3MJHA

Crystal structure of human rab5a in complex with the c2h2 zinc finger of eea1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title Structural basis for Rab GTPase recognition and endosome tethering by the C2H2 zinc finger of Early Endosomal Autoantigen 1 (EEA1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 61
structure length 168
sequence length 168
chains with identical sequence C
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mjhA00
3NTUA 2FF7A 4BZPA 3LXRA 5EP4A 2IF0A 1ZBDA 4GMDA 4X8HA 4PC7A 4OBEA 1XD8A 1DBSA 3HDTA 5FTNA 5J40A 3NH9A 2HT1A 3SNHA 5FR2A 2ZITA 1VG8A 2XEXA 2EFGA 1Q1EA 2J0VA 1JAHA 3TVDA 1FP7A 5FTKA 2HJVA 3KJHA 4C2TA 5IF9A 2FV8A 3SYKA 2AKYA 2IHYA 3GJ8A 2WVJA 2QZ4A 4PO1A 4KAXA 1UKZA 3B2EA 2N42A 2O52A 2QP4A 1Z6GA 1XMJA 4M21A 1C1YA 2V1XA 4JLNA 1CR0A 3BBPA 4M1WA 5DYGA 1TNDA 2RGDA 5KTYA 1AJEA 4OK5A 4BFYA 1K8RA 3GD7A 3KB2A 4FMDB 3WMGA 4QGGA 3RWMB 1WE2A 4OI2A 1YE8A 2QPTA 2G83A 4A0HA 1OE0A 2B92A 2R65A 4H9GA 5DI3A 4DUGA 1OH8A 3H1TA 4EFMA 3W5JA 2V54A 4RD3A 3VU9B 3AB3A 1X86B 2Q9BA 3QEOA 5GADl 4Q7KA 4CW7A 4UXIA 1OFTA 2IYRA 1GVNB 2PX0A 3GLIA 4HUQB 2CE2X 4JBWA 5DI9A 4NPHA 2WJYA 5BQ5A 4B3DA 2ZJ8A 5GVSA 2NMVA 2BBWA 3PEUA 3RS7A 1YZKA 4LJYA 4G01B 1HQCA 2WIBA 1WCV1 2DBYA 1Y3AA 4EKDA 3VKGA 2MSCB 3UG6A 1KSHA 2R2AA 1II8B 2XX3A 3IPYA 3U2QA 4Q9JA 5B2ZA 3R8CA 3WNBA 3QKTA 3AUXA 4B44A 1U9IC 4HLCA 1K6MA 2P0EA 4NKRA 5J4YA 3VAAA 5BN5A 1IN6A 1LS6A 4F93B 1NIPA 5HE9A 2QE7D 2XB4A 1U0JA 2ORVA 2ZJ2A 4DXAA 2J0UA 4QBFA 2YKGA 3QXSA 1ZVQA 1WBDA 2QMOA 3BK7A 3RS4A 4POAA 4X8MA 3TQCA 2FFBA 1H8EA 1OHHA 3KUDA 1Z63A 4C9BA 2Z0MA 2ZUDA 4DCSA 2CLDX 4D25A 3AUYA 1ZYUA 4WZAE 4UNSA 1MABA 3QVVA 1QHXA 4QRHA 3K53A 1KTVA 3SU8A 3OZXA 2RGXA 1ZCAA 3JZMA 3VKWA 5DE3A 3PFIA 4A6PA 3NDPA 2VA8A 2H8KA 2XZPA 3GLFE 3MWKA 3KJGA 4D80A 1XEWY 1M6NA 1UDXA 3TUIC 4A8JA 1KHTA 2IWHA 1RIFA 1NBME 3LVRE 4AURA 2WMNB 4ESVA 1LV7A 2GCNA 4DVGA 4ZV4A 1P72A 3ZQ6A 1W36B 1HE8B 3AVUA 2PT7A 2ZYVX 1DAGA 4D0LB 3TW8B 3PITA 4BFXA 4LJ9A 1R4AA 2C9CA 4K81B 2QPOA 4PC2A 5FBWB 4UNPA 3T5DA 4G5QA 4B32A 4MKGA 4Z54A 2W6ID 4LJ8A 3WHLA 4DLZA 4Z1MD 3L8ZA 2ATXA 1NVVR 2MMGA 1XTQA 2ZRKA 4LHXA 3U3MA 1P3JA 1P5ZB 1UKYA 1KDRA 3A1VA 1NVXQ 4U5XA 1E4VA 1U0HC 2C78A 1HY3A 3W6PA 1TQ6A 4LY6A 3K09C 3P4YA 1O3YA 2D2FA 3N2EA 4RZXA 4YDHB 2PJZA 2GBLC 4YMTA 3KQLA 1EWRA 1KI9A 2GEVA 2QNRA 4ZPXA 3U60B 4FMCF 4DSUA 1E2IA 3BWDD 3I8XA 1HEIA 4GP7A 4ZCMA 1DAMA 2W2VA 4OQLA 4BRWA 2BBTA 1UKEA 4TSFD 5SZKB 2FFQA 2PX3A 4WZBE 1CXZA 4U7DA 3GEIA 1SXJD 2B7BA 2IS1A 1SQ5A 2ZRNA 3CPHA 4JVSB 4TQUS 8OHMA 1VHLA 1FMLA 5KSOA 4LV8B 5GJCA 3EZ6A 221PA 2G88A 1I2MA 3UWOA 1PJRA 1XMSA 1E9RA 1P9RA 4AYXA 4US0R 5ELXA 1GKYA 2HYDA 1KDTA 3RC3A 2FH5B 4GL2A 5HR5A 5HKKD 2OAQ1 4ZCIA 4DCTA 2VH5R 1PVOA 1EXMA 2XAUA 4B71A 3PJRA 3B78A 3IEUA 4HLDA 2RMKA 2DB3A 3DM5A 4O2RA 1AQYA 4A0FA 3U7HB 1N3BA 1DTSA 5CYPA 1UM8A 3FVQA 5KPDA 1COWA 4UKDA 2J45A 3HYRA 1ZUHA 1FUKA 5HCNA 5KNCA 2IX3A 4JJKA 4IDHA 5A4JA 2OLKA 3LA6A 121PA 2QT1A 4LC0A 1R6BX 821PA 5J4HA 3SJCA 1G5TA 4XH9B 4A8JB 4M2LA 1NLZA 2IBMA 1YZTA 1H65A 4JLDA 4L9SA 3QPWA 421PA 2RGEA 4JYCA 4GZLA 1Q1QA 3EW9A 2XB2A 4XD7D 3DMDA 3KQUA 4EJSA 3KQKA 1RZ3A 2HLDD 2NO6A 2VHUA 3F3YA 2F1JA 2O0KA 3ZIAD 5KHOC 5FI1B 1TF5A 3EASA 4AC9A 5FUYA 4AWXA 2GF9A 2O8BB 4HAVA 621PA 1P9NA 1DOAA 1OXUA 2ZANA 1NVWQ 1BYUA 3BB1A 2A3RA 2EWVA 2KI5A 4B2LA 4LV5B 4C0LA 1T8TA 4BFSA 5EP3A 3LBIA 3VNUA 2WOJA 1RPZA 1FTNA 1YZQA 2JLSA 3IBYA 2MSEB 1SXJE 4KLNA 4CT5A 2JJ8A 1MR3F 3O8RA 4FWTA 1RJ9B 1KSGA 2OFXA 4URVR 3F0TA 3D31A 4ARZB 1DADA 3RNLA 2BKEA 1JJVA 2XZOA 2H17A 5IK2A 5CDFA 3QSYA 1SKQA 1N6HA 4LCBA 3GP8A 4L5BA 1E0JA 2IC5A 4E07A 3DZ8A 1E98A 4ASUA 4H1UA 3GQBA 5F3WB 1A2BA 1QVAA 2C8VA 4NCJA 4QNMA 4TT3D 4CEJB 1XJQA 3W3AA 1W0JD 2XSZA 4MITA 1H8HD 2P6RA 5JI2E 3BXZA 4DDUA 3VX4A 1G17A 1Z2CA 2V7QD 3GLIE 2QY9A 3TLXA 3EPKA 1UAAA 2R9VA 2R6FA 5FOVA 4V0ME 3EARA 4DEXA 2JLZA 3UANA 3I8SA 4II7A 3EA5A 3C4JA 2Y8EA 2EFEB 1OH5A 4P4SB 4R98A 5BN3A 1XFAA 1G8FA 3F8TA 2ZTSA 5BWMA 3MLEA 4JLKA 4CIDA 4ITRC 1KI4A 1QDEA 2REOA 3VTKA 3ZVRA 1KO7A 1G8YA 1ZRHA 1XXHE 3UG7A 1NVUQ 4B6FA 3ASZA 4M0LA 5CM8B 4ZI3A 3EIHA 4DLYA 3PR1A 1PLLA 2ZJOA 3B9PA 1EWQA 1TU4A 4HZUB 2BOVA 4PC3A 2ANBA 3CWQA 2F9MA 2QN6A 5AUOB 4FCWA 4GP6A 1G7CA 2HV8A 4EJSB 4FMDF 1YZGA 3PXGA 4CEIB 3D7MA 5J4VA 3U5ZB 2GNOA 4B74A 4EPYA 3KDSE 3TW4A 4M9QA 5TXGA 1E2MA 1XXHB 4LBZA 2A9KA 2FNAA 3MWYW 1A2KC 3EZ2A 3LFUA 1YZUA 1GDDA 3ZD6A 2YWFA 2XOKD 4WIAA 3UKDA 4LJ5A 4B76A 3WNDA 3QJYA 4PXAA 4C0SA 3RSOA 2IW3A 1US8A 2CLSA 3I4LA 1EK0A 1NMZA 2WHXA 2BMEA 5DYIA 5P21A 2A7QA 2A78A 2GETA 4LJAA 2IWRA 2JA1A 2JEOA 1Z83A 3R7WA 2QQ0A 3ICQB 2GA8A 2XXAA 3A4NA 1NBMD 1A5TA 3HP1A 1D9ZA 3CUEF 3I61A 2P65A 2GZDA 1M7GA 4IKEA 1VYVA 2Z4RA 4EQ6B 3ZZTA 3CB4A 3P32A 4JLOA 3K70B 3IQXA 4B2PA 4LYFA 1G20E 3SBDA 2XGJA 3Q9LA 5TMPA 4TTPA 1SGWA 3RS3A 4CRWB 5DN6A 4DLSA 4MRRA 3EWAA 4M9SA 3FB4A 1Z8FA 1RYFA 3CNNA 4TYYA 2WBLC 3IHWA 1WBBA 2QTHA 2H92A 1G4AE 3R9XA 3OIUA 1X1RA 1GITA 1M7HA 2WWXA 2BJWA 1QHYA 3KTAA 3VKHA 1HUQA 3KKPA 3AGQA 2CVFA 2OE2A 4W5WA 1MO5A 4DLWA 3U4QA 4C0KA 1XCMA 1OKKD 1JEDA 3A36A 5E3HA 3WRXC 1W4RA 3AP1A 3DM9B 4B3XA 4JSTA 5LB4A 3ETLA 4UXJA 1H8ED 1OHHD 4UJ5A 3O8DA 3ZGXA 1AA9A 3C7KA 4LDJA 1LS1A 3L82B 3C5HA 3RRNA 2ZVQX 2QAGA 4HLUC 2V7QA 1FX0B 3WYGA 1CF4A 2VF8A 4JLMA 2IUSA 4OHVA 1QHGA 2FMXA 1DARA 4IDQA 4TMVA 1E0KA 2IS4A 2XTNA 4RZUA 1XB2A 2VSOA 2IHBA 5DGXA 4WBSA 4LSGA 3C15C 3K9NA 1XCGB 5EE3A 3NH6A 1Z29A 5DHFA 2ZS9A 5EP2A 1NNEA 1QG2A 4IFEA 1LB1B 4MRSA 2ZJYA 3QUSA 3KTAB 1OIXA 1CTQA 1GP2A 2GAAA 4KSBA 3VR4A 2KJQA 3JZAA 1G21E 4TL7A 4B47A 4AKGA 1XX6A 3BERA 4PFSA 4B2IA 4CEHB 2AWOA 1LW7A 1YRBA 3I32A 4KFRA 3U44B 4PZLA 1T91A 1W46A 1IXRC 1DG3A 3TJZA 3KKMA 3TVTA 4IVRA 4BFWA 2WSMA 4WXPA 5FUVA 2EWWA 3HU2A 2RGBA 1F2UB 2GXAA 2JLWA 2JJ1A 1HYQA 1JB1A 3KFXA 2CVHA 1IJFA 1S96A 2QT0A 2GK6A 5JSZA 1LY1A 1GG2A 3FTQA 2ZI7A 3O47A 1W0KA 4DLRA 3CNOA 2JIZD 3NG1A 1VCNA 2N46A 4PAMA 4AKEA 4DCNA 2QROA 2GJAA 1ZC4A 1DVRA 1Z08A 3GJ0A 1FNNA 2FOLA 1L7VC 1J7KA 4NYJQ 1NG1A 2QGZA 3X1DA 4MQBA 1II8A 1K5GA 2UVQA 3KZ1E 3VR1A 2Z83A 3KJEA 2UKDA 1RRGA 4TYQA 3ZJYA 4RKFA 5JEEA 4JLPA 3FGNA 1II0A 3LBHA 3LO5A 2ZI6A 2WJJA 4LHYA 1OXSC 3B1YA 4IOMA 4N0EA 1MO3A 2ZSBA 4UXHA 2ZSFA 3V00A 2E9SA 4OYHA 1FFHA 4KODA 1DG1G 1LVGA 4EUNA 2GZAA 3T35A 4V0LA 3D8BA 5IK2D 3OAAD 4AYWA 5KPJA 4G5SA 4DDVA 5A5GA 2VP6A 2ZROA 1UADA 2WJHA 1IQPA 4YDSA 2DWOA 2BV3A 1KDOA 2D62A 5EQTA 2XSZD 2WICA 2C98A 3OEEA 3KKQA 1MH1A 1G5PA 1US8B 5DN6D 4PQFA 3JVUA 3UATA 4D0GA 5K8UA 4OHYA 4URXR 3SE0A 2BMJA 4DLUA 3THOA 2AXNA 2BKUA 1N6KA 1GIAA 2C95A 2CCKA 1Q22A 3EPLA 1ZW6A 3T06B 1SVKA 1WP9A 1C9KA 4HB0A 5JI3E 3DL0A 1YZLA 4P4TA 4NYIQ 4HZIA 2HCBA 1BMFD 2D4HA 3H86A 1Z28A 5EXSA 2IXFA 4E5UA 5CB6A 4K8OA 4M8NE 4M1SA 3K70C 2BBSA 2XITA 4Q1BA 3GJ6A 1T0HB 1ESNA 4QGFA 4URZR 4US2R 5FTLA 3PG5A 3FHCB 5FPHA 4I1SA 5JWHA 1E99A 2WPDD 1ZM7A 2NO7A 2IXEA 3HPQA 3LW7A 5EUQB 1OV4A 2ZJAA 1PLKA 1E1QA 3SBEA 3FWYA 4NYJR 4PHHA 2ZRBA 3T15A 2MMCA 1YU9A 2CBZA 4L9WA 4UNQA 4D4JA 3NDBB 2R6CA 4OJQA 2OCBA 2QAGB 5J4LA 1IN7A 1TQ4A 3UK6A 4DSOA 3CH4B 3HYTA 2QSYA 4NYMR 4BGDA 5F98A 2WJIA 2FN4A 3ZZUA 1OB5A 2G0NA 1GRQA 2PL3A 4A0RA 3EZ7A 1XU4A 1G7RA 2ZJ5A 3AV0B 3FFBA 5B64A 3CX7A 2JATA 4AD8A 2W2TA 1W4AA 3GFOA 3CLVA 1N6RA 3WYAA 3FPAA 4XJXA 5AJVB 1Q44A 2D7CA 1J99A 4GPTA 4F91B 1NJFA 3RLFA 4DBLC 1P7CA 2V4ZA 4JIMA 1HTWA 4WVFA 2O0HA 1KJZA 2ZS7A 5LPNA 1XD2B 1CEEA 4IXNA 4MUAA 1VPLA 1B0UA 1S1MA 3UWKA 2J3EA 3U44A 1GM5A 3DKPA 1KI8A 3DMNA 3E5HA 2F1IA 3FKSA 4G5RA 1F2TA 5EXTA 4A2PA 1E2GA 4XTCS 4PSKA 4ERNA 5J4KA 4HATA 1E0AA 3QPUA 4KSCA 3P1JA 3QQ5A 1XF9A 1T9HA 2AWNA 1W47A 1TPZA 2IEYA 4FWIB 2JJ1D 3THWB 1IXSB 3BOSA 1QG4A 4NHOA 4C7OB 1TMKA 4IW3B 2P6NA 1Z5ZA 4CGZA 1CBUA 4A8JC 3REFA 1TEXA 1Z3IX 2NGRA 4PQRA 4RD1A 4B33A 4Q48A 1XJCA 5HTKA 1OXVA 1D2EA 2XZLA 1G19A 1CR4A 2BDTA 2G1JA 1OF1A 1AKYA 4I99A 5H1YA 2QORA 1E2KA 4TZ6A 1ZUNB 2ODBA 3ZDQA 1J8MF 2PZEA 5SZJA 3RSLA 1M34E 3AF1A 4QHYA 5F2EA 4DRZA 2ZIAA 4P3YA 1GNPA 2WTUA 4M1YA 3B1VA 2V3CC 2OEPA 4Q7JB 4TQAA 3U6BA 1W7AA 2KB0A 3GCGA 1AS2A 2P6UA 2VL7A 3K0FB 2OILA 1IN8A 4EAQA 4AG6A 2ZSAA 4GBMA 1D5CA 4TYPA 4DSNA 4EPWA 4LHVA 1E2DA 1PZNA 2YVUA 2HJGA 1U2RA 3NC0C 2QBYA 1DAKA 3BD9A 3QXXA 4MA4A 5CK5A 1QHIA 3RAPR 2VHQA 1T3SA 4BFTA 3CR7A 2NTYC 5FBLB 1Q1BA 4C3ZA 5JMTA 1GWNA 4Q47A 5JSZB 4IOLA 5EJEA 1N6IA 2WWWA 3AKEA 5FFMA 1OKKA 3M1IA 2CNWA 1MABB 2W6JD 2JLVA 4QHTA 4TLBA 2RKOA 3RS2A 1TADA 2HDNB 5L3VA 2IEZA 2WWFA 1O87A 4V03A 3BC1A 2VHCA 3CRW1 3IILA 4IHQA 3SOPA 2CCJA 2ZR7A 1WRBA 4GMXA 1PUJA 3C41J 4NDZA 2LKDA 2AFHE 3AEZA 2YZ2A 1XPOA 1TQDA 2GJKA 5DLQC 4E09A 4Z51A 2JAQA 5L3SA 1Z47A 4DHEA 1BS1A 3WNCA 4ZKDA 4JT2A 4Q4LA 4KFSA 3NBYC 2PH1A 2O8EB 1W0KD 3L0SA 1T6NA 4PZYA 1QHHB 4NE2A 3WMFA 2Q21A 1QRAA 1UFQA 4Q5IA 2XNDA 2J0QA 3O8BA 4PHFA 3QKRA 4XWOA 4BLRA 3EPJA 3FHOA 4RFSA 5CLQA 1E1QD 4RCZA 1GUAA 2CJWB 1MOZA 1M1YE 2WSSD 4Q1DA 2D3WA 3E1SA 3SHFA 4M1KA 4KITB 2YOHA 2IUTA 2QUZA 5AR1A 2RCNA 1UDWA 4YONB 1E2FA 4MKFA 2ORIA 3X2SA 5HZHA 1Z0IA 4NCNA 3THYA 1IBRA 3CZPA 4DLXA 1ZM2A 521PA 1UEJA 1P2SA 4LYJA 3LLMA 2EW1A 2YC2C 4A92A 1JQJC 2E87A 1SVIA 1R7RA 2VEDA 1OYYA 2JLXA 2CL0X 3CBQA 1CKEA 3IBGA 3K0AB 1CULC 1YKSA 1GNRA 1P9WA 3CF2A 1KK3A 3SFVA 1GRRA 2IYUA 3LWNA 1NIJA 3CONA 2I1VB 1NF3A 3QF4A 4LYHA 2V55B 4CT4B 1KKMA 4MYUA 4B48A 1R5NA 1UF9A 4W5JA 4IDPA 4Q9IA 2IXGA 3AF2A 5CB8A 4QKQA 1KJYA 4NCHA 1CJUC 4GOXA 2IK8A 1TAGA 1AKEA 4V0NA 1Z0AA 3ZS9A 5FPKA 3I62A 2I3BA 5C18A 4NYIR 3OIWA 1XP8A 4HDOB 2GWHA 2ZSEA 2AFIE 1T4GA 2B21A 1ZMXA 2WOOA 1KNXA 3TKLA 2IS6A 1KJWA 3QG1A 4I81A 1J2JA 2QRNA 5AJWA 1ZD1A 3VFDA 4D81A 1CRPA 2FPLA 3U3JA 2HCJB 1ZAKA 2GTPA 4MKHA 3QY0A 3RS5A 4B3GA 2ZE8A 3KJIA 1N0VC 3CO5A 3OIVA 1CIPA 1KY2A 3N70A 5B30A 2QAGC 3EWSA 4OHXA 1BH2A 1S0UA 4Q4JB 3GLFA 5EZ5A 5BW8A 2FEMA 1CJTC 2FU5C 5EE5B 2Q3MA 2C5LA 4G5OA 1W36D 4LWZA 3B82A 4JKIA 4Y0VA 3W9YA 3A1TA 3OE7A 3B1ZA 4WZ6A 3A8TA 1E9EA 2ODWA 4BUJA 2OO7A 1WA5A 2AK2A 2LKCA 3CZQA 1CRQA 4OQFA 4TLCA 5AUQA 1R0ZA 4C7OA 1Z07A 5JLJA 2X19A 2GVDC 1W36C 1JAIA 2V9PA 3BB3A 1W48A 2QG6A 4QBIA 2ZREA 2QTVB 1F60A 2ZRDA 3SZRA 4YLGA 1P4SA 5HPYB 5LD2C 4NH0A 2JGNA 4URWR 4BFZA 4F4JA 2OSBA 5GJBA 4JLBA 2RGAA 2OHFA 3CH5A 4OI1A 3U3OA 1OXTA 4U00A 4HAXA 1SHKA 1VG9B 4QNRA 1EFRA 2IYLD 1AN0A 2B8WA 2W6IA 5FOTA 4DWJA 3U3KA 4WAUA 3JVVA 1Z2AA 2G6BA 1D9XA 4LJ6A 4LZZA 3K9GA 3ND8A 1P2TA 3LY5A 1ZM3A 5KDLA 1G3UA 3CRMA 3UMRA 2GJSA 4Q9HA 1JXOA 4OL0A 4JT4A 1ZD9A 3AVOA 1G8HA 1S4QA 1KO5A 4LYAA 2QAJA 5SZHB 4BLOA 1TU3A 2ZUBA 3UXMA 2RHMA 4DIDA 1AQUA 2YHSA 2BCJQ 3SS8A 1NKTA 1QBKC 2ZI9A 4QXAA 2F9LA 4HEJA 3SI7A 3BE4A 1SXJA 3KKOA 4BASA 5F9FA 1J8YF 4HAYA 4Q03A 3MJHA 1MT0A 2O8DA 3ND9A 4NTZA 4NONA 4PO8A 1CJVC 1CR2A 2FSIA 1X8JA 3SJZA 1IXZA 4KCGA 2BWJA 1FL9A 4C0AC 4EDHA 1P61B 4DKXA 1VYUA 4HAUA 3EIEA 2AD1A 3K0EA 3QG5A 3AVXA 1BOFA 1IONA 4YXWA 3W34A 3TSOA 5FL3A 1VCOA 2I4IA 5EE9A 3AF0A 2BVNA 2W58A 3G5UA 4OI0A 4BQSA 1CLUA 4Q4AA 3WMEA 1G5RA 4QJ5A 2OCYC 4EIWA 1UBFA 4DCVA 1XRJA 3A37A 1DEKA 1F48A 1UKVY 2GEUA 2ZJZA 1UBGA 3P26A 4TSFA 3ZZ0A 4BEJA 1Y63A 3R7WB 1OSNA 2YWHA 2ZRHA 3TR0A 2ZRAA 2FWRA 3VR2A 1FW6A 2WZQA 4Q7LA 1E79D 2CEAA 1P60A 3X1ZA 2BHRA 4PTLA 2ZSDA 1Q21A 5FPTA 4JBYA 4TT3A 5JWRA 3RS0A 2YV5A 2ZPTX 4ACAA 4E03A 1CJKC 3CW2A 1N5LA 1ZU4A 1KMHB 3LQQA 1XZQA 3DZDA 2CDNA 4EQ6A 4JLVA 1T5LA 1DAIA 1XTJA 1XXHA 1IM2A 2JJ2D 3Q8XB 1I4TD 5D3QA 5HKKA 1KO8A 2PJRA 4P4SA 3QXHA 5KSYA 2YNMA 1GSIA 3HJNA 1L4UA 1E9DA 2P67A 3GFTA 1HE1C 5K8IA 3GJ4A 1ZNWA 2GCPA 4XD7A 1KOFA 2WWIA 3U7FB 1U9IA 2OLJA 2QEQA 3BAFA 4UNNA 3RRYA 2FZLA 3H0KA 1ANKA 2W6JA 4Q4HA 3ZIAA 4A2QA 3U7EB 1G18A 1S2MA 2J5XA 1VHTA 1GL7A 2EVWX 2WSSA 5BXQC 4NCKA 1VIAA 2ASEA 2DR3A 3KKNA 4KO8A 2P5TB 2OZEA 3T1TA 2KBEA 3QF4B 2EU8A 4BLPA 5CITA 2IUUA 4MH0R 1GKIA 2VSFA 3PEWA 3BJIC 3K0SA 1TTTA 3AVTA 1EFUA 3RABA 2PEZA 4TMWA 3SN6A 1IHUA 1KSFX 3F5FA 4M1OA 3K9LA 2OBLA 3QBVA 2EYQA 2FPKA 4AY2A 1JR3A 1MRSA 1SULA 4Q02A 3ZQJA 4N1AA 4D0NA 5FBRB 4GT1A 3TSZA 2GEDA 2VLIA 4DLVA 1KO1A 1KZ7B 3QNUA 4QBGB 1OH6A 1AZTA 4ACBA 4LBVA 1XEFA 4GI7A 5JCZA 1EGAA 4V0KA 3EX7C 1U8YA 1XTSA 4MGZR 3EXAA 2LWIA 3W6NA 4EFLA 3L43A 3QF7A 2ZUCA 4A2WA 4BLSA 4ASUD 1XPUA 4TL8A 2AD5A 2WIAA 2MSDB 3WRYC 2PEYA 3BFVA 1CS4C 3K0CC 2IF2A 1PLJA 1Z0KA 2C99A 4HZUA 3LX8A 2J1LA 3IUYA 1SVMA 1U99A 1G3QA 4R7ZA 4AIIA 4LBWA 1NBMA 3RC8A 1SVOA 1RFLA 2J0SA 1ODFA 1U8AA 4S2EA 4L16A 1NJGA 3GJ3A 4LGMA 3H2YA 2O8EA 2V1UA 1QHSA 4E22A 5JS7A 4CDGA 1NN5A 1G3RA 3ZD7A 2UZIR 1RRFA 3THWA 1E4YA 1BIFA 1BO6A 1XDBA 1E9BA 1Z0DA 1ZP6A 3H4MA 4MKIA 3QENA 4JVNA 3LXXA 1OFIA 2AL7A 1R0YA 1KSJA 4YC7A 4C0JA 1G8GA 1W0JA 5CIWA 3RWOA 3RVBA 1LFDB 4Q1AA 3WBJA 1H8HA 1W1WA 2A5YB 3WYFA 2DY1A 1X6VA 3NHAA 3I1FA 4ZO4A 4A1FA 3VNVA 4EFNA 4PSVA 3VR6A 3REGA 4BECA 4DCUA 3BS4A 3B7GA 4GFDA 4PX9A 5KYKA 3TRFA 1GFIA 3L8YA 3OEHD 4Q4HB 4IEEA 4I1OA 5B57C 1FQKA 2DYKA 4HB3A 4X8OA 4KBFA 5FOWA 2P5SA 3MUFA 4DZZA 3IQWA 2FPMA 3EC2A 2Q9CA 5CJ2A 3IDQA 4URYR 1P2UA 3EG5A 5FL7A 3GLGE 1AGPA 5LDDC 4G1UC 1FPMA 4MDEA 3HR7A 4L15A 1F2UA 3TSWA 2AXPA 4PHGA 4DDTA 1N2CE 3FE2A 4KV9A 4LPSA 2O8DB 5GVRA 2VO1A 3DPUA 1E2QA 1R5BA 5EXXA 3RDPA 4JLAA 4XSGA 2JDIA 4C0BA 2RHDA 1JQLB 3UIEA 1N0WA 3NIBA 2YYZA 2DWQA 3HPRA 4K46A 4IVPA 5JECA 2JJ2A 2GXQA 3E2IA 3AP3A 5E7MA 5DNYB 1X8KA 5JJIA 3FDIA 3TNFA 2QSZA 3P20A 1XCPA 4FIDA 4KVAA 5DISB 4RD0A 1KKLA 1KAGA 5L3SB 3FFAA 4TYNA 4RVCA 1JXMA 3GEHA 5H8WA 2PCJA 2UZ3A 1KO4A 2A30A 4M4SA 1XEWX 4DSTA 1G6HA 3NEJA 1RRCA 3EPHA 3H84A 4DB4A 4Z8XA 1XJ0A 4IOJA 4M1TA 2TMKA 4B75A 3MWLA 4DB2A 2WKQA 3C5CA 1PV4A 1KMHA 4QG7A 3QKRB 5E7JA 2WM9B 2QI9C 3Q7QA 4B6EA 2G3YA 2CCGA 1A82A 4RFVA 5DI3B 1EG7A 2CJWA 5LB2A 2P2LA 3K0CA 3LAWA 4XSHA 3WY9A 2R44A 2D2EA 4PANA 3A6PC 2ODEA 3TIFA 1J70A 2WJGA 3NBFA 1VG0B 2VRWA 5CLLA 3VHXA 4QHSA 1KK1A 3IEVA 3W5IA 1U0LA 1F3OA 3AM1A 1ZJ6A 2R6DA 3DHWC 2Z6VA 2CHVA 2OG2A 2F3TA 1E6CA 1E79A 3RYTC 4DIEA 2NIPA 5KNBA 3M6AA 1G8PA 2F55A 4NL4H 2OM2A 1Z0FA 2YC4C 2H18A 1IN5A 1TQ2A 2BJVA 2NG1A 3T12A 3ADBA 3HU3A 3N2IA 4PSAA 2Q3FA 5FOXA 2QRZA 4AG5A 5JCPA 4Q9KA 2G9NA 4CEJA 5K8TA 4YMUA 3E70C 1QHNA 2SHKA 4G5GA 2CLCX 3EZFA 4NP6A 3B6EA 4CZ2A 3BGWA 4OHWA 5KUTA 1E2HA 1GZSA 1S8FA 3QIAA 4U02A 3KL4A 4MGYR 2JLQA 1ESMA 3KXKA 3CPEA 2RGCA 3R9IA 3TUJC 3KQHA 3SQXA 2GVZC 4JL6A 4IDOA 4P32A 4ZKEA 3LNCA 5GJVC 6Q21A 3SJAA 4IVQA 1QVRA 2W2XA 5JS8A 1D6JA 1YR8A 1AK2A 2PZFA 4OQNA 5G41A 3THYB 2CL7X 3AKCA 3MMPA 3FMOB 4V0MA 4AYTA 2VF7A 1NKSA 1ZD8A 4RKEA 2J7PA 1N5KA 1J90A 2R62A 5CIQA 2CK3A 1M8PA 2GESA 2ZU6A 2X8AA 1LF0A 1A1VA 1SXJC 4D2IA 3A4MA 1FOEB 4QBHA 1RE0A 3GEEA 1Q0UA 2GJ9A 1BMFA 3VQTA 3W3ZB 3GJ5A 2DFNA 4PAQA 2NOAA 2PMKA 4XOIA 4KXFB 1YR9A 2W83A 1MRNA 2JIZA 1MKYA 3FKQA 5CJPA 1N5JA 2XTZA 4LX0A 4CVNA 4H1VA 2RGGA 1YRAA 4XWAA 3AVWA 4OKSA 1P73A 1OIWA 3WBKA 5KNDA 4MDFA 3I5YA 3O8CA 4RD6A 3SQWA 2IYZA 4JS0A 5D3MB 2IYYA 2ZE7A 3LV8A 4FXPA 3C16C 1YHNA 1G291 2FA9A 2J46A 2O5VA 3S1AA 3AP2A 1ONBA 3TBKA 1IJEA 4YXWD 1E32A 4GOJA 2HXSA 4HDQB 1RW4A 3W90A 1HH4A 1OYWA 5G3ZA 3WP0A 5K8LA 1AGRA 2AX4A 4KU4A 4W9MC 4FCTA 3K70D 1P75A 5TARA 1BKDR 1RVDA 4B3BA 3IGFA 4KI0A 5E7IA 4OJKA 5TDHA 1NLFA 1QZXA 2DCUA 3DEFA 4QM7A 3IPXA 1Z6YA 5TVKA 1G41A 3NEYA 1E9SA 5JZVA 4JL8A 2Q0HA 3EC1A 1K5DA 1ZNYA 5L8VA 1TEVA 3K8YA 2RGNA 4J0QA 2ZYUX 3GLHA 3SR0A 3AVYA 2ERXA 2CHQA 2YINC 1C4OA 3NBXX 1NY5A 3DOFA 4WA7A 2GBLA 4F7WA 2ZRLA 4N3NA 4AK9A 1TX4B 2FSHA 2ZRIA 4HLQB 1WQ1R 1XWIA 2EYUA 2L0XA 2IA5A 1NSTA 1PUIA 2JCSA 2BMDA 4V0OA 3PUZA 1S3GA 4DEYA 1NP6A 3TK1A 4HLUA 4BZXA 3KUCA 2FX3A 2G77B 4EJSC 1Z6XA 3QOFA 4B3CA 1N6PA 3S1AB 3LVQE 3MGCA 2QE7A 1OIVA 1JPJA 5FL7D 5JFGA 1XEXA 5C4MA 1I4DD 3C8UA 1NN3A 3UPUA 1E2NA 4Q4AB 5BYJA 4A15A 2HEIA 4UNRA 3TAUA 4LV6A 4PPGA 1G7SA 2ZYWX 4NBSA 5LBIA 3BH6A 3PUWA 3QKSA 3K0FA 4XVQA 1E1RA 4RD2A 4D26A 2W0MA 3MAAC 2CL6X 3RHFA 4MRPA 2VP4A 1P2VA 5HZKA 3AF4A 4XIGS 2A5JA 4XVUA 1JR3D 4LBYA 3FHTA 5FOUA 1KNQA 2FE4A 2XNSA 4Q9LA 3SFZA 4NU0A 4MUBA 4DLTA 1M2OB 1NMYA 2GILA 1M7BA 4MRNA 3LDAA 1AZSC 3ONWA 2F7SA 2NPFA 2ONJA 5IRCD 1YVDA 1E94E 1DPFA 3GLGA 2BM0A 3VU9A 3ADDA 1WDTA 4TZ0A 1E3MA 3B1WA 3SYLA 2I1QA 4QC2A 1U90A 2FJUA 3CIOA 2CNWD 4FCVA 2PLFA 4BLQA 2OV2A 3OFND 3QPVA 2JASA 2DFKB 4WXRA 1VKJA 4C0HA 5CDFE 3LW8A 3LQRA 1KYIA 3L2OB 3MSXA 3W8RA 1CP2A 2X2FA 4C30A 4KYIB 2FSFA 2IL1A 3ZLJA 3FOZA 1NVVQ 4HB2A 5EP1A 3AVPA 1D8TA 3B9QA 1XEXB 2IS2A 1GAJA 3SDZA 4IDNA 2VP2A 2D06A 2GKSA 3MFYA 1FP6A 1X8LA 2FGKA 4LJ7A 1G1MA 5FPYA 4C0QC 1W4BA 4JL5A 3HR8A 1A4RA 3ECCA 5DIFA 4YQFA 1G64A 4FMBB 2VSXA 1JNYA 2DFTA 2OAP1 1MV5A 2A5DA 3Q5DA 4BZQA 1XPRA 3R9WA 2OFOA 3SYNA 5EZ6B 2O8CA 2OUKA 2IYQA 2VPPA 3NC1C 3QBTA 1DELA 3W6OA 1FX0A 4IXMA 4PZZA 3IO5A 4XWKA 3V9PA 3A1UA 4Z8YA 2OBMA 4JVMA 3T1QA 4PQYA 4QFMA 3CF6R 3V4RA 4QM6A 1MO6A 2F1RA 2OESA 1DO2A 3FMIA 2QM8A 1E9AA 1BYIA 3N5CA 3KXLA 4HI0E 1KDPA 3GPLA 4ZDKA 4KJZA 1X3SA 1E2LA 5JEDA 4FN5A 1KY3A 1EX6A 5C2JB 3PUXA 4IRUB 2HXYA 4LI0A 4M22A 3CRQA 2WV9A 4EPVA 1ZC3A 2NQ2C 1NY6A 2O0JA 4RZ3A 1OFUX 4D6PA 3KB1A 4PPFA 2XXAB 1HT1E 2H7VA 1UJ2A 4HB4A 3CF0A 1X1SA 2ZI5A 4KVGA 4YMSA 1LF5A 1KZGB 1SVWA 3A58B 3RRZA 1KK2A 1XZPA 1R2QA 3PENA 4BE7B 3BIFA 2J0UB 1XTKA 4I1UA 2V6JA 4HSEA 3U7GA 1CU1A 2ANCA 5FUWA 5KSPA 2ZQ5A 2VTKA 3BH0A 4FD2A 2LCFA 2GXUA 3PUYA 3QXCA 1SXJB 4D4MA 3GJ7A 2GAOA 1IN4A 4M9ZA 4ZI2A 4MYCA 2QP3A 3CR8A 2KSQA 2NO0A 4OHZA 2N1BA 1UPTA 4HAZA 1RJ9A 2VYFA 3G82C 2EFHB 4PR0A 4TMKA 3HWSA 4V02A 4B73A 4C2UA 3PEYA 4Q19A 2Q6TA 5FR1A 1ELOA 2HLDA 2BEJA 3T61A 1D2NA 1COWD 1HV8A 2A5GA 2HF8A 2IYTA 5HE8A 4M53A 3K09A 1I4LD 1GKUB 3QKSB 1IY0A 1Z06A 1UEIA 3B85A 4MYTA 1G6OA 4PPQA 5A0FA 4Z1MA 4KFTA 1VYTA 2OCPA 2WWHA 4YMWA 3IIJA 1GL9B 4B43A 5JHGB 1E1RD 1JECA 3DVLA 5FH9A 2ZR9A 1ZNZA 1R8SA 2AN9A 3M0EA 1KI3A 2C96A 2FG5A 4F38A 1NG9A 1VG1A 4P0TA 4L8GA 1VIYA 2FZ4A 2IYWA 2ZM5A 2C9OA 2ZE6A 4URUR 5G3YA 1NL3A 2GJ8A 3QEJA 3TH5A 4Y0AA 2XNDD 4B34A 4PAOA 1T3LA 2WAYA 2XOKA 1XTRA 4BFUA 2K5UA 4F4IA 1QF9A 1XTIA 3ZYCA 4S35A 1HA3A 3L0OA 1W49A 4NYMQ 2BM1A 1JBKA 4NMMA 4TL9A 1XD2A 2OXRA 3CWZA 3PEVA 4A4DA 1KI1A 2KBFA 1HT2E 5EXPA 4ZDJA 1FUUA 4XTRA 3CX8A 3KX2A 1ZCBA 1W4CA 2EQBA 2Q3HA 5AJZA 1Q3HA 5G40A 4X8LA 4ZDIA 2ZI3A 2O8CB 4KHZA 2FDCA 1SVLA 2ZRFA 3L0PA 2W00A 4AKIA 1XD9A 2NO1A 2W0SA 3Q85A 4LPKA 1G7TA 4LHWA 2DPXA 4JYBA 2ZU0C 4WOPA 1I2DA 4DC9A 3CM0A 2V8OA 2VHJA 4Q18A 4LRWA 1N5IA 3UMSA 3K1JA 3OESA 2Z4SA 3AKYA 4G0NA 1RKBA 2OFWA 4P4UA 1WXQA 1JJ7A 4QJ3A 2QPAA 1S9HA 5KDDA 3CPJB 5F9HA 4LC1A 2J7PD 4PC1A 5AUNB 1KAOA 4I4LA 2RAPA 1YQTA 3FYHA 3ZS8A 1KMQA 3TAHA 5J47A 1Q3TA 1OH7A 3L0IB 1GOTA 3RANA 5J5CA 1S3SA 1SKYB 2R6AA 3HU1A 4KYUA 4B3FX 1KK0A 2WKRA 4IEIA 3WXMA 3BRWD 4FINA 1VMAA 4TLEA 1IAQA 3FMFA 4JMPA 1E2EA 4TL6A 1E96A 3RRMA 3SHWA 1SZPA 2VHTA 2IYVA 3Q72A 4P31A 3R8FA 2H1LA 4CF7A 2FEOA 1JI0A 1NI3A 2AKAB 2EFDB 5BYKA 1OFHA 1R5OA 2X2EA 2QA5A 3PIRA 1OLOA 1EFRD 3WHKA 1N0UA 1T3HA 2O8BA 1OPXA 2C9YA 4MYHA 4HYYA 1VDZA 1JR6A 1F6BA 1RRPA 4L4UA 3T1OA 2GRJA 4OQXA 2ZS8A 3OE7D 1DE0A 2PZGA 3VX3A 3LRPA 1N6LA 3X1YA 1L8QA 3I5XA 2Z43A 2G0TA 3P4XA 4O0MA 4BLTA 1GL6A 3NKVA 1LNZA 4DT1B 5M04A 4W5HA 5KU1A 1W2GA 2ODNA 2REBA 3AGPA 4C4PA 2CXXA 5HCIA 2R8RA 1SVSA 3PVSA 4ABYA 1TUEA 1WB9A 1JR3E 3GJXC 4R2IA 3OFNA 4ILEA 4LUCA 3QE0A 1NSFA 1S9DA 2VP5A 4A0GA 3KQNA 2GZHA 3MCAA 2QU8A 1OB2A 2F43B 2AHOA 2VP9A 3QKUA 1JEEA 4MRVA 2H57A 2NZJA 5G53C 2J7KA 5FPSA 2D74A 1Q20A 5JRJA 4TN1A 5CK4A 721PA 1HURA 2P3SA 1FTSA 4ZIRA 4I1VA 2QMHA 1DAHA 4B35A 4GOKA 5DHAA 2JLUA 1ZINA 2H5EA 4Q1EA 4KBGA 3THXA 4OK6A 5IDVA 1G3MA 4Q1FA 2OXCA 4JLJA 3I73A 4UQOA 3BFXA 2A2ZA 2X77A 2KE5A 5C46F 5L3QB 2CHGA 3QXJA 4NZYA 2B6HA 4TMTA 3MRSA 2QL6A 4OI4A 3EZ9A 2VP0A 3U61B 1Z22A 2QENA 4Q7MB 5H68A 2CE7A 1NRJB 4KFUA 1CJMA 2JLYA 1Z6AA 3Q3JB 3GLFB 4A9AA 1EESA 4PHTA 1M74A 4TMXA 4BWYA 3DDCA 1KI6B 1OT3A 4JSYA 4PPNA 4GZMA 4TTRA 3V4FA 1TL7C 4M9XA 4D4LA 2V6IA 4FI3C 1IY2A 2YOFA 3B8HA 1VCMA 3ASYA 2ZETA 2DHRA 2ZRPA 1AS0A 1R10A 3DKVA 4LK2A 2PCLA 1TF2A 2FGJA 4HUTA 1YR7A 3D6TB 1FNMA 3CNLA 4RY2A 1NLYA 1T0JB 4MGKR 4QGHA 5UKDA 2PLRA 1OXXK 3B60A 3SJBA 2ERYA 5AJXA 1RYHA 3I92A 5FOSA 2GF0A 1G9XA 3IIKA 3MWJA 4BEBA 5AUPB 4EPTA 4JBXA 3OEED 4A6XA 3QI2A 1AIPA 1R8QA 2AR7A 3GFPA 2ZI4A 3CRVA 2QTFA 3B13B 2ZR0A 4RSGA 4TYWA 1G3IA 5H70A 5DSZA 2A5FA 3AF3A 2HF9A 3OIYA 4Q4JA 2C77A 3K0AA 1ETUA 3A1WA 3BB4A 4FW9A 4CYMA 3AVVA 2XTMA 2B8TA 2VIIA 3U4QB 3P27A 1CR1A 1TUIA 1KI6A 1UBEA 1XMVA 2QGNA 1HQYE 1ZU5A 2IT1A 2J9RA 2ZXUA 4HDCA 1YZNA 4CEIA 4D82A 4RCYA 3GLGB 1AS3A 1E0SA 3T34A 2G1KA 1E69A 1G4UR 1T8UA 2F3RA 1W44A 2CMKA 4ZIRB 2IYSA 5TV2A 2ZE5A 3DOEA 3EAQA 4HUQA 4O2LA 3ZVMA 1T5IA 5C1BA 1JALA 2GCOA 2O8FA 2JDID 3EIQA 2REXB 3VMFA 4D4KA 2RGNC 5DH9A 2VBCA 4TQ9A 3AKDA 3IHLA 1YJ5A 4JZKA 4TTQA 1B23P 3B1XA 2NPIA 5FTJA 1NMXA 2QMEA 1D2MA 1E2PA 2DWPA 3CKLA 3IKJA 3R20A 2Z5FA 4DT1A 4G3XA 1U8ZA 5L3QA 2KWIA 2ZEJA 5B58C 1FQJA 4GSYA 3K9HA 3MG9A 2OCAA 5FUXA 3U3RA 4TLAA 3OAAA 2QMUA 1XMIA 5AJYA 1ZNXA 3D3QA 2DFLA 3BFKA 5KSZA 2HYIC 1U98A 1ZM4A 3KXIA 1Z6TA 3QVUA 3VR5A 1W5SA 5CM9C 2EFCB 3LBNA 1V5WA 2B7CA 2F43A 4QJ4A 1F2TB 4CEHA 3LD9A 5BN4A 1W2HA 2BC9A 4QGAA 3FMPB 4P33A 3FKSD 3VHLB 3PQCA 4EPXA 1VTKA 2OBNA 1ZUIA 1N6OA 1R0XA 1ZM9A 4RFSB 4ESHA 3NVAA 4ZCLA 1KI7A 3T1VA 3SEAA 1GRNA 2RH5A 5ANRB 3U6KA 3ADCA 2ZYTX 1IOZA 2QM7A 3KFVA 3OEHA 5C4GB 2YOGA 4BFVA 2QQEA 1P6XA 5FI0B 1IY1A 4DUGD 3EA0A 1RC8A 4LOAA 1WMSA 2PT5A 4XVRA 2VQSA 3X1WA 4AKHA 2ZJBA 4MGIR 2FFAA 2J87A 4PC6A 4A82A 2D7DA 1N25A 1UBCA 5TY0A 1F5NA 2E1RA 2YWEA 5EE0A 2BEKA 3LLUA 1EFHA 4Q00A 3G0HA 5KO2A 2GHIA 2WJVA 1FMJA 5JRZA 3OF5A 5GJWC 4JJZA 2ONKA 3GLHB 3MD0A 1P62B 3LH5A 3TGPA 2ATVA 1DAEA 1KGDA 1Z0JA 3BORA 2XJ4A 4LHZA 4N0DA 3C14C 2HT6A 5FBQB 4Q66C 4R71A 3THXB 2BIFA 3PCRB 3TUZC 4IJMA 3NBZC 1NN1A 2WPDA 1KI2A 1U81A 2GCOB 2ZRJA 4W7SA 1SKYE 1N6NA 2BMFA 2F1HA 4DDWA 2NZ8A 2WWGA 2RB4A 2YWGA 3IO3A 2WMOB 3M4YA 4OQMA 3ZVLA 1DS6A 5IT5A 5JWOA 3I72A 3ADKA 1VECA 4DJTA 5AWFC 4RD4A 1MO4A 3Q7PA 3GLHE 3CX6A 1FZQA 3VR3A 3CRRA 4OK3A 4EPRA 2WWYA 4GDFA 2CK3D 4F92B 2Q9AA 1EFCA 2WKPA 4US1R 5DO9A 2J59A 1E9CA 4FMCB 2C2HA 1JPNA 5EUMA 2C04A 2QBYB 3SC3A 3TE6A 1QHHA 3X1XA 1DAFA 3WP1B 2BBOA 4KLZA 3ZH9B 3GMTA 1R0WA 2WAXA 4Q1CA 4R2HA 4NCIA 5KDOA 1GNQA 3AVQA 4RJLA 4UJ3A 5D3MA 3PUVA 1S1CA 2F6RA 2PBRA 4O25A 3TMKA 1GILA 2O8FB 3B5JA 1II9A 3TR5A 4QL3A 2NO9A 3DO6A 4ZDWA 4O3MA 2FSGA 3T5GA 5JHHB 5E4FA 5FTMA 3NHBA 4R9UC 1XBTA 2GXSA 4JKYA 3BH7A 1L2TA 2HUPA 2J41A 4BRUA 3ICEA 3TQFA 2C03A 5TB5A 2GK7A 5CYOA 3W8NA 4F4CA 1KIMA 2ORWA 1L4YA 1ZIOA 2FFHA 5L3RA 3A1SA 1NN0A 4Q01A 4GNKA 4WW0A 1U94A 4TMZA 1SHZA 1Q12A 5E95A 1VCIA 2ZRMA 4LJ4A 1GTVA 4A36A 5AK0A 5KOYA 1LTQA 1WF3A 1YR6A 2H16A 1G16A 1V43A 2R6GA 3J81k 2GDJA 2XJ9A 1E2JA 5LD2B 1E9FA 3ZVNA 2ECKA 5FBVB 5JJKA 5IHPA 4M1MA 1A7JA 2ZRCA 1Q57A 3UMFA 4AI6A 1OW3B 4TWZA 4QOSA 5EE1A 5JBQA 2JLRA 1OJLA 4HAWA 4JVLA 3GLIB 2PMDA 1Q1ZA 2BCGY 1XNJA 3IIMA 2ZAMA 3A4LA 4IOKA 3AH8A 2X1VA 1TF7A 3OHMA 5JJLA 4ARZA 2ZVPX 1AM4D 4PO9A 5SZIA 4IFBA 4GRAA 4BPBA 1EX7A 2ZAOA 2IYXA 3MJRA 3NXSA 3I3SR 2YJTD 2AK3A 4YMVA 1DO0A 3LX5A 1ZIPA 4ON9A 4RZ2A 2OT3B 2QP9X 2ZRGA 4Q21A 3Q5EA 1W5TA 1EFTA 3PV0A 4TLDA 3NWJA 3AQ4A
chains in the Genus database with same CATH superfamily
1ADFA 1T5DX 3VC3A 1ZW1A 5B3JC 4UM9D 3IQDB 1CUVA 2A9VA 1W9HA 1GGVA 5A4IS 4DR7B 4YRMA 1RYNA 4ZEVA 1A9ZA 3MCTA 1IAVA 2UYYA 1E6KA 2XKBA 1DBSA 3HDTA 1ML4A 3L4EA 4Q9NA 5FTNA 5J40A 2QYTA 1T6YA 2F8SA 4QX6A 4J94A 3SNHA 4D9CA 5AM0A 2Z08A 4DG9A 5FR2A 4ATNA 5FOQA 2V4UA 3QUCA 4AZ0B 1SUCA 1N8SA 1TKCA 4OLFA 2FPUA 3NDJA 2WTAA 2XEDA 4W7IA 3QVLA 3TVDA 4BNLA 5A02A 1FP7A 2OO5A 1U7ZA 5C32A 1ESDA 3SYKA 2EW2A 1WEKA 4CM3A 1RXUA 4RFLA 4EZBA 4INOA 5BWCA 5KTOA 2YRXA 1HC7A 4R1LA 3NOVA 1XRMA 1KH3A 2WVJA 1RRMA 3NJ8A 2QZ4A 4Y2XA 2OXTA 4PO1A 3MZ0A 2GMWA 2N42A 4GXNA 3KJZA 5KKAA 3JQRA 5EMMA 1GG8A 4M1WA 2M32A 4KIFA 3IP8A 3BBPA 4JBLA 3LMKA 5DYGA 4YDQA 2DLCX 2GN6A 3FF4A 2BP7A 2JGIA 1BKSB 2VPWA 3KB2A 1P31A 4ZVRA 4XXHA 3RWMB 4KL8S 4B9EA 3OO1A 3D4BA 4OI2A 2QPTA 3FRIA 1S7GA 2VF4X 4ENVA 2YH2A 3TQQA 3CLUC 2E4WA 2R7MA 1OE0A 2B92A 3EF0A 4HNQA 4X1IA 3VKUA 4A0HA 4W8HA 1GVHA 3BILA 1V1JA 3W5JA 2JGFA 1TUGA 1S2IA 1JYEA 3AB3A 2O57A 3MPUA 1X1BA 4FR5A 1G8JA 3UKJA 5ALVA 3OZRA 1PYDA 3ZGYA 4UXIA 3QLUC 3RYFB 2I1WA 1OFTA 1OU0A 2R79A 3E7PA 4UBLA 3GLIA 3PNMA 1I36A 3O2NA 4JBWA 4BEVA 2Z2JA 3A6HA 4AFNA 4D44A 2BBWA 3RS7A 1UMBB 1YZKA 3AO0B 1RT9A 2Z1DA 4KC0A 2WIBA 3LK7A 1P4RA 1Y3AA 3EZNA 3ZPXA 5EMLA 1ZUD1 1C9EA 2PGDA 1HTTA 4CBVA 3BIJA 1HFWA 3DFKA 1U3UA 1KSHA 2W6OA 1II8B 2OAGA 2XX3A 3UG6A 2F17A 4ENRA 2OENG 1E58A 1AKRA 4FHEA 1GPWB 4KP7A 4Q9JA 2OB2A 5B2ZA 4ARBA 2XE4A 4KXUA 4I1RA 1XR3A 2OBYA 3EIWA 3Q5GA 2UU9B 5J4YA 3ZUPA 2R87A 1OX6A 2F67A 1EJ6A 5HE9A 1WPXA 5IZCC 4Q1VA 5ILOA 2ORVA 2FW0A 13PKA 2HDWA 2J0UA 1JJFA 2PQMA 4F8EA 1DX9A 4ADSG 2HIAA 1WBDA 4R2JA 2QMOA 4ZO6A 1TZMA 2D00A 4POAA 4X8MA 3U1BA 1DJLA 1IWOA 4EY3A 1FFYA 1OHHA 3JRXA 1PNVA 3KUDA 1G55A 4QQFA 1OROA 2G72A 2Q3LA 4DCSA 4D25A 2P4QA 3AUYA 4LVUA 4UNSA 3EH1A 1QHXA 5ECGC 3SU8A 3QEAZ 2J6HA 4DIOA 4G5HA 2AVDA 2UZAA 3N07A 4Q05A 5K20A 5DLPA 4NBWA 4ZOAA 3V8QA 2VA8A 1ID8A 2XZPA 4U2FA 3RJ9A 3KJGA 4D80A 1AB6A 3ENKA 1M6NA 3FMGA 3WSWA 4UE6A 1UDXA 3SQDA 2HQOA 2IWHA 3ECAA 1O9BA 1ORHA 1WTCA 3CCBA 3FLBA 2WMNB 2KYRA 3LVRE 2R8XA 3O8OB 3PUHA 4HXEB 4BO8A 5L7WA 4WXEA 5EWLA 4OD0A 3VU8A 3QOWA 2PT7A 2ZYVX 1DAGA 3U0BA 3TW8B 4HG2A 4TGLA 5JAQA 4D0LB 1I2ZA 4ENPA 2AFHA 2QPOA 2V74B 3OPYI 4PC2A 1HNWB 1QC5B 4EQZA 4QXOA 3V1LA 4P2BA 3ENWA 4RM3A 2JRCA 4Z1MD 2ATXA 1NVVR 3BQNB 3KQWA 4OSPA 2VDMB 5LU9A 4ZREA 2IDKA 1Q0ZA 1P3JA 1XHLA 1Z68A 1WEHA 2WTXA 3A1VA 3EK2A 1QGOA 1Y1RA 2Y76A 2XUJA 1T1RA 1MHPA 1U0HC 3N86A 1HY3A 2E5FA 2R96A 4BJHB 3ZGZA 1PCXA 2GBIA 1WDWB 2V3WA 2DQ4A 1XZDA 3IDOA 4Q9AA 4QRDA 4B09A 1CY0A 4WE3A 3GUVA 4FMCF 4CR8A 1E4EA 1DAMA 2QRUA 2BBTA 3M7IA 3M3HA 4KN5A 3OC6A 1IE3A 4PO3X 2GF2A 3G7SA 5FWDA 4U7DA 4JEHA 3GEIA 5A3RA 2VPXA 2WK1A 1RWNA 2B7BA 1Z2EA 4X24A 1BE8A 1SQ0A 2PYZA 3WTCA 5HP4A 4YCCA 3CPHA 4JVSB 1FMLA 3ZQKA 3PQ5A 4QA9A 1RWQA 3GH1A 1JIJA 5KJ6A 2WTNA 3EZ6A 4PHCA 5L6LB 221PA 4D4HA 1M2WA 3INGA 4TWJA 3E9QA 4H7IA 1I2MA 4Y18A 4WHMA 4F71A 5HIKA 1BQEA 1E9RA 1P9RA 1XMSA 1EK6A 2BGLA 1I2AA 4US0R 2HMWA 2CXHA 1CVRA 2P9CA 4NWIA 1KDTA 2VJNA 1M9NA 1MPXA 3FTPA 5I7WA 4E6EA 2R7NA 2Y4OA 2C1ZA 1RACA 3F46A 5CB4A 3DNPA 3T3OA 2NU6A 2O2GA 1JPUA 4DCTA 4BAGA 1FFDA 2VH5R 1KYZA 4K9SA 4FGZA 2XAUA 4MNTA 5DP2A 4HLDA 2XQKA 3Q8LA 4RIGA 2GTHA 4KR2A 1AQYA 2VT3A 3U7HB 4RHYA 3WGKA 2PUJA 1DTSA 2ECQA 4BMPB 4MCJA 4YWHA 3T7CA 4N5DA 1K8QA 3PHJA 1ZUHA 3NI2A 3J7TA 3JXEA 1UC5B 1Y80A 2AC2A 4IDHA 2ZSKA 3MRXA 2OLKA 4F3KA 4HNUA 3DT9A 2G5GX 2G1PA 4DR4B 2QT1A 3ZW7A 4DRXA 2WUGA 3INNA 4LC0A 2O23A 4AJ2A 4S3MA 3ZR4B 4QNNA 2R86A 2IUYA 5IFKA 5J4HA 1U1FA 3AR9A 4Q6WA 3K2QA 3LC0A 2NXEA 1KHHA 2IBMA 2HL6A 3AM5A 3G0OA 5SY4A 2MSKA 3IS3A 3QPWA 4TRRA 2HSZA 1LVHA 5CFNA 4Q3AA 4IUYA 3OUZA 1JA1A 3CLKA 4U7FA 1EXWA 1JHDA 5IUNC 4N8SA 1RZ3A 3VR0A 3EEFA 1WHTA 1VJRA 2E21A 1GV1A 4FZJA 5LMUB 1OZFA 4XYBA 4AC9A 1GPYA 1V3UA 2O4UX 5E3JA 5FUYA 4D7AA 2GF9A 5BR4A 1LSJA 3ZHZA 3PLAE 1QGDA 1OXUA 1C30B 2HA5A 4ND6A 3RO7A 1NVWQ 1OMOA 3BB1A 4XYGA 4NZZA 2X3UA 1CZLA 3MAJA 3QJGA 2KI5A 3TZ6A 2E7ZA 1ISHA 1UDCA 2YL2A 4LOKA 4LV5B 4MHOA 3FWPA 4UU8A 5GONA 4L78A 3W5UA 3VNUA 3PQ7A 1RPZA 1W94A 1YZQA 1VL2A 4RS3A 4CT5A 1SXJE 1W4ZA 2ACWA 2WJ6A 1XU7A 1E5VA 3A9SA 1HNXB 1GCGA 1RJ9B 1UMDA 1TYCA 1VJ0A 4IRMA 1KQOA 3MYYA 5DYWA 5GM1A 1JZSA 5J2TB 4ARZB 2C5FA 5T5QA 1R00A 4LXTA 1PL0A 3ZBUA 2NSJA 3R3WA 5I4BA 4DMCA 4Z1OA 2EGHA 3DD1A 3P97A 3SEZA 5JC8A 1EXVA 1N6HA 4X5OA 3W5HA 4BWGA 1E0JA 1H94A 1B8VA 3PWSA 4D41A 4YRTA 3W6ZA 4E07A 3RTCA 5LLTA 1E98A 4WQMA 4FHFA 1C14A 3G1TA 3GQBA 1A2BA 1JEJA 2FPIB 2GPTA 2VQ3A 4PLWA 4QNMA 1P19A 5FAXA 5GINE 3FG9A 2B78A 3K5WA 4FE4A 3KSMA 3EGOA 4HS4A 2JKZA 3BXZA 4JX8A 5I7RA 4I7EA 2P6RA 3NRCA 1J97A 2FQXA 5C7LO 1Z2CA 4MW5A 2IPLA 4HQLA 2EJBA 4BJ3A 3V2GA 2LBPA 5BSVA 3HWWA 4CF5A 1JMYA 2WG1A 2YXEA 1SU7A 1XYGA 5JPIA 4Z3DA 3UANA 2YV3A 3OY2A 5L53A 4II7A 3SXUB 4JROA 3C4JA 4X60A 1NT2A 2Y8EA 4KVZA 2RIRA 5SY6A 2OCLA 4K9PA 1M8KA 4OHRA 4R98A 1XFAA 3F8TA 5BN3A 2ZTSA 1LTHR 2WUVA 2ZSHA 4CIDA 1LCIA 2PS3A 1GPBA 3M5WA 3EZGA 3NASA 4NOLA 3UMBA 1QDEA 2CZCA 3R24A 1PDVA 4YV2A 3TLZA 4ZI3A 4M0LA 1SNYA 3E0QA 1MBZA 3QUAA 4OGFA 1LWNA 3C1UA 4NH4A 5AW5A 3MRTA 3FOBA 1TU4A 3I9KA 2F64A 3R4VA 4MA5A 1K7FB 3RM3A 4E2WA 4RMHA 4BWFB 2JCBA 4GP6A 4LECA 2PFKA 4EJSB 1WV0A 1WIWA 4AMGA 4JR1A 4FMDF 1PL7A 4GX2A 2WJAA 3D7MA 5BT8A 3DTTA 1IHYA 4KBYA 4M9QA 2WUFA 4YJ2F 1YU6A 4TZKA 3NWPA 1YL5A 4LBZA 1SJ9A 5CMLA 2XYPA 1NAIA 3G2MA 2P4SA 5I8WA 3KE8A 1EVIA 1AQNA 1GDDA 3V8RA 4B81A 2AGVA 1CEQA 2ZT5A 3F1LA 1MJGA 2XOKD 4XRRA 4YJGA 4ZO7A 3HADA 1AXEA 1X15A 4LJ5A 4Z3KA 3HDVA 2P6OA 3V4OA 1J0EA 1M54A 2ONCA 3L41A 2WWTA 1ZIYA 3QTBA 4EHKA 3VPGA 1K27A 1U9CA 3GAAA 3ZHOA 3OJCA 2O2EA 1HRKA 3L18A 1Y8QA 2HO4A 2W93A 5DYIA 1O6FA 1OZHA 2GETA 2E5WA 2JEOA 2QQ0A 2XD4A 2FZEA 2Z30A 4ER0A 5B36A 2ZBQA 1DMSA 3FY4A 4P54A 3CUEF 1VBMA 3EVTA 1P3Y1 2JHPA 4F8YA 4ARSA 2PO7A 1JU4A 1N2CA 3BICA 4CF3A 5LQUA 5BT9A 1E3WB 2JZCA 1U6IA 2I8AA 4M88A 1ONOA 1E66A 3SX2A 4K7JA 4CETA 2AJBA 2REQB 1O9GA 5MGBA 1ZHFA 1TYDE 4EL0A 4EQ6B 1VLQA 4WADA 3ET5A 2R00A 3HU5A 4B2PA 2Q5LA 3HVIA 2QLNA 4LYFA 3IXLA 2XMQA 3BVPA 4I5FA 3FUCA 5A2QA 3RJ5A 5TMPA 4NJOA 5TMDA 3RYFA 1KYVA 4DLSA 5JW6A 3BXPA 2Q3DA 1NPDA 4RKRA 4M9SA 1F2DA 2BFAA 4KQHA 5EOVA 1S2GA 3FCUB 4HDKB 4TYYA 3OT1B 4FNMA 4RMNA 1AKQA 3G0IA 3LU1A 4BO5A 3DTVA 1T2AA 5CT5A 2H07A 2Q1TA 1MJGM 3IAXA 5DFAA 5IABA 3R9XA 4C08A 2WWXA 2YXDA 4MSUA 3W04A 1JIQA 4L9RA 3C85A 2QVYX 3DXZA 4WZBA 5AXAA 5JJBA 3ANXA 3KKPA 1HM5A 5JD4A 3SZ3A 4W5WA 4DEVA 1MO5A 2E89A 3LPDA 1NW6A 1QOQB 3IURA 4UAJA 3FGOA 3IUSA 1Q14A 2BP7B 4FFPA 2R8BA 4OA8A 2JGAA 1C7RA 3O4HA 1AHHA 4WLEA 3A36A 3E03A 5E3HA 3JYNA 3AP1A 3DM9B 4J0KA 4IL5A 1ACLA 3N8IA 2MINB 3JD0A 4B3XA 5A0TA 3OOSA 1OHHD 3EQ9A 1P2FA 3SJUA 3OZFA 2XMZA 5TS3A 3O2SB 4QYIB 5ITZB 3ZGXA 4YBZA 5ALHA 1LS1A 1BHJA 3PZRA 4QDTA 2N3ZA 2QAGA 4N5IX 1NW8A 2A84A 1WCXA 1H3NA 1FX0B 1RXIA 2VH2A 2RHTA 4JBGA 3LY7A 1UP7A 1SPXA 1Y6RA 5KMGA 2IUSA 2W48A 2P3QA 3QH4A 4UHCA 1DARA 1DEAA 1XRLA 2PUAA 4RZUA 4BVJA 1N5OX 1X1TA 3U49A 4UCQA 2VSOA 3U5TA 4JI7B 2IHBA 1Q1GA 1G5IA 2G4VA 4B4KA 3NM5A 2VT6A 5CB0A 2D2XA 3NH6A 2VHVA 2AR9A 1JSRA 4RPHA 5EP2A 4FYVA 3KKKA 4DGQA 1LB1B 4YJ2A 2ZJYA 4IZOA 3R7BA 2YBDA 1GP2A 2A0XA 5CDUA 1RWKA 1YACA 4BX3A 4DJEC 1G21E 3V4ZA 3WAGA 3FSGD 1P5RA 4AKGA 4B2IA 2WQ6A 1Y7TA 2AWOA 2XLCA 3K7EA 2VTBA 3A2MA 1RQPA 4J4BA 3U44B 1T91A 1W46A 1DG3A 4WLNA 1HYGA 2BDUA 2DWUA 1RXYA 1HYEA 1DT3A 1I13A 2VBIA 2WSMA 2QJTA 1YQUA 1L7EA 1ISSA 2I66A 3HO6A 4M1QA 2J09A 1F2UB 2O1XA 2RGBA 3BQMB 3AM4A 3BSYA 3DDHA 5BNTA 2JLWA 1J20A 1JB1A 2NUPB 1PR5A 2ZTMA 2XCUA 1CRLA 2XECA 1ZH8A 1C7QA 1M1ZA 1S96A 2ILVA 3STYA 2BGIA 3O47A 3P96A 2DHQA 4DLRA 4YO8A 3NQ41 1NI4A 1VCNA 3L49A 4YCLA 4DCNA 1OILA 4AKEA 5JAMA 1W581 1APBA 2ZIGA 1DVRA 3GJ0A 3QVOA 4LYGA 4MW4A 1R0LA 2JL1A 1ESZA 1NG1A 2QGZA 4P86A 3R44A 1ECLA 3O2JA 5AJTA 1YQGA 1CY6A 1SELA 3H65A 5DASA 5IMBA 4H08A 4GYWA 5K0BA 3KJEA 2PWBA 2UKDA 4ND1A 4DNPA 2YWJA 2WILA 3MQ2A 1FXWF 1OX5A 1WM1A 3NHLA 4JSRA 4XIYA 3RC9A 3Q88A 3M3DA 4C4SA 2PNJA 1TYZA 4JLPA 3LO5A 4N9WA 1EDEA 3L0BA 1Q74A 3ZEIA 5IZ4A 1CUGA 2I3DA 3L1KA 4D0SA 3DCJA 3QX9A 2Q3BA 4MPJA 5CAEB 1LKZA 5LZ9A 1PR6A 1PR9A 1YUNA 1ORTA 1U65A 2D4AA 2C9MA 2AI2A 2ZSFA 1OI4A 2Y1LA 3QLVC 3V00A 2E9SA 3AY0A 4OYHA 1Y9ZA 4G1BA 3ZDDA 1DG1G 1GEGA 1HT0A 4NF2A 2MSNA 3L4KA 5DXFA 4FWBA 2VUTA 4F7WA 2OOKA 4AYWA 4UULA 4F12A 3FN4A 4TTTS 2HWXA 5HRCA 1JP7A 1SBHA 2VP6A 2RD2A 3V5NA 4ZTUB 1TJ3A 1NJ2A 4PX5A 4PE5B 2WJHA 1AB5A 4JC4A 4X6UA 2V6GA 3PUIA 4UUAA 3ZNNA 2B8EA 1I6MA 2D62A 3DBIA 3LHDA 3SCZA 4BTEA 3O4RA 1ISFA 1BS9A 3IMGA 2XWSA 4RVFA 1CW2B 2XD9A 3RBZA 1XF1A 5ITVA 4PQFA 2Z98A 2AOUA 4RYLA 5E9JA 1ISPA 4URXR 2PDAA 2VXCA 3THOA 4E12A 2AXNA 2UZ0A 2WNIA 2BKUA 3JR3A 1ISJA 5I4CA 5LOVA 2NYRA 1J8VA 4NDAA 1WP9A 8MHTA 4HB0A 5ALYA 1CUAA 3HKCA 4OVKA 2R1ZA 5KQPA 1PJQA 3O8QB 4RZSA 1HNZB 3ZXUB 4DTIA 1XTTA 3PNLA 1L4KA 2XWBF 1Z28A 2IEBA 2IXFA 3GFGA 4PG5A 4K8OA 3NVMB 5IBQA 5A3VA 2YY5A 4A10A 4UVEA 3EA4A 4BC1A 4EJ2A 1BCRB 4QGFA 4URZR 1IIRA 2YS6A 2ZPUA 4K2AA 1V3TA 5JWHA 2WPDD 5EFZA 1ZM7A 2NO7A 2IXEA 3P9XA 4IQGA 1JIKA 3MB5A 2VJMA 3JRNA 4D4JA 2MMCA 1OGYA 3NDBB 4OJQA 1N7IA 2JI4A 2QAGB 1XZLA 4RKWA 1RLUA 4RMIA 5J4LA 2ES4A 1IN7A 1TQ4A 1ZRSA 1HXHA 2BKXA 2X40A 2ZB7A 3ABIA 3IUMA 4NYMR 3VKFA 2YJ5A 2HOQA 4J0HA 2J3DA 1CV2A 1CQJA 2PL3A 2ZCJA 3H5VA 3V2IA 3EGDB 3QQPA 1G7RA 1E6EA 2WIFA 3AV0B 3FFBA 4ZYZA 3GNSA 3CX7A 4AY5A 3E22B 3CU5A 4AD8A 1E61A 2DVMA 1O5TA 1E92A 1ODJA 1W4AA 3BSFA 3FW1A 3GFOA 4Y1EA 1KEVA 1I94B 1FK8A 3JQBA 4IIJF 1YH3A 1TLTA 4K9RA 5FYQA 1Q44A 3WYAA 5F4BA 5AVRA 2G6TA 4IKPA 4LDZA 1NU8A 1E1CB 2V4ZA 5FA8A 3OPMA 3QMMA 4DBLC 5C8XA 4WVFA 1TZBA 2O0HA 2HC9A 1DKRA 2FUEA 1YJ8A 4MI6A 1DBPA 5JDCC 3GVIA 4IXNA 5I48A 3FPFA 4TXMA 1Q0RA 1SC3A 3B51X 3UWKA 3LYUA 3U44A 4O1HA 3VVBA 3DKPA 1AZLA 3D3WA 3E5HA 4G5RA 1L4FA 5EXTA 4ERNA 4ZGGA 1KH1A 1MXHA 1PN3A 2QF7A 3EDYA 3FYTA 1YQWA 1CJBA 2ABWA 3PKIA 4PSKA 4W9NA 3QPUA 4K9LA 4UMVA 4EG8A 3RAEC 4OXKA 4KB5A 3AX6A 3AHJA 3QQ5A 4P7BA 3VOSA 2Z3VA 4QXQA 2H63A 3VYTB 1F4PA 1ZH0A 1P77A 1TPZA 1FUEA 2IEYA 3AETA 2JEZA 4FWIB 3THWB 4NHOA 1U2SA 4LF4B 4C7OB 3CS3A 1NHWA 3A9UA 1YUMA 4IW3B 5PGMA 1NQVA 4J43A 1BWPA 1EUCB 2Q6VA 3JYLA 3MJSA 3EAGA 4JODA 1XVAA 4P3NA 3H83A 4MS4B 1C4KA 3E3LA 3G2HA 1E3TA 4JLWA 5CUQA 3REQA 4LNAA 5HTKA 3IJEB 1OXVA 4QVGA 2PN1A 4NOJA 4EAAA 3KE9A 1C1DB 5H1YA 1E2KA 3DLCA 2ODBA 5JCXA 4PGMA 5EKTA 4KQJA 1RZRA 3TG2A 3GPCA 3VSBA 3WL4A 2AE2A 3VM6A 1ODSA 4QHYA 2ZIAA 1CF9A 4HWTA 3PSHA 1PTJC 1B42A 3GCGA 4AROA 4CQJA 4F21A 1KWGA 1U0GA 3SG0A 4ZGBA 1IN8A 3HKBA 5ALRA 1GTRA 2WU8A 3LDFA 1ZISA 1QTIA 4EPWA 3KCQA 2OV6A 4LHVA 3O38A 1Z7WA 2YVUA 2QL5A 3NC0C 2VVTA 2ZWPA 5CK5A 2FETA 5MFZA 2VHQA 2OZPA 3X1JA 3EBOA 1QKJA 4JXJA 3WOHA 3CR7A 2NTYC 3IAFA 1Q1BA 1QK5A 4ND2A 4BFTA 2AQHA 2EOAA 4PG4A 4Q47A 5JMTA 5CIYA 3LP8A 2E18A 2WWWA 1FA9A 4ZV9A 4FDAA 4FDMA 3M1LA 2CNWA 3UK0A 1FF9A 1X7GA 4JR0A 1OPRA 4TLBA 3DPSA 3URKA 3D8TA 4YCMA 5L3VA 2IEZA 4LF6B 2WWFA 2I78A 1G8MA 1O87A 2JD0A 4X66B 4G0WA 5EZSA 4O29A 1P4GA 1ZA2A 2FPRA 4YJKA 5EAIA 3ZWYA 3BC1A 3CRW1 3IILA 3A7EA 3G7NA 4P9NA 1PUJA 1DKUA 4H1WA 5KSWB 5KU7A 5F1OA 1GPJA 3BGIA 1XPOA 5I7FA 4IWYA 3T1YB 4CMKA 1USIA 4DCJA 4HQNA 4OP1A 1ZH6A 5LP1A 3DOUA 3GLKA 4G0QA 1E7QA 5H3CA 2G17A 2XODA 3PHIA 2BJHA 1BS1A 3JTMA 4YS6A 4B7ZA 4HXGA 4C14A 4Q4LA 2GPWA 4KFSA 4RPGA 5AK5A 3ZCUA 1A8UA 2HRRA 4NU6A 1TKBA 2Q49A 1QF7A 3ENNA 4UMDA 1Q6YA 3A6EA 1BKYA 1VZ2A 3QYAA 1T6NA 3EDRA 3MMNA 3STHA 4B3RB 3E7WA 1JX6A 2GCIA 3P94A 1A9XB 4Q5IA 8ABPA 3K71B 3ESZA 5K0ZA 1SQ6A 4PHFA 4JQOA 3T3HA 1Z4NA 4LHEA 1VRVA 2CJWB 3R3YA 2J5RA 1C1HA 2WSSD 3WGIA 2D3WA 3SC6A 1B16A 5ALIA 5LA6F 3SEFA 4X0EA 4KACA 1FLDA 1A04A 1FFBA 2RCNA 2IH2A 3HCPA 2VPYA 3VDMA 4YJGB 4S1OA 4G65A 2C0QA 2NYUA 1Z7BA 4LMPA 4TX1A 2IDMA 4X3OA 3T99A 3X2SA 1MMFB 4MS3A 1WSBA 1ZJYA 1D3AA 2YICA 1RNLA 3FH0A 4NCNA 4RHFA 5IUJC 3SWWA 1EFVA 1ZCZA 4IQ8A 3BXEA 4OMCA 1G66A 2B94A 4EI2A 5JS6A 3LNTA 1KGSA 5I7OA 1G98A 3GLRA 3LLMA 4L5CA 2J5KA 1K8XB 1N2IA 4IJKA 1TK2A 2XUKA 2WKWA 3UJ7A 1NQ5A 3BXFA 4L3VA 2ZWOA 1HDRA 4U4AA 1NFQA 4QQ8A 1A3CA 2J3IA 5EZYF 4ER5A 3RYCB 2WD7A 1GNRA 3HYNA 4WNYA 3FVWA 4EHNA 3WLRA 3SFVA 1KL7A 1I0IA 3FZQA 4QFMA 1X9GA 3ELWA 4CLRA 4Z9FA 3BMOA 4DIUA 5ICMA 2QVZX 3CEPB 1XYYA 4AJHA 2Y0BA 3WGNA 1XMOB 3LHKA 5ARCA 3WJAA 5I3CA 1W4LA 1UF9A 2GNPA 4IDPA 3VV2A 1DBQA 2IXGA 3AF2A 5HDQA 3ZV6A 2V7BA 1ZS9A 2OCIA 2QYHA 3JWHA 4UASA 1Z0AA 4ZCSA 3F2VA 3ZS9A 5JUWA 2DTXA 2I3BA 1QQ7A 4X45A 4BTVA 5COAA 2AW3A 1XN1A 2UVDA 5EWMA 2WZCA 2B21A 3EGCA 3B5EA 3TKLA 1Z5GA 1J2JA 4JP2A 4XEUA 1ZD1A 3VFDA 3B3FA 3OE4A 1SCUA 2JFWA 5BMVA 3U3JA 1RM3A 1T4CA 1ZAKA 3OVMA 5EJ2A 3T9AA 5AQEA 4W1SA 4B3GA 1N0VC 2V5VA 3OIVA 3QELB 3WG9A 2Q4OA 1F1BA 1S0UA 4FNOA 4MVWA 2IIBA 4Q4JB 3HRKA 3OM0A 1Z8NA 2K87A 5BW8A 5CA1A 1TVKA 3DLAA 2DGDA 3OZBA 3TZEA 3RHSA 4BJ1A 4G5OA 5DKFA 1OLUA 4P82A 4R3UC 1YXMA 2H11A 3I01M 1BEZA 2FW8A 1CYDA 4DQXA 1PFYA 1RJDA 4JHLA 1AKWA 1BE0A 1I3CA 3QBDA 2OXEA 5JV5A 2PBFA 2ODWA 3VR6H 2OO7A 1WA5A 2LKCA 3CMMA 3CZQA 3H8JA 1ZCJA 4LHSA 2P2GA 2ZQYA 2OV3A 2YV4A 3F8SA 4ND3A 4CXMA 4ZK6A 1IOLA 1QZ3A 3WLKX 4W6ZA 2DBVO 1W36C 1G9TA 2V9PA 3BB3A 2FSPA 1NNI1 5T57A 4QBIA 3RTBA 1Y7LA 2QTVB 3KJXA 1DJPA 1P4SA 4YLGA 4NH0A 5BRAA 4L76A 5CGZA 1LFAA 1FIUA 4XQEA 3NXKA 5B58T 4IS3A 4JFRA 3C4VA 4YQZA 2WFZA 3MWGA 3U3OA 3ZHQA 4DREA 2C5AA 1WULS 1PNTA 3S2IA 3PUKA 3U56A 3VO1A 1YA6A 1EFRA 1S2LA 1AN0A 1Y0BA 2H2DA 4XVCA 3KQMA 3M6FA 2GPJA 3ONEA 5JCPA 5BWBA 1GZUA 4GXRA 1W85A 1DZIA 1SUAA 1N5DA 1Z2AA 4LJ6A 3K9GA 1RBMA 2Q28A 3FSEA 5JD5A 3U26A 1ZM3A 3IUNA 4XB2A 2R0QC 1U1IA 3AINA 2FN9A 4NV0A 3DLPX 4LXYA 1XP5A 3FLAA 1G8HA 5ALZA 1KO5A 3GFRA 4DHWA 2OV4A 4QDXA 3R6WA 4DYHA 1RWMA 3M2TA 2QN2A 2ZUBA 1A4XA 1WHTB 2PA3A 1O6BA 4NENA 3B3JA 3QPBA 2ZI9A 4F9EA 3EEBA 1QPGA 1ICIA 3PYLA 4WGFA 2O2IA 1FUIA 2HMVA 4EA8A 5DXAA 1EA7A 4WCFC 4WKCA 3A9VA 2Y92A 3HNRA 1KZ1A 1MT0A 3PFHA 4M55A 4NTZA 2BZ0A 1GU0A 4G5YA 4OXRA 3U19A 1CR2A 3ZDBA 2F4VB 5TJHA 3SJZA 1H2AS 1LQ2A 1OU4A 4KCGA 3VH3A 3ZHBA 1F7UA 2VF5X 1A9OA 4EDHA 2TRSB 2XIQA 1E4OA 4DKXA 1QQBA 1G2IA 2CWWA 3B20A 4OHMA 4AUMA 2AD1A 2JHCA 5HKBA 3AVXA 5DCUA 3W34A 1ESEA 2X76A 1PDWA 3GJQA 1IZ9A 3DOJA 1VCOA 3KD2A 4KKVA 3DDSA 5EE9A 5HSGA 2W58A 2CDAA 4C5BA 3MXOA 5CPBA 1P6UA 3ZW9A 3KXDA 4Q4AA 3KRTA 3ZC3A 3HA5A 5A71A 1EUYA 2GHQA 1NU6A 4EIWA 4PU0A 2YRWA 2B4RO 2JFYA 1PZFA 2DAPA 1F48A 2IY9A 3A37A 3NATA 1QP0A 1I6LA 3R7WB 3SLGA 2ZRHA 4NATA 5K0NA 1EE2A 1WZCA 1U4SA 2I3GA 3LA8A 3NHPA 4Q7LA 4FEAA 4B4OA 3KOOA 1IZYA 1CUEA 3IP7A 5JWRA 2VZ0A 1PSZA 2VJMB 3OG9A 3QE2A 2E4UA 2VPQA 3LQQA 3W5SA 3IQFA 2Y4NA 3QBJA 3T7EA 3DZDA 2IDZA 2NSYA 3V7WA 1HZZA 4B7UA 5C2JB 1V39A 2YQZA 4TV9F 4JLVA 1NI4B 3L02A 2HRCA 1T5LA 4BGDA 1R4MA 3GZJA 1GCOA 5CLIA 3L7LA 3HBLA 6PFKA 2HWWA 2JJ2D 1SO8A 1SUFA 5HKKA 3NUZA 2Q6OA 3ZY3A 2LIPA 2PJRA 3ESAA 5LXTB 2QW0X 2YNMA 4OFZA 2FKNA 4D3DA 1E4EB 8LDHA 3VO2A 1BX0A 4CU2A 1E9DA 2COEA 2I2AA 2Q6LA 1NTRA 1FUYB 1ZNWA 3GJ4A 4XD7A 3UAXA 2WWIA 1TIPA 1UQUA 3MC1A 2W6PA 3AILA 2BFPA 3DTVB 3PQDA 4FPXA 3RE1A 4YUXA 1DV1A 4JGIA 3AWIA 3NAMA 3RRYA 5ERXA 2W6JA 3GD5A 3MHPA 1G2QA 1L7OA 5CVUA 5IYZA 3E18A 1ULZA 4I50B 3WB1A 1QYIA 2WSSA 2KHZA 1VIAA 4NCKA 3C5VA 5TT0A 1JA9A 2OZEA 3T1TA 3DS8A 2OECA 4BLPA 2OD7A 1C3VA 1SUPA 4QDUA 3LUDA 1G42A 4IDAA 4K6KA 4UBNA 4TMWA 4M1OA 4AY2A 2O2DA 2WD8A 1PQUA 2OBLA 3HJAA 3QBVA 2REQA 4GZ5A 1H1LB 3WB9A 4ENQA 1SULA 1N92A 2IKQA 4CF6A 4N1AA 1YA4A 2K7FA 5T67A 3T7KA 3BDVA 1KYWA 5GOTA 3H5IA 4AL4A 4RLSA 3R3JA 4MARA 1MJHA 4BNJA 4QDJA 5B7PA 3QNUA 1Z7GA 5DM2A 4JJ8A 1Q6ZA 3EGDA 4D3SA 4GI7A 1EGAA 1R4MB 1U8YA 3KV1A 4QQRA 4U6SA 3UO8B 2QX6A 2PAFA 4O63O 1CY7A 4EFLA 5HRAA 5K5EA 2AG5A 3OLXA 2ZUCA 3OX3A 3OCVA 2ZUWA 2XY4A 4M0UA 2WIAA 2BEVA 4B31A 1YFLA 3WRYC 2PEYA 3CLRD 2VFAA 2ZLBA 3DVRX 5CFMA 3VNBA 3K0CC 4KPGA 1SEPA 1PLJA 2C99A 3K96A 1R37A 3FVTA 5HZGA 1CIVA 1GR1A 2J1LA 3RU9A 3N59A 5IWAB 1QR6A 3TJMA 3TS1A 1XHFA 1U99A 3HXQA 2ZJ0A 3RK1A 4TTIA 4IGFA 3JWEA 2AZDA 3E82A 4JK3A 4FB5A 2PUBA 2OORC 1NBMA 1NJSA 1RFLA 2J0SA 1D1QA 1GG5A 4EB6A 4LGMA 2XUIA 3OZAA 3LL7A 4CM5A 2FG7C 2DE0X 2JRLA 3EQZA 1B76A 2BFCA 3KFLA 4ZT4A 4E22A 5JS7A 4X71A 1G3RA 2DPHA 1RQGA 2FWMX 2Z8XA 3THWA 2RG1A 1T24A 1Z0DA 2M6KA 1E9BA 3H4MA 4HPWA 4DQ0A 3UPUA 4JVNA 2BFWA 1LJLA 2HSEA 1RLJA 5L3ZA 4O2BF 3OX2A 2RE8A 5AW0A 2ST1A 3EXEB 2AL7A 3CO0S 1R0YA 3UT0A 1QJCA 5KOHA 5AJUA 3VNQA 2O50A 4UDYX 3RVBA 1PU2A 4MS1A 3WYFA 4QVKA 5T41A 1X6VA 4KLRA 4HO1X 5EPOA 4DANA 5H83A 5FI3A 1D0IA 1ORWA 1JQ3A 3HKEB 2DPYA 3RK0A 1BSVA 3K0HA 4YIKA 4EFNA 1X38A 2DCMA 4M0FA 2DQKA 3NHZA 3PJGA 4LRSB 4X84A 4LFBB 2VDOB 2BTOA 5FO1A 4DCUA 5KYKA 4PX9A 1N8TA 2QUKA 3TRFA 3GEDA 2HQBA 4CI0B 1UDRA 2MTBA 3K9BA 3L8YA 4FOSA 3I30X 1IMJA 3ER6A 3U4HA 4ZMSA 1KU6A 1X7ZB 4BB6A 4D9NA 4CIWA 3IQWA 3TXYA 3S7TA 4M60A 5HMLA 3VNAA 4AS2A 3LK6A 1SB8A 5JMPA 4EO7A 3KKLA 3OJOA 1AGPA 5LDDC 2R68A 1RHJA 1TM7E 3HR7A 3LCUA 5HJEA 3E58A 3KAPA 4DJFC 4NV1A 7YASA 3HUDA 3SR4A 4KV9A 4B79A 1MC8A 1GPKA 2J9ZB 5GVRA 4DZRA 2I91A 1MO2A 2XE6A 2Q62A 4JLAA 3B1JA 4PLTA 3DE1X 4K1XA 1P2GA 2I0FA 3FFTA 3HP7A 3UIEA 1KQGA 4N76A 1O08A 4IIXA 1N0WA 4RQTA 2ZVDA 1DDIA 5JECA 2AMYA 1Z4JA 3G59A 4P3OA 3AP3A 3H1EA 3T6KA 5KYYB 3WHPA 4QO8A 1EVKA 2A86A 4OFBA 5EHIA 1JSXA 5DNYB 3U9LA 3WL7A 2G1UA 1XQVA 3MM4A 3EGWA 4CTOA 1XCPA 5DP1A 3ZLVA 4PLGA 4C7XA 4RD0A 1V1MA 2GERA 2C4KA 5L3SB 1F4VA 2LZ0A 1JXMA 2JKVA 3GEHA 4ZCRA 4RTSA 2UZ3A 2A30A 4DSTA 3OQHA 4UFPA 2QTGA 4OUDA 5HA5A 1RRCA 2BN4A 3UXHA 2AZTA 2H1VA 2QIPA 2XADA 3E3NA 4MTCA 3DAHA 1XJ0A 1JAZA 4M1TA 2GDZA 4RSHA 3TDMA 3B7PA 4B75A 3MWLA 4BDTA 3IR7A 3L92A 3N74A 3BD8A 4IY1A 1GUFA 3QKRB 4QUAA 4R3NA 5AKJA 4QASA 1GA4A 4C3UA 2HDHA 1P1CA 3Q7QA 1A82A 2H3HA 1QKIA 3F71A 3K0CA 4JASB 3WO0A 3AHIA 1ZCFA 4CQMA 4GPIB 1KFCB 1J39A 1J70A 3PQEA 3AR5A 5EWMB 3VZSA 4KX5A 1VG0B 4REQA 1YBHA 4UU1A 1B6SA 2FVYA 6REQA 1FLAA 4PRKA 1D2AA 4EENA 1U0LA 2IQ5A 3RIGA 1KZ6A 3IBCA 2R6DA 4OP2A 3PJDA 1VKRA 2OG2A 2P2CA 3R7AA 3FVRA 1GCUA 4DIEA 1ESCA 1IU9A 3M6AA 1G8PA 3A6DA 4A91A 1QTRA 1Z0FA 1YRQA 4LZPA 3DZKA 5EYPA 3TIIA 2NW6A 3PC8A 4NPAA