;  3G87 A;  5E0O A;  4MKA A;  4HEA 9;  1VQL S;  4LIR A;  1HNV A;  3QGP A;  2DVI A;  2RRB A;  4YDD B;  1DTT A;  1N88 A;  2LMI A;  2R7Q A;  3NAH A;  4OZ3 A;  4Z7Y A;  4ZIT A;  4X65 F;  3L3C A;  3N6L A;  2MGZ A;  3MUR P;  3L4B C;  2LEC A;  1HL6 A;  1VLY A;  2VA2 A;  4NLX A;  1E3C P;  3OLA A;  4JYA F;  1FSU A;  3AA9 A;  2QMW A;  2W01 A;  5I3Q A;  4QZV B;  1WSR A;  3TJ9 A;  1RT2 A;  1VFJ A;  2POK A;  2QA1 A;  2D69 A;  2NYH A;  2HNY A;  4J90 A;  1IKW A;  1KVJ A;  1SC4 B;  4NXN J;  1TKX A;  2QT7 A;  5DGA A;  1UVI A;  3CC4 S;  1RAH B;  2Z2M A;  1XMQ J;  5IJS A;  3JQK A;  3CJ0 A;  4H4K C;  4MFB B;  1H6K X;  4GVB A;  2LVW A;  4OJG A;  3OW2 R;  4JI5 J;  4RL1 A;  1D8Y A;  1FKP A;  2NZ4 A;  3M6U A;  2SXL A;  5DDP C;  3NCQ A;  4DFP A;  4ETX A;  2D9P A;  2ROE A;  3FUY A;  2CIM A;  2BAN B;  4OLP A;  4O0I A;  4LR2 A;  3WBH A;  2Z0G A;  2IUC A;  3DLG A;  5DQH A;  5LL6 d;  4CLK A;  3KHR A;  1VRU B;  2H5I B;  4P2S A;  2HQG A;  1SV5 A;  3E01 B;  2U1A A;  3W9J A;  3CDU A;  3M2U B;  4YHH J;  4JI0 J;  2HHW A;  3GIJ A;  5LRM A;  4ECS A;  2HSE B;  5EWG A;  3FK4 A;  2IC3 B;  1U49 A;  3OXF A;  1FDB A;  3BO2 A;  1M1H A;  1S6P A;  2MZT A;  2VV5 A;  2O3D A;  2C2N A;  2DRD A;  2EC2 A;  4FVM A;  2HBY B;  4ZP6 A;  5CYQ A;  4UOG A;  3BGF A;  1RTD A;  1ZS6 A;  2XO6 A;  1NJZ A;  2DIU A;  2NUH A;  2XUL A;  4PAA A;  3BB5 A;  3OTD A;  2HIY A;  4LSL B;  2MY8 A;  2QZU A;  5A0Y A;  1RT7 A;  2VG6 A;  3U27 A;  3NY0 A;  1IJE B;  1T05 B;  3BSN A;  2R7T A;  2V63 A;  2NS1 B;  5E41 A;  1Z2L A;  2RRA A;  3M8Q A;  3Q86 A;  3A13 A;  3M6W A;  4DL4 A;  3KNA A;  5D4N A;  2ZC3 A;  3UD3 P;  3OQ2 A;  1B8J A;  1MNE A;  1IKV B;  1RT5 B;  1YRX A;  1CG2 A;  1S72 S;  4M95 A;  1RAA B;  1WD6 A;  1I94 J;  3H40 A;  2HHX A;  4AL7 A;  1CPZ A;  4RZR A;  2JEI A;  4UF4 A;  2AZ1 A;  2LU1 A;  3H59 A;  1H2T Z;  3LAN A;  3PYD A;  4LVN P;  1J5E F;  1NRK A;  1VHF A;  3U7J A;  2IFY A;  1Q1K A;  1U1N A;  1CC8 A;  2CAJ A;  4XTT A;  3UVJ A;  1S1V A;  2EK1 A;  4UTG A;  1IBL F;  1O0P A;  5AT1 B;  3UQS A;  1MWQ A;  1RTH A;  3M1V A;  1FRJ A;  2BXJ A;  3CDB A;  4LBH A;  3VV2 B;  3J81 U;  3IDD A;  4LVO P;  3SCJ E;  1X5O A;  2WAQ D;  2RDJ A;  2W5V A;  1C1B A;  4WTO B;  1F3F A;  5F3T A;  1NBE B;  2ZOF A;  3AOB A;  2ZJR Q;  3CCU S;  4FBU A;  3DI6 B;  1WHY A;  3C8Y A;  3TI0 A;  4KPY A;  3M7V A;  4KRW A;  5DRK A;  4DX5 A;  3NKO A;  4O4G A;  4GVL A;  1N5S A;  3ZZR A;  2DRA A;  2ZZT A;  2HQ3 A;  3ILL A;  1GXL A;  4USU A;  3JYT B;  1F2G A;  2JOQ A;  4ZVO B;  2RUG A;  4NLU A;  2GVD B;  3KKF A;  3LP1 B;  3POT A;  6FD1 A;  1E6Y A;  4HTJ A;  3K5M A;  3IGV A;  3B82 A;  3CCW A;  3O2I A;  4C3M A; 
#chains in the Genus database with same CATH homology
 4ZG7 A;  2W5Q A;  3LXQ A;  2GSN A;  1P49 A;  4KM4 A;  5LIA A;  1HQA A;  1ELZ A;  1E2S P;  2XRG A;  3KD8 A;  3WBH A;  4CYS A;  4QAX A;  4UPK A;  1KH7 A;  3TG0 A;  1ELY A;  5INH A;  3NKP A;  1KHK A;  1KHN A;  1KH4 A;  3MK1 A;  4KAY A;  3T00 A;  2W5R A;  3SZZ A;  2W8S A;  1HDH A;  3B5Q A;  5TJ3 A;  1KHJ A;  1E3C P;  5L0K A;  1AUK A;  1FSU A;  1E1Z P;  4LRE A;  3UO0 A;  1AJD A;  3SZY A;  5L0E A;  1K7H A;  4GTX A;  4CXU A;  4YR1 A;  4LR9 A;  2W8D A;  3ED4 A;  2GSO A;  3WAX A;  4CYR A;  4LRD A;  4CXS A;  4LRB A;  4MHX A;  5IJS A;  3NKR A;  5AJ9 A;  1Y7A A;  3IGZ B;  4MY4 A;  5EGH A;  3CMR A;  3UN3 A;  1KHL A;  5EGE A;  2GA3 A;  3UNY A;  4ZGA A;  3NKQ A;  1EJJ A;  1AJA A;  1ELX A;  3WAW A;  3T01 A;  3Q3Q A;  4UOR A;  3UN2 A;  2VQR A;  1E33 P;  1EW9 A;  4LR2 A;  5KXA A;  2GLQ A;  2IUC A;  1KH9 A;  3IGY B;  1AJC A;  5LRM A;  1ZEF A;  3TX0 A;  1EW2 A;  3OT9 A;  3E2D A;  2W5W A;  3UN5 A;  3BDH A;  4UPH A;  3M8W A;  1URB A;  1ZEB A;  5C66 A;  3T02 A;  4NWX A;  1ZED A;  4TN0 A;  1O99 A;  4UOO A;  5DLW A;  2QZU A;  3MK2 A;  4FDJ A;  3M8Y A;  3TWZ A;  1EW8 A;  4GTZ A;  2X98 A;  3A52 A;  4FDI A;  4ZG6 A;  1SHN A;  3DPC A;  1N2K A;  2ZKT A;  5L0B A;  1O98 A;  1B8J A;  1KH5 A;  3BDG A;  4LR8 A;  4ZG9 A;  4UPI A;  1AJB A;  1HJK A;  3NVL A;  4KJD A;  3NKM A;  4LQY A;  3WAY A;  5LRN A;  4LR7 A;  2IUC B;  1ALH A;  5HRT A;  1ED9 A;  1N2L A;  1ALK A;  1EI6 A;  5K4P A;  3BDG B;  2IFY A;  2ANH A;  2RH6 A;  2D1G A;  2W5T A;  3NKN A;  5LQQ A;  4N7T A;  4CXK A;  5GRR A;  4LRF A;  1ALJ A;  4MIV A;  3IDD A;  5DLT A;  2W5S A;  3WAV A;  2W5V A;  4UOP A;  3DYC A;  4LRC A;  1ALI A;  2GSU A;  3M8Z A;  3M7V A;  1EQJ A;  5IJQ A;  1Y6V A;  3NKO A;  5GOV A;  4KJG A;  1URA A;  4LRA A;  5DLV A;  2G9Y A;  2W5X A;  2XR9 A;  4NWJ A;  1ED8 A;  1ANI A;  3BDF A;  4B56 A;  1ANJ A;  4GTW A;  4KAV A;  4GTY A;  1SHQ A;  4UPL A;  3MK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...