3MXTA

Crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
283
Chain Sequence
AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Crystal Structure of Pantoate-Beta-alanine Ligase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
total genus 91
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3mxtA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mxtA01
1WXEA 1T6ZA 1K97A 1TQ8A 4MVCA 2WQ7A 2GM3A 3RFFA 1P7PA 1N2HA 1EUQA 1VBNA 1JHDA 4MW0A 3IDFA 5KCMA 1WXIA 3CR8A 1SURA 4EG4A 3TZLA 1I6LA 5LM3A 2WB2A 1J1ZA 2J4DA 1NUTA 4MVXA 4ZT6A 4RUKA 3TQIA 2NSYA 4MUKA 5H16A 2E0IA 2VXOA 2C5SA 1QTQA 4MUNA 4CDMA 1QRUA 2YY5A 3RJZA 1V8FA 4Q16A 4EG3A 4NAHA 1DNPA 1EJ2A 4MW4A 5H7XA 3CA8A 4F4HA 3H9CA 1LI5A 1M1ZA 4ARCA 5IJXA 4MUHA 1J21A 1YI8A 4J75A 3X1KA 3MUEA 4QBTA 1EFPB 2J08A 2X0KA 4MUGA 2R5WA 4MW6A 1H3NA 3RK0A 2XRYA 4HPWA 4MAFA 3TZEA 2CV0A 1N2EA 3FDXA 3COVA 2VTBB 4CT0A 2IELA 3X1JA 2QTMA 1U3CA 3DPIA 2Z09A 3RHSA 2A84A 4YP6A 2CV2A 4PY2A 1QRTA 2A1TS 4DJAA 1R6UA 2V0GA 3IVCA 1WKBA 4HJXA 2CYBA 3IVXA 3GLVA 1KQOA 2QJTA 3KT8A 2DEUA 1N75A 1H3EA 1G59A 1T9GR 2X3FA 1JILA 5TGTA 4KPUB 1N2BA 5TEWA 2O8VA 3OTWA 5DEOA 1Q15A 4PBSA 3ILVA 3H97A 5K0SA 3Q10A 4J76A 3SZ3A 3SDBA 1VLHA 1G8GA 5DK4A 1GLNA 2YWCA 3ZUGA 1O96A 2CSXA 4MUFA 5K0TA 2TS1A 4DDMA 2CT8A 2VTBA 5AHWA 4OUDB 1O0BA 3COYA 3CLTD 1KH3A 2CYCA 3PNVA 4WNYA 4E1AA 2H29A 2Z08A 3PXUA 4ZT3A 1ZH6A 2X1LA 3N9IA 4HK4A 1IQUA 3TNJA 1MB9A 1GTSA 4DE5A 3ZGZA 3UY4A 3KT6A 5J5AA 3P0IA 1NZJA 1HYBA 4X0EA 3CLUD 4ZCPA 1OBHA 4EG7A 2AZXA 5FNZA 4RPIA 1ZH0A 5J59A 3N8HA 1O94D 1NUSA 3FIUA 4GRIA 1M8GA 3P0HA 4MUIA 3G59A 1N2JA 1IH8A 3A2KA 1B6TA 1I6KA 4L2IA 3MXTA 3VGJA 4MW2A 3UOWA 1OWPA 1JZQA 2WQ6A 2V0CA 4NDAA 1TYCA 3H9BA 4ZCRA 4QREA 4MLPA 1T6XA 2QTRA 4XSVA 3FWKA 1NUPA 1GTRA 2D13A 4DDKA 3RBAA 3NBKA 1IQRA 3INNA 1MAUA 3E27A 3HFJA 2YXNA 3ISJA 1M8FA 1NUQA 3CLTC 1N2IA 1K4KA 2IJGX 2PFSA 1T9GS 1U3DA 2PZ8A 4G5FA 4MW9A 4MWBA 3IOEA 4MWCA 2CYAA 2HZ7A 2JAXA 1N2GA 1U7DA 3LOQA 4U7JA 5HUJA 3CLUC 3FI0A 2A1TR 3ND6A 2PZBA 3IOBA 3CLRC 2AKEA 1TYDE 4P2BA 1EFPA 1PG2A 3G5AA 1KP2A 1O94C 1KR2A 1G8FA 2IP1A 4K03A 4PBRA 4JXXA 2X1MA 4MUJA 1J20A 1WQ3A 4WSOA 1R6TA 3M5WA 2RE8A 3AIIA 3NBAA 4I6EA 1YIAA 1O97D 3HZRA 1D2RA 3HMQA 4BWVA 5IHXA 1WY5A 4DLPA 4YMIA 5HG0A 3RK1A 5KHAA 3AL0C 1V47A 2NZ2A 3DV2A 3CVYA 1KAMA 3P0JA 3IMGA 2AG6A 1JIIA 4MUEA 3CVXA 2DUMA 1O0CA 3IMEA 3TS1A 3HL4A 1GAXA 3QE4A 1M83A 3CLSC 4Q93A 4EG6A 4XFDA 4F3RA 2JANA 3FY4A 4MW5A 2DR2A 4JFAA 4JXZA 4MVWA 1GPMA 3LCJA 1IQ0A 4KR7A 2DLCX 1ZUNA 1OWOA 1WXHA 1WZ2A 2E18A 4U63A 3JXEA 2EL7A 1KP3A 1YULA 1G8HA 4MW1A 5J58A 3VRHA 3PNYA 4NZPA 3OP1A 2HGZA 3MLBA 4AQ7A 4XFJA 3K9WA 5TS2A 1N77A 1EFVA 4S1OA 3COWA 3IH5A 1WQ4A 3C8ZA 1ZJWA 1XJQA 4YP7A 3GMIA 3G6KA 4OUDA 2JA2A 2QJFA 1LI7A 3FOCA 3ND5A 4EG5A 4MULA 3X1MA 2RD2A 1IFXA 1PFWA 3IUEA 1KH1A 2B7LA 3ZXIA 4R2MA 1TYBE 1VL2A 3HV0A 3UMVA 2O5RA 5FO1A 2BYTA 1GZUA 3MLAA 4EFKA 4PBTA 3H99A 4ND7A 2A1UB 4ZCQA 4AS1A 3UK2A 1X6VA 3ZXSA 1U0BB 5TEVA 4QRDA 1UFVA 2CUZA 3DO8A 1WXFA 4KPUA 4EF6A 1T6YA 4YBRA 2Z3VA 1N1DA 1LW7A 4ZT5A 1JEEA 3GUZA 4G6ZA 3HGMA 3U1VA 3BL5A 5JBNA 1QJCA 1OD6A 2PG3A 3KFLA 3ND7A 3Q4GA 3ZJTA 3CLSD 2CV1A 1NSYA 4L2IB 1JIKA 2I1LA 1K4MA 4NAUA 4DNXA 4ARIA 3UC5A 1PFYA 1O96B 1Q77A 1TFUA 3FNRA 2GKSA 5EKDA 4EG8A 3AKZA 1OBCA 5LFAA 3MMXA 3FETA 3CVWA 3F3MA 3AFHA 1MC1A 1MB2A 3K32A 1YUMA 2DETA 1COZA 2A4MA 5F23A 1F7UA 1O95C 3ELBA 3S3TA 4GU5A 1PFUA 1VBKA 1IVSA 1N2OA 1PG0A 1X8XA 1JMVA 3PRHA 1I2DA 1JGTA 3LE8A 1S4MA 4UZFA 2QTNA 2DXIA 1JEDA 1KQNA 1YUNA 1OWNA 2QJOA 3DLAA 3IOCA 1CT9A 1IRXA 3A04A 4ZT4A 3IVGA 3A4IA 1PFVA 1NI5A 1JECA 3SEQA 1K92A 1F7VA 2J07A 1O6BA 2PXHA 3P52A 1EXDA 3TQOA 3Q12A 4NATA 2QUJA 1Q11A 2D5BA 2OV4A 2A86A 2E89A 1F9AA 5KWVA 1QRSA 2QUIA 1NP7A 1TEZA 1M8PA 1JIJA 2YWBA 3QTTA 1WJGA 1OWLA 3NV7A 3ZJVA 1MJHA 1RQGA 3KT3A 2QUHA 4EG1A 3PNBA 2BTEA 3L93A 4ZCSA 2EJCA 1O95D 1NUUA 1A8HA 2J09A 4A91A 1XNHA 1XNGA 3N2YA 2XRZA 1FYDA 2E21A 4MWDA 4R0NA 1NURA 1MAWA 4NX2A 3IMCA 3COZA 1Q19A 1EUYA 1M8JA 4I6JA 2D54A 4ZT2A 1ILEA 2WSIA 3CLRD 4ZT7A 1QU3A 1FFYA 1KORA 2J5BA 3IODA 2G36A 3KT0A 2ZUFA 4MW7A 3CVVA 4KR9A 4CDNA 1IHOA 2ZUEA 4K0RA 1J09A 3FHJA 1MOPA 1MRZA 1R6XA 4ND6A 2DPLA 3I05A 2A1UA 1KKUA 4CQNA 3AG5A 1H1TA 3VU8A 4OJMX 1KH2A 1J70A 2HMAA 2PIDA 3SP1A 1MBZA 3D6VA 5DASA 4KKVA 1U7XA 3AG6A 1QNFA 5LLTA 4TS1A 3IUBA 1O5TA 3SEZA 4KR6A 4EGAA 1EFVB 1F4LA 1YIDA 4FZJA 3N05A 3CVUA 1J1UA 4U8HA 4H3SA 1NYLA 3SYTA 1OWMA 1WOYA 4MVYA 3ZIUA 4R2LA 1M8KA 1KQPA 1KAQA 1BS2A 1N78A 5FO0A 1H3FA 1GN8A 2GOYA 4MWEA 1N3LA 3L92A 3SZGA 3H05A 2QUKA 4UZEA 3A05A 2CFOA 3FG9A 4I6GA 4DDHA 2A88A 2ZP1A 5BNZA 5HUHA 3FH0A 3QTBA 1JZSA 1TYAE 4G5YA 4JYZA 1VBMA 3ZJUA 2OQ2A 1EE1A 4YP5A 1I6MA 4ZCTA 5DB4A 1XNJA 1ULHA 1WXGA 1QU2A 4JZYA 1QQTA 4HJRA 2H2AA 2DERA 2A7XA 3D6UA 4MQ6A 1Y42X 2PZAA 1O97C
chains in the Genus database with same CATH superfamily
1SC1A 4S3MA 4D4JA 5CXUA 2X3YA 2W42A 1PV2A 2YOFA 3ETHA 3DZ8A 3OZBA 1MO3A 2JBAB 1SU7A 1BVYF 3H4MA 2ANCA 2H11A 3KG2A 4KFSA 2VOJA 4TZ6A 4GPBA 5ITZB 5DCLA 2JIZD 3ZVRA 1XNQB 1EVKA 1OGIA 4JOBA 2WOJA 4MWZA 1E63A 1XZCA 1CK4A 1JQDA 1MGOA 2JI8A 2GLTA 1ZJZA 1BWRA 4DQVA 2P9ZA 2DT8A 2YQ5A 4RVDA 1RPTA 1NN1A 1GSAA 2GN9A 5IP5A 3R09A 4IRUB 4QDUA 2QBYA 2VA8A 5DM4A 4BLQA 3RC1A 4UBNA 1V45E 3BRQA 5CDSA 4RTRA 1E2JA 1EDZA 1H69A 1JYEA 4UPDA 3HDVA 4WBNB 4UUMA 4YAFA 5JBIA 3I6MA 1N8KA 3H9QA 3E5MA 3KHKA 4QO8A 2XVXA 1E9FA 4BMCA 4RTLA 1ST3A 2OCYC 3GBVA 5ILOA 4OGKA 1MJGM 1P17A 2QW0X 4FTWA 4M37A 3IQWA 3IELA 1IZ0A 1MT0A 3ANTA 4JIMA 3S44A 4MW6A 2VDLB 4H7KA 2R8YA 3T6KA 2FW1A 1XNRB 1SD5A 3D4NA 4C4ZA 5JDIA 3T5BA 1KEVA 1Q6ZA 3GEPA 3M6AA 3VPHA 3REOA 3EGCA 3A6EA 2YN2A 5EE9A 5B3LA 5KOHB 2F2TA 5FA8A 3WRWA 2C2OA 3A6GA 3FSEA 3GFOA 1CZNA 4M36A 2GPWA 4IMRA 4BP8A 3OTHA 3MYYA 5CLIA 3OZEA 4DMKA 1S0UA 4QUBA 2IDJA 3BXPA 5T64A 3I2JA 1BXRB 3U49A 3QQ5A 2HXYA 3FAKA 5CEJA 5JNWA 2A1TS 1Q6YA 3PHJA 4UAJA 4QEKA 4QJ4A 4X8LA 4DPMA 2PVCA 3OX2A 4OYLA 3FPJA 2IZ1A 4TV9A 1XCLA 2GYYA 2ZI5A 3TNDA 5IYZF 1EKXA 2M98A 4FFSA 1CUDA 2XDAA 3AEKB 3BTVA 3UV7A 1G20A 2C2BA 2FFRA 4ZZ0A 3DFUA 4OHYA 1LBSA 1NVFA 1T9GR 5LBIA 3EIOA 4AZVA 4DARA 2BHLA 1NXVA 3DA8A 3WHIA 2X4DA 5DNCA 1QAMA 3AM1A 4RLFA 1JA1A 1IULA 3FMIA 1V5WA 1N2BA 1I51A 2WJVA 1V3VA 3HI4A 4I5IA 4Z4QA 1F8YA 3CO5A 2FRDA 5J5VA 3UPTA 3SHWA 1Z63A 3HY3A 3SDBA 2IVZA 4JL6A 4ZOAA 4FBLA 5FA5A 1IHYA 1VLHA 2HMUA 2PSSA 1JEOA 1LPPA 1WZNA 2VF7A 4YB8A 1PDVA 2O7QA 5BT8A 1HSZA 4F85A 2YWCA 5J4LA 4N03A 4DSAA 3GT3A 1SUCA 4LXGA 1GTG1 4ZK2A 1YJXA 3FNBA 5TQ2B 2PUFA 5CPBA 4L22A 3STWA 2PCLA 1JU3A 3TL6A 4YIHA 2PMDA 4R6WA 3LT4A 2HKIA 1MAHA 3WFJA 1PYDA 4M4SA 3PENA 5EJIA 3H6GA 5E6UA 1WW2A 2I76A 4QDXA 5DFAA 2GK6A 4RXTA 1YSCA 4EA6A 5CLQA 2VWGA 4I19A 1F0NA 3N9IA 4NENB 2LCIA 4WZBE 4Q9JA 1GTSA 4UVGA 3AUJB 1N9GB 1XDGA 2A94A 5L6MB 2FZGA 3UY4A 2YZMA 3JD2A 3H9UA 1R8XA 1FP1D 2IHYA 1HFWA 1OVMA 3HWWA 4X0EA 5AKEA 5CB6A 1K7XB 1GN9A 2A9OA 3AR5A 3M6VA 2BSXA 2G63A 4R01A 3RVQA 5BWLA 1E0AA 2Z1MA 1Z26A 3B8HA 1V7ZA 2XB9A 4AZ0B 3IGFA 3EGWA 2NXWA 2EBWA 2QRUA 3V5NA 1PV4A 5JH7B 1UJ6A 1Q17A 1Q84A 1DAHA 2ZSHA 3ZHCA 3UBTA 1AC5A 1B6TA 1FXSA 3CUTA 2J30A 1PVVA 4Q47A 1VFNA 3F6PA 3QVVA 2ETVA 3A10A 4F7WA 4KPYA 1TYCA 3HJUA 4OLJA 3ZDZB 5E6RB 4F45A 3ETCA 4HNQA 2IEGA 2WVJA 1U9IC 2PVSA 2XGSA 2V9CA 3OAAD 4LY3A 2NU8A 5IFKA 3K20A 4A0RA 1NF2A 1WXXA 4NC9A 4H7FA 3JQDA 4QOEA 4B4OA 4UTVA 2FUG1 1J4AA 1Z0AA 1CETA 2TMKA 3RBAA 1DAFA 1XEXA 3NP7A 3B9BA 1X42A 3T4UA 1BS9A 3ADPA 2XWPA 4G37A 3IP1A 4F7DA 1NW3A 4IM7A 2V65A 3JQFA 4YWHA 3QPAA 1JPNA 3KQNA 3B5IA 2H9IA 3VTAA 5EJ4A 1XZQA 3L8EA 2UUCB 1Y8RA 3ZD7A 1NT2A 2GR7A 5KUTA 5AJXA 4CN9A 4WY8A 4HKTA 3V4SA 3OCWA 1RLIA 1RMYA 1U3DA 3LQFA 3CUWA 3A6ZA 5AHXA 5F76A 3VXKA 4ZVQA 3UKDA 3RLIA 1DV2A 2CYAA 4B17A 2AA3A 3FIJA 2P5YA 3AF5A 4WL0A 3OHMA 4Z86A 3WHPA 1K06A 3L6OO 3PE4A 4C7VA 2FY8A 4HSEA 5G4KA 4ZVRA 5C5CA 4H16A 1JSZA 4XJXA 5F4BA 3TOZA 1QE5A 1DRKA 5B3AA 4PXAA 3G5AA 4BWYA 2J4FA 2CBGA 4JI7B 4O63O 1C1DA 1K5PA 1UK9A 3BF8A 4D6PA 4DRZA 2IP1A 1KI6B 2DBYA 2I4TA 3DHYA 3ES9A 1YH3A 3JASB 2H1SA 1PDOA 4Z7JA 2IFTA 4BFWA 2C2MA 4Y98A 3WL6A 1N0HA 4BNFA 4Y6LA 5ALFA 2VP5A 4YDSA 3N5CA 4YYZA 3AIIA 1GDTA 4I6EA 4R1PA 2F9MA 3UCFA 3VH2A 2H5LA 3KP1A 4F93B 2W71A 3DNPA 2RHBA 1D2RA 1EK5A 1P45A 1XFDA 3HMQA 2W4QA 2POQX 3BXFA 3O4JA 5J63A 4CM9A 4JQYA 1Y4UA 3CCBA 4Q5IA 3ZEAA 1KJIA 1SQSA 5DV9A 3VDNB 2DHDA 4RTMA 1EUZA 2IYTA 3OLXA 1XMSA 3CNBA 4JX8A 4PGGA 1W581 3QX9A 1VE1A 4RFSA 4TSRA 1H4TA 4OM7A 2AFIB 1DKNA 4FN4A 4X71A 4CKXA 3CM0A 3RVRA 1R37A 2V6MA 2ZR0A 1SCAA 2CBZA 2JANA 2G9NA 1W36C 3WLEA 2GF2A 3DLTA 1MTOA 1YBAA 1G7SA 4ZQFA 3SF8B 4IWNA 4R16A 1R0BA 2P30A 1RHJA 1OWOA 1QPBA 3I9KA 4FE4A 1HFKA 3AONB 3CC8A 2EDCA 2ZBDA 4Q9IA 3AETB 4HLDA 5ICSA 1KOGA 1T2UA 2DWQA 1C41A 4Q01A 4E2FA 5F77A 2VDKB 3OH8A 3PNYA 4IKOA 4B82A 4MLZA 1YVRA 3V1UA 2BKVA 2YNMC 4JLKA 1JG7A 4B4VA 1Z2AA 1TVEA 4A26A 2CZQA 1H2FA 2YWFA 5LQSA 3TCKA 2OHGA 5JV5A 1B0UA 3W79A 1PT6A 3SEQA 3TPCA 3C43A 1E5VA 1X7XB 1ZA1A 3HCWA 1KH1A 5KQPA 3QMWA 3GMTA 1X39A 2Y9MB 3BM5A 4Q7MB 3T1QA 5JDCC 1VL2A 2GYWA 4HN9A 4F1KA 1JDZA 1OLUB 2V7EA 4FYHA 3KTDA 4PTLA 2X7XA 1ZRSA 3C6XA 4K6KA 3VU0A 1YNSA 1N7GA 2R62A 4ZCQA 3ZVMA 2WF5A 4HH4A 1PQWA 3C3AA 4LHZA 5ALWA 2YVLA 2HBYA 2QYHA 5E7MA 3ROPA 1UFVA 1PN3A 2IDKA 3LFHA 2O7NA 1CC1S 1ZUWA 1JP7A 2OCPA 3C6ZA 4LK3A 4PTZA 4BVFA 4LJ7A 1LW7A 3PUYA 3FJYA 3GUZA 4H7HA 2CFSA 3KHUA 5ELXA 4W82A 3QLJA 4Q1EA 4S0ZA 3N6XA 1CRLA 1I3NA 4HVLA 4N7JA 5I7EA 5ALZA 4I1SA 2C31A 3ZU6A 2CV1A 3W9UA 5AHKA 4EUKA 1PJ3A 4URXR 2WHXA 4MEJA 4QELA 1W93A 3BMQB 1US8B 4AJEA 1WTCA 1DX9A 4BLOA 5ENZA 4BUJA 4I4TA 4NXNB 1MXHA 2H51A 2OXCA 1JHOA 3C1UA 4NU6A 4A0HA 3SQNA 1FSPA 1M1NB 2B4TO 3LFTA 1CZUA 4NJEB 1NMEA 5LP6F 1D6MA 1TJ3A 4K2HA 2H4JA 3CMCO 1YV9A 5BOSB 1QFYA 3O3OB 3PVZA 4TT3D 2H85A 5E9WA 4YCMA 1Z3CA 5K0JA 3F1KA 4G1VA 1GRVA 2PZGA 4N3BA 4BGEA 1MZVA 5F23A 1DUVG 1NRJB 1Q0ZA 1DFHA 3FVTA 2MSNA 3PXBA 3CFAL 1HDXA 3OC6A 4K9QA 4RMGA 3DKKA 4F4DA 2RSLA 4LNHA 3CH5A 1XTSA 4XIGS 4EY5A 4Q1AA 1K5GA 4WXMA 3HNOA 1NXSA 1JAXA 2ZQYA 3PRHA 5A05A 2XCUA 2HJRA 4AULA 2OOKA 4BO6A 3PEYA 4MPTA 3CUYA 1L8LA 1ISMA 1UZMA 3KX2A 2A9JA 2I3ZA 1XRSB 3L4SO 6AT1A 1V95A 4YRGA 4Q7LA 4TUYA 4OD0A 2V1XA 5EZQA 1V37A 4Q21A 4QOSA 1CW2B 3HZZA 1IRXA 2GKOA 2ZYSA 2NIPA 3O1JC 4DGQA 1K9SA 2YJZA 4QYTA 2OD7A 3EDOA 1TQHA 5EZYA 4B32A 3KXIA 2IXFA 4RTQA 3AF3A 1H1DA 2EQ5A 3A2NA 2PZKA 2O0HA 3LY7A 1RWXA 4KO2S 1HA3A 1CG6A 3U4CA 3UAWA 2AE1A 1C0EA 2XYHA 5GZ1A 4H4EA 5AVXA 2O7RA 3A4VA 3C5WP 4IV0A 4P98A 3P52A 4I8IA 4REOA 4IIUA 3WL8A 4CM8B 1HBJA 4I2NA 5CDHA 1UQUA 1U8YA 4BJ1A 2E48A 5AWFC 1KI9A 4RCYA 1BYUA 5KWVA 2CJFA 2P9JA 1A8IA 4GZLA 4BX0A 3DSRA 2RI1A 3PWTA 4QXPA 1JSRA 5F52A 2BZGA 2AX3A 1V1RA 1E2MA 4J0EA 3RHFA 2FVXA 2JZCA 3KU1A 3SXUB 3ZDBA 3WGOA 1OI4A 1PR4A 2D1TA 1EUCB 1WHSB 2SNIE 2JAPA 1UR5A 3O0DA 4IJ6A 2VSNA 2AS0A 4BNMA 1O95D 1YZHA 1LS1A 4MPRA 3UK6A 4MPJA 3TLZA 1XNHA 3QMMA 3WQSB 3PEWA 3GQBA 1UM9B 3HCOA 1VTKA 5JECA 4QU9A 5AP9A 2QSJA 2FWNA 4KYVA 1TAGA 1Y63A 3VU3A 2ZE7A 3H5IA 2QYTA 1TU4A 2B6NA 2Z4TA 4IG4A 4H27A 4XYGA 3UA3A 3FYTA 3REGA 3PF8A 1RCTE 4IIVA 1TRKA 4MEBA 3S2YA 1JDPA 3AERB 3VYVA 1KYYA 2UYQA 4UOQA 1X2EA 1LVHA 3VJKA 1TECE 1Q16A 4D3XA 1HFEL 3KXPA 1J24A 3ONVA 1DQPA 4G01B 3OF3A 4P53A 1EP9A 1UK6A 3WRYA 3BWXA 5CR9A 5IVKA 3FPGA 2XUHA 2J5BA 721PA 4GMXA 1BQEA 1UUFA 5I4CA 4ZO6A 2X7HA 4XD2A 2ONZA 4QTUB 2R66A 5F5XA 4B3CA 5B36A 5IMSA 4H18A 1IHOA 3WYEA 1Q3TA 2O4CA 3DYIA 1QX3A 3FFXA 4LVNA 1E7QA 4AMUA 5JZ9A 4JI2B 1JJAA 4UUOA 1JFLA 1OAAA 3AU9A 5JCOC 5C4MA 3ANMA 4R8MA 1ADGA 3UZUA 1GILA 2H17A 2XRMA 3GBPA 1NJ1A 2A9KA 2J5XA 3KOUA 3L0SA 5DISB 1BVHA 2HMAA 1IN5A 3P9IA 4DLBA 3BD6A 3M83A 4LBYA 4B3TB 1XRJA 3Q8LA 4W9MC 3EFOB 2XWQA 4DMRA 1KAHA 3R5SA 2FFHA 4G2NA 3HN7A 2FMFA 3EJWA 3QKSA 1R4AA 4A6DA 3WWEA 3RVJA 3L0ZA 3ORHA 4IEEA 1O54A 3EXHB 4FLFA 4CKEB 4KLCA 5JWOA 4HQ6A 1CYDA 2H65A 5BORA 1OX6A 5IVDA 1A7KA 2AVNA 1J1UA 1OCEA 1NMZA 1O9GA 1X3LA 3R7NA 2MYTA 3VTFA 1E9CA 3U7RA 2CXUA 4FX5A 3E7XA 5LMZA 2DWUA 1KQPA 3DEJA 3W2IA 3LCMA 1AQNA 5F5LA 4M3NA 2BGGA 1HE1C 5PGMA 4RWEA 1QKJA 2IV2X 1GN8A 2NXCA 3NYQA 4MWEA 2L17A 5F2NA 2C3OA 4MP3A 5BQOA 1U3VA 1YQWA 3FZGA 2FRXA 3GEGA 1UWKA 3ELUA 2WUGA 2Q62A 2ZUCA 2E4YA 1MPXA 4HLCA 4YACA 4DSZA 3IUPA 5DWDA 1LH0A 2GGSA 3EULA 4KI7A 3A1EA 3M9WA 3MEQA 1SCBA 3HNRA 1YD7A 1EVYA 2QNBA 3D5EA 2O0LA 3DLIA 4NYIQ 1JDBB 2GS9A 2ID9A 5D2CA 4CKCA 2ZXFA 3VVBA 1QE0A 2HHAA 2KWIA 2Z6VA 3IDQA 1L7XA 2C4TA 3QOWA 3LZCA 5EXDA 4MQMA 1KZ9A 1QH8B 2BTQB 1ULHA 4FQ7A 2XUDA 4PE5B 2Z5FA 3K8ZA 2P90A 4L4YA 5I7OA 2CCKA 3TYXA 4JSYA 3MOGA 4MQ6A 1SM4A 5A9RA 5AI4A 5FFFA 2QM8A 3PGA1 3M89A 1CXZA 4KXFB 2PD3A 4HGPA 3WIUA 3RBXA 5I01A 2P3QA 1VIMA 1XRMA 2UYOA 3WZMA 1S4QA 4NIMA 2QA5A 2IITA 2W98A 4BIIA 4W7HA 1WXIA 4YRFA 1ZNZA 4NDZA 1XDBA 3VISA 1RKXA 1I30A 2O2CA 3TJZA 4BVEA 4ZJZA 2XUKA 4KZKA 5AOAA 5F33A 3HVKA 2FSPA 3H18A 1VB5A 4CIXA 4NS4A 5LA6B 3WB1A 4GL4A 1TTHA 5DGIA 3NX4A 4WVFA 3DP9A 1T9HA 1A4IA 1S2DA 1JG4A 3O2QB 2XA9A 3G5TA 2CJWB 1HXHA 2D3TA 2GH1A 3UJ3X 3ZE0B 2DQSA 2PMWB 3UK7A 2E4ZA 3ZE7A 4C14A 2FMTA 3VKUA 3HS3A 4H7DA 4L7QA 1JLLA 1HKHA 2ZE5A 1A4XA 3E3AA 1GAQA 1XOIA 2UV8A 1IQPA 1C9EA 4X1KB 3ZW7A 4AS3A 1TUBB 3DCNA 2QVZX 1YI8A 3Q7SA 3KRTA 4LS3A 4Z3OA 2FB9A 4I1VA 4OXXA 4AN0A 4J7XA 1N0VC 3DDHA 4IFIA 4JP3A 1Z17A 2AC7A 3V8QA 2Y1WA 3FOEC 5IXSA 2FWBA 5DW0A 4MIKA 4WWHA 3GRRA 2D3WA 3E8XA 5DIZA 1PI3A 3D7RA 3HKCA 1ZW6A 3A6DA 1ZI8A 3MVEA 1EDDA 3LKZA 4D81A 1LDGA 2C84A 3BEOA 1EFTA 3CFFL 3HFSA 4YP6A 3KUXA 2ZDGA 2GR8A 4OHRA 1Z06A 2FK8A 1K7EB 2CNNA 1B8PA 1VJDA 2PRYA 1FRVA 3FFBA 2Q5QA 5JI3E 4ZDIA 4HG2A 3AM5A 3ET5A 4CIVA 1PKEA 4MLDA 3TKLA 1WKBA 1NYTA 2DECA 2Z4RA 1UZAA 3A4MA 3AR7A 2WJYA 1HQKA 3G3EA 4UMDA 2OYCA 5JFTA 1RZRA 2IZ0A 3MTDA 3RHTA 5JZOA 3BE6A 5CU7A 1KSHA 3E9NA 2WW8A 4EEKA 2KM1A 4OIMA 2ZWVA 3CZPA 4O6VA 3B51X 2FZLA 1CEEA 3KR0A 1BOFA 1XRPA 2HA6A 5FNVA 4D3YA 2N75A 1RLOA 3IDOA 3ZYCA 4IJVA 5G4KB 4DJEC 1PTJC 1XTJA 1XJWA 3OTWA 4LI0A 4UULA 1YQUA 5KOIA 2WJ4A 4MV0A 3RARA 1YJ8A 3INRA 4JT4A 2QLTA 1AUQA 3JQQA 1CF9A 4GMKA 3TAUA 5I51A 4RCVA 4LJYA 3LHFA 5IF3A 1E3WA 1XL0A 3A31A 3T7SA 1RRKA 3GVHA 1TTPB 1BOOA 4A7PA 1CUAA 3S0JA 4LSGA 2CSXA 4S1VA 4MUFA 2XUJA 1N1GA 2P5UA 3GGOA 3R2JA 3H4IA 4N7MA 3STVA 4HLNA 3PHBE 3ZD9A 4WUTA 1YJCA 3DEZA 3TL2A 4DIMA 2W6JA 5IBCA 4TX1A 1HDCA 1U5CA 2OGTA 3R0JA 4MTLA 4UMEA 4ITVA 3DE5X 1O6CA 4L75A 1R4MB 2ZEJA 3O8OA 4NE2A 3ZE6A 3PXUA 3PGLA 2JJ2D 1IPFA 2WYWA 2C54A 4MKFA 4WE3A 4DUPA 3AF4A 2P8SA 4OGWA 3L4BA 3UHOA 4NV1A 3CF4G 5KWIA 5ALNA 2W8BA 2HPZA 1EE2A 3EZLA 2OXIA 3N59A 4YT4A 3JQ6A 1AURA 1IOZA 2REXB 4KREA 1P1RA 4HAXA 5I9BA 1GL9B 1RC8A 2EKZA 3SC4A 3N8HA 2N42A 3V1KA 3HXLA 4FHGA 4RA9B 5HVNA 1SU6A 3ZHVA 1JDNA 4HEA6 4UVHA 5EKXA 1N2JA 4EKDA 3AK4A 4F9EA 3Q72A 4WZZA 3L0PA 3C5VA 4EWLA 5CJPA 1JQJC 4CL2A 5J43A 3BIWA 5DN9A 1CQJB 3K92A 3MUOA 4WHMA 1KRHA 1VXOA 3SR3A 3V80A 1RHQA 2ZJ0A 4U1RA 5AKJA 5HM6A 1TF7A 4IFTA 3CN7A 1MPTA 4V03A 1T1GA 3NDJA 4QJ3A 3LLVA 4GOXA 2BLNA 1P4HA 3ABSB 2VQDA 3DLBA 4DBVO 2QGZA 4D0NA 5H83A 5K0ZA 1M0TA 2HOQA 4Y6SA 3NBKA 2A67A 3HFJA 3PVSA 4LISA 2BLLA 4YS6A 5CFQA 5JRDS 5DDIP 1KBOA 1PJRA 2ZANA 3I9V6 3HU3A 4ZJUA 1H2RS 1JIUA 4N0MA 2Q9AA 2R96A 1AZTA 1MP0A 4GP6A 4WCDA 5LZ7A 3I83A 1BGWA 3MSXA 3U3OA 4GMFA 4XASA 5F4ZA 2OCGA 2XA2A 2ZR8A 1ZFNA 1S89A 3TLJA 1DXYA 2R3SA 4EW2A 3UYKA 4JJEA 1IJEA 1YONA 4V0NA 3IOEA 8LDHA 1XIVA 2Q5FA 2PUDA 3PPYA 2P4SA 3JAWA 4NOMA 1LQUA 4I50B 3B2EA 3TD6A 5IPFA 1VSVA 1A76A 3F0TA 2VJAA 5IXYA 4KDEA 1GKLA 2VH5R 4G0VA 3VGPA 4D9MA 4E5YA 3IIEA 1BAPA 4GQBA 1TGYA 2JD1A 3NS7A 4OMCA 4KVGA 2J87A 4AJIA 1FDSA 2H9AA 4RXUA 4YJ2A 2ERXA 1XTUA 1J9GA 3IV9A 1QVZA 3N75A 4J0IA 2ZGVA 3E9QA 3HR7A 3NV9A 3T9FA 2VPQA 1D4AA 3FZNA 3LUDA 3FDJA 5FWAA 5AIBA 2DAPA 1CIVA 2PEZA 4XWKA 1Z88A 5KYYB 4X7PA 5A5VA 2OB1A 4OGLA 1ZD2P 2JLVA 5SZKB 4FFVA 1FFBA 2I62A 1U3TA 1VMKA 1WY5A 3T3DA 1QC5A 5KYWA 4L72A 2PEYA 5HG0A 4FCCA 4YFYA 3GLGA 2L0XA 2CLIB 1T4GA 1FLDA 1Q92A 1CLUA 4WBNF 1AHNA 3R3VA 4HQNA 1P6XA 2OBLA 5EXEA 2O2HA 3WX0A 4LZPA 2DUMA 3DKRA 3E22B 3HGQA 1O6ZA 3THRA 2REQB 2F90A 2W11A 4EAQA 2X5OA 3U6KA 3I5YA 4YGYA 4ODIA 1Z6ZA 3NBUA 3TGWA 2P78A 3PX7A 1ZM7A 3PS9A 2FPXA 3DEFA 4LDAA 2WDPA 4Y1FA 4E3WA 4F3RA 1RTKA 4NESA 3TRHA 1PR9A 4EA7A 2ATEA 1Q5PA 3E3MA 3GLHA 3QVUA 2RHJA 4XUDA 4OBEA 4ROTA 1JDJA 4UAVA 4U63A 2ZJ7A 4FIDA 3ZCSA 4AMGA 3OKAA 4NMMA 4WDRA 4NZPA 4P7BA 1YKFA 1J42A 2HGZA 1IM2A 3AY0A 4XLTA 3W06A 5MN4A 4PYOA 4HBGA 4YONB 2Q7DA 4FWBA 3O03A 4CG3A 4F4UA 2NO0A 1E2GA 1I7NA 3H5TA 4GD3Q 3CT4A 4IPTA 4ERXA 2GF9A 2QRZA 3COPA 4ETWA 2VLIA 4GOND 2B92A 3IB3A 3NHAA 1TT7A 1UBCA 4C7KA 2AOUA 5HGXA 4D96A 2CZGA 2MU1A 2NO9A 2O5RA 3CVOA 2BYTA 2EJTA 2Q3LA 2JIZA 2SCUB 4LYDA 4HAVA 1YS2X 2NADA 4ZVUA 5IJAA 1FFHA 2SHKA 2HBRA 2EHJA 5FTWA 3WQHA 2FKNA 2Y66A 4EPVA 3TGLA 4CTOA 1ZUD1 2QPAA 1EP1B 4IH1A 1SVNA 3KR1A 1XZIA 3ZKWA 1QIJA 5BV7A 1CBUA 1E7RA 4Y6GB 2PL1A 2WZDA 3ANYB 5DN6D 1N6RA 4C6TA 2Z3VA 1R0YA 1UM9A 3IQXA 4LWQA 2RFLA 4GE0A 1RXCA 5CVJA 5TS3A 1IWPB 3ZE2B 1BRMA 4BX9A 5BMVF 1THMA 1M2WA 5BN3A 1A0OA 2POCA 3K4HA 4G1EB 4QGSA 3OMXA 1ATIA 4KU4A 3EW7A 5C1OA 3E6AA 3PD7A 4ENTA 3TG8A 3KFLA 5IC6A 2BKAA 3QJ5A 5HX7A 5IDWA 2APJA 1WF3A 1QGYA 1WB6A 4NULA 4MQ5A 3PDWA 2BVNA 3ZVKA 3UFBA 1I7PA 4CM4A 1THZA 1YE8A 1MO4A 5BNFA 3ILXA 1X7HA 1EQ2A 4FEGA 3VO1A 4BKMA 4NV0A 1FP4B 1DJPA 3IT0A 4Z7QB 3EQ2A 5IDXA 3C70A 3OZRA 3MT9A 1ZDMA 1GQYA 2B4QA 3F3MA 1VSUA 1GCIA 4N76A 2G5PA 4YNBA 3THXB 4FZ5A 2J7PA 2QUZA 3O5AA 4NH0A 4QWMA 3ZCPA 3PK0A 4GKVA 4CCSA 1A88A 3KEMA 3CKKA 1K7SN 3HPRA 3QFFA 4G5QA 3JAMA 2IHNA 3AZQA 4XXHA 1NV8A 3I32A 4DT1B 3V7NA 1W44A 4OQFA 4QXRA 3I62A 1QP8A 4HYYA 2B6HA 1QH1B 1F1JA 2IDZA 3BE8A 4MV8A 3AUUA 3NHRA 4ZAVA 2DXIA 1RWBA 1Z5OA 5CHYA 2DTXA 1R9MA 4URVR 1L4NA 2Q3BA 2Q4OA 4CI9A 3CUVA 4JR0A 1IN6A 3BIOA 2XOEA 2E55A 1GLVA 2EOAA 3LC7O 2YMQA 4KK3A 2FWAA 4NE9A 3VBCA 2PV7A 1NMXA 2XNDA 4UMFA 4BTVA 5FBVB 8ABPA 1AQLA 5B4VA 1QQBA 1C1XA 2XTMA 4IXJA 1CJMA 2ZKLA 1V4BA 1NAIA 5J4YA 1Z38A 4YJGA 4G0NA 3JQ8B 2PLWA 3S1AB 4KRGA 2J07A 4YCAA 1W48A 2Y6UA 4W1PA 4CMHA 4UHFA 1EXDA 1GGFA 4RJJA 3WGMA 2I8AA 4FFWA 4CUKA 2BI8A 2VUTA 3UGJA 1YZVA 4O3MA 2H1CA 1LQ2A 2QUIA 3K9LA 1W19A 1M8PA 1Y6ZA 3ON5A 1OHHA 2NN3C 4HTFA 4JP2A 1EDBA 2WIKA 3U7QA 7ABPA 3NBXX 2RC6A 2H2FA 1ZIYA 1WABA 4OI0A 2GCOB 4AKIA 2N1MA 4UTRA 3H8JA 4R1UA 2D2XA 1E9SA 2YNMA 3KNZA 4TMYA 4ZDKA 1B93A 1GSIA 1KS9A 1SXJD 2IY7A 3EDQA 3IIMA 3FMGA 5FWXB 2AXQA 3O83A 1TNDA 2GPBA 4QDKA 1VMDA 4RSHA 5C8YA 4ZVOA 3K5IA 5A71A 4RLSA 5BT9A 3LRTA 1OFHA 3D7NA 4ARVA 5F2KA 4ZK6A 3RS9A 1P72A 1I24A 1MEOA 3AESB 3OSUA 5DM1A 1TCBA 3K3PA 3T54A 3W7AA 3ZZUA 5EPUA 2F6RA 2WJHA 2A9FA 3RABA 1F17A 1KPIA 3KZMA 3LO8A 5JJ5A 2XBMA 1TO6A 3QXJA 3D3QA 2PJZA 4NBKA 2BEVA 2AEEA 3T7CA 4AJJA 3VNVA 5GVSA 1OMOA 4XOUA 3NORA 3EXG2 2XD9A 4N0PA 4ZT2A 1JAIA 3RRFA 3VPDA 1IVYA 4DZRA 1A7JA 2NAPA 2GHRA 1U1EA 2FCRA 1TEHA 1BFDA 3EIUA 4EJSB 3T8YA 1DAKA 4C7JA 3C41J 1OILA 4NYJQ 3NNDA 1SKYB 4UFPA 1V16A 1XTKA 2VP4A 4IKEA 4OQEA 3AH8A 2ZUBA 4XW2A 1K7FB 3P9XA 4ZREA 4CDNA 2W70A 3U7FB 3OQPA 2BEWB 3OU7A 3W90A 3I05A 4DSUA 1HH4A 1CPYA 1Y9EA 2I3GA 2QWXA 4BBJA 2VHUA 3CVJA 2NP7A 2ID8A 1KR5A 1QJ4A 2Q8NA 3IR5A 2D4HA 1K0UA 3IBYA 4H77A 5CX1B 3FRHA 3IKJA 3D2BA 4OJMX 4Q19A 1M9NA 3NC1C 3FCXA 4PXYA 2RGRA 3WLIA 5LQCA 2J4CA 4PCVA 1G2OA 2AKYA 1V7CA 1ZW1A 4UEJA 4FOSA 2PX3A 3C15C 5IAGA 3RG8A 3O8RA 3CRZA 2EARA 5G41A 3RIMA 1JB1A 1EFHA 3DBRB 1P75A 3P7MA 3AVTA 4PO8A 2RHLA 3A6JA 1F2VA 5ALYA 3TSAA 4QQFA 5E4JA 1GKYA 2O3SA 2XY4A 3OZAA 4RBNA 5B1SA 2JFHA 2O1SA 5JS6A 2GW4A 1NM5C 3N05A 4LRTB 3UOAB 3ZZMA 3ACBA 2I6UA 5EUMA 3AMVA 2JS7A 2HSJA 1N34B 3SYTA 3HKCB 1IBCA 1ORRA 1NJ8A 4G1UC 1G98A 4R2LA 1XZEA 3VC1A 1DOHA 1JPVA 1OXBB 2OECA 3JATB 1ZVJA 4RL6A 2FTKE 3GLIA 1MA3A 3ZNOA 2NVOA 4OH1A 1CFZA 4GXTA 4CUZA 2B25A 2JFWA 5KAPA 1RFGE 5EQTA 2IH5A 1ECFA 4TL9A 1WULS 4H4DA 4ZVMA 1EBBA 1QPGA 1U65A 1U31A 3A05A 3RYFB 4S12A 5KB3A 4H08A 2GEVA 3RYTC 4I4NA 1MF7A 3K1JA 4JLPA 4OXRA 3MWDA 4M21A 3RS8A 3DDOA 3ZWBA 2XUIA 1Q91A 3PHLA 4OXKA 3ZDYB 4KQHA 5B7NA 2WSMA 4NP6A 3PQCA 4EEZA 2DQKA 3W9BA 4AX8A 2P4EA 1YZNA 1JEJA 1DXQA 2GDZA 5BYKA 1XZMA 3S1SA 2YUTA 4YV2A 1GNRA 1E69A 1WPXA 5FPHA 3BCUA 3TB6A 1OB2A 2Y0EA 5AVVA 3DKIA 2QYSA 2GAFA 2C2KA 3E23A 1WVIA 2O6HA 3W6OA 1GM5A 4G3XA 3CCFA 4YP5A 1Z0IA 4HNUA 1SQFA 1XF9A 2QGFA 3CXUA 1VLLA 1VZ3A 2QUAA 3GNTA 4WN9A 5FTKA 5LD2B 4KXVA 4HJRA 3UGKA 4LC1A 4FK8A 2NXEA 2A7XA 2I2AA 1H1LA 3OEHA 3PR2B 4OQLA 4F2WA 4KPFC 3A26A 2DP4E 4DLRA 5L7WA 2H18A 2AMJA 1QHGA 1J23A 2WAYA 5CT9A 2ZYWX 4RHCA 4Y9TA 1YFLA 3RJMA 4HZUA 4ETNA 2QLBA 1RP7A 5A4JA 1C8KA 1QIIA 2Q28A 3K1AB 1NW4A 3LYUA 4F0JA 5MFZA 4G23A 3EDCA 3DWGA 4QIHA 2XEDA 4GBGA 3FWNA 3IHWA 3I0MA 4RMHA 3TBFA 5IUKC 3TX6A 4EVQA 2O0MA 4YXWD 1HFJA 1E92A 1P1CA 3ZXXA 3TQIA 2B61A 2V5UA 1JL3A 5DYIA 1L5RA 2GASA 1XRNA 2J33A 2C4WA 1NVBA 5JPIA 3WLKX 3ZWNA 3DMFA 4F21A 4BNVA 2CHQA 2JH8A 1KY5A 4MUNA 1OLXA 2VYFA 3EZFA 5HBGA 2FQ1A 3SNHA 1T5TA 3WP1B 2EBFX 2XHZA 2W58A 2IHBA 4GX2A 4OSOA 3PQ5A 3KSDO 4MYSA 2Q41A 2YYSA 4G9BA 4L85A 2IUUA 5HEKA 4C21A 5EIBC 1OA0A 1USWA 3DZFA 1DJMA 3AR6A 3ZQJA 2GK4A 4J6FA 1SVIA 4TYQA 1FP6A 2JA1A 5AW1A 1QCCA 2HEGA 3DL2A 1K88A 3MC1A 4FONA 4P5EA 4DA8A 7MHTA 3OD1A 3UT5B 4B6EA 4M0MA 4OQXA 5HZMA 3A6PC 1KAGA 4MUGA 3S7TA 3B1VA 1QTRA 1OLOA 5DYYA 3N3AC 1H3NA 1R27A 2JLRA 3OWOA 1E1MA 4MAFA 2Q99A 2I34A 2CV0A 2PY6A 3H86A 5ILQA 3ER6A 3KOMA 3I6ZA 2AJLI 1XV5A 3CX4A 1W73A 4M9RA 3X1JA 1T3ZA 1NW8A 3VR2A 3CSDA 3BGOS 3RHSA 4PICA 3LDFA 4RC9A 3OEWA 3RF6A 3T0FA 4W5RA 4KIWA 3TVTA 5IWCA 3ITEA 3EXIB 1UBFA 4C7BA 2CJYA 1TW2A 2WIGA 1E2EA 1PNVA 3BIFA 4TT3A 2GTHA 3DEAA 4RPKA 2BGIA 2J5RA 3RROA 7REQA 3X2EA 1YR7A 4EHLA 2JGFA 1SUIA 5IT4A 3VPXA 2V3CC 1DS6A 3LXRA 3CX3A 4WKOA 1ZMXA 4PFSA 3ZWDA 2PRJA 1G41A 4CVNA 1GNTA 4QNMA 1OI2A 4NFSA 1G64A 2Y1GA 1BDJA 1FRQA 3L9WA 3OU6A 2WU1A 4GEGA 1RI4A 1CUJA 4TXNA 3I04A 5DSXA 4AJPA 3U56A 2CNKA 3KCQA 4BAGA 3VDMA 4OYHA 5DEOA 3OCZA 5IYZA 4YASA 4LC9A 2F1RA 2PUVA 1D1QA 1XE3A 5ITSA 1V9SA 3DVAA 2ZJ3A 1D5CA 2CHUA 3C45A 1T8SA 4X63A 5SICE 3BSWA 1AN0A 1E1LA 1NOIA 1K0FA 3U3ZA 4QTYA 1CIPA 4ZOQI 2YICA 1HYQA 3G2IA 3OEED 1O96A 1G7CA 1NKSA 2PD4A 2JEZA 3AVQA 4IVNA 5I7VA 2Q5HA 4NBVA 2OESA 3HC7A 2AHOA 1WCXA 2HBZA 2AMFA 2IH2A 3NNSA 3UJ9A 2VDWA 3MHTA 2QP9X 4INJA 1J90A 2AD5A 3TTTA 5LIRA 2WYOA 2CYCA 1T8RA 4I99A 4BATA 4G8CA 5ITWA 1NUAA 3JARB 3NWOA 2P2CA 2OQVA 2CW5A 1E6LA 1H66A 3EGXA 4COKA 4WLEA 2PT9A 4HRXA 1CLEA 3NCHA 4RWZA 3Q2OA 3TNJA 3IAS6 1ANKA 1R1DA 3PUKA 5FR2A 8OHMA 2HMYB 3NTOA 3LZDA 1U7WA 1JQAA 4BMNA 3UMYA 5EMLA 3E22A 4O0MA 3CLUD 4CL8A 3NM6B 3RFUA 8GPBA 4ZV9A 3NBFA 4DC9A 1H9AA 2JH3A 3QSGA 1OB5A 4DVJA 5ER9A 3M6XA 1I9GA 3N8DA 4TWBA 5ESRA 4KLRA 4C4TA 3C48A 3QPWA 1E9RA 1JLMA 4KRFA 2EEPA 2VJOA 3AP3A 1BX3A 5I3ZA 4D9NA 2E4WA 4LJ5A 4MS3B 3LYLA 4CCYB 2IYLD 3N8GA 2H7XA 3TMKA 4DLLA 5C51B 5F78A 2WQ6A 5BNTA 5CB0A 3O47A 2JJYA 4JP1A 1ZHFA 4AXBA 4IVQA 1FLAA 2IHVA 4OX9B 5L3SB 2IE0A 3UEOA 1GXSA 4P3XA 1GTZA 2DLDA 4JP8A 2JBAA 4M9CA 1KQ3A 4DJTA 3GLFB 3U4QA 1YK0A 2WUVA 1T8UA 4OHFA 5EHQA 3EBPA 1PJTA 2O1XA 3JQBC 5THXA 3U40A 3WDSA 1V5FA 4RVOA 4OK6A 3SM3A 1LEHA 1P9NA 2PVPA 4YAOA 2GESA 3OM0A 3OHPA 3INNA 4LW8A 2PPLA 1DRUA 2G07A 2XZDA 1LSSA 4Q9DA 1MDBA 2ZUTA 3EVCA 5FV4A 2XGJA 2F59A 4P8RA 3GCZA 3WWPA 1EI9A 3PIRA 4B35A 4EITA 2D1SA 1H65A 1X9HA 2C7VA 1RRMA 1N2ZA 3BHJA 3FUVA 5TF4A 1RXVA 3T7EA 2XX3A 1E3MA 2ATIA 4R41A 4W6ZA 2BT4A 4MW9A 4KQ9A 4PHCA 3IPAA 4MVJG 4ZAXA 3HYSA 3PWSA 1I5OA 5DT2A 1DBWA 3LXXA 5KVQA 3ZWCA 5CB4B 3PQFA 1SKBA 2WF8A 3LVRE 2JCVA 3P9QA 3TIXB 3UUWA 4PNZA 4W6QA 1OBVA 3ZG6A 1KP2A 3M4ZA 3QI7A 5CA1A 1I3MA 1X9IA 4KVAA 1W5FA 1IMOA 4ND2A 2QX4A 2ZAMA 3MCTA 4K9LA 4PBRA 2JIPA 1R8QA 3ROQA 4XRGA 1UKAA 5LOVB 2YX1A 4BO9A 3T5CA 1SRRA 3L0OA 2VQEB 1P2SA 4GIBA 4PF1A 4QA9A 4DT1A 2EVWX 5HGJA 4EDHA 5HTKA 1UEJA 1Y7HA 4ZHQB 1O3YA 1L4BA 1BXRA 3TW0A 4BWVA 2HRZA 3MT7A 5GQSA 1ZO8A 2A0KA 2DY1A 4INAA 4DBZA 3LC1O 4XQ0A 4EFLA 4UFNA 3LNCA 3K1YA 2RHRA 1QH1A 3P0JA 4MVJA 3ZGOA 2O9JA 2AG6A 4FM9A 3CVXA 3IO3A 2XTAA 3QE0A 5K05A 3TS1A 2O8EA 2X0NA 4WXHA 4OQMA 1HOXA 1M83A 1W30A 3QFHA 3O6VA 2K87A 4NBTA 5AHOA 5H5JA 5BUSA 5JEDA 5FUYA 1M67A 4CKYA 2DR2A 3QENA 4MVWA 5AKHA 1A9TA 1ZRMA 2A3NA 2FMKA 4ECEA 4RIGA 4YI3A 5DOVA 4JNCA 2HDHA 4I81A 5L51A 2UYYA 1G8HA 2VRWA 4C22A 4DQ0A 4YRNA 3G0HA 3JQ8A 3PX2A 3S1AA 2Y1OA 3BHNA 3M3PA 1FQJA 5IUJC 4CMIA 1XK7A 3ADDA 3ZHUA 3S99A 4IYRA 4TS9A 3LPNA 4NEQA 1JE1A 4JLUA 2Z2ZA 4MS1A 1TVKB 2EIHA 1D7AA 3FOCA 4MMXB 2F00A 4HNSA 1GZ7A 2R85A 4HDNB 4K1XA 4K88A 4CV2A 2EIXA 5F64A 2HIMA 4D9CA 2BE9A 3ZZ0A 2HWUA 5B58T 1FBNA 1NMSA 4F97A 4GC5A 1GZUA 2WI8A 3AM4A 4P4SA 4BNGA 1YFJA 1ZD5A 2QL6A 2CLSA 2R751 3IALA 4PVDA 4JT8A 4UPEA 1J22A 1U0BB 1PS0A 1YMVA 3RS4A 3T52A 1UKYA 1O5OA 4N65A 2RKOA 1R15A 3U26A 1QPZA 1VI5A 1P7WA 4ABYA 3RJ5A 4EF6A 2WU0A 3SFVA 3IKMB 4XWTA 1QHIA 1VBFA 4U2KA 3U3JA 1R4NB 1RXUA 3U7IA 4O4IA 4I5FA 4GGPA 4G6ZA 3ENKA 3H8WA 2RAVA 2H5JA 3M81A 5DBHX 3RFTA 1TO2E 5CM9C 1TFRA 3K2QA 4L3OA 2Z8YM 3UJNA 4J90A 4PLPA 3MQFA 5KWJA 1QZZA 3MCWA 2WUFA 3AXTA 2PUCA 1UXJA 3U7JA 4RSRA 1H6AA 2XCSB 4CEHB 1B2RA 2QK4A 3AI3A 3ELYA 3TRIA 2KMLA 3C3WA 4Y9SA 4EECA 3BD7A 3P1JA 4D5GA 4B8ZA 4JASB 5GGXA 5CAEA 1CDOA 4IX1A 4AQYB 2LPMA 4FMCF 2XOXA 4XVCA 5BXQC 3HPQA 1VL6A 2C78A 3O94A 4LXUA 1EEXB 5LFAA 3NHUA 3BFJA 3OKFA 4OHKA 5EVJA 5BXYA 5A4MS 4BPRA 4AJLA 4HDAA 1LX6A 5DX0A 4RY2A 3B9QA 1MOQA 3EQ7A 1SKAA 3AHCA 3JV7A 5G3ZA 3TZ6A 5EJ7A 1H6CA 5JXIA 1T13A 5ADVA 3ELBA 3N2GB 1FEZA 2B69A 3QU9A 5K6AA 2H16A 4HL6A 1QNLA 3U44B 4C3OB 3OE7D 3CI0K 1UQRA 2R65A 3PYMA 4IDBA 5CNKA 4A8JC 1JGTA 4DS3A 4AECA 3PEEA 4BCCA 1U6JA 6Q21A 1YUNA 5CBPB 4DMUB 1K63A 1GPUA 3EF0A 3PUXA 2OZVA 4Y6OA 4BRSA 3OQVA 4Z0NA 2OCLA 2C94A 1KVSA 2G9RA 3WGIA 1VSBA 2IYEA 4WECA 3LQYA 4X1YA 4YRMA 3KYDB 3ROEA 2FOLA 2UUAB 3D6NB 2J9XB 2PGIA 1GPDG 4LZNA 4XE5A 5EXXA 4DUZB 4OVKA 5HR5A 1XZNA 1GA4A 1K7YA 2F3TA 2Q9CA 4LOLA 3EOBI 3I58A 4JJKA 1NBHA 5AW8A 1M1XB 2JFOA 4LX8A 4M55A 5GJBA 1CNEA 1EBUA 1R00A 1RPJA 4NYJR 4K7JA 4TTRA 2YINC 2JFUA 3UH0A 4NATA 4UDOA 2FWPA 1LV7A 1Z0DA 2RB4A 1WPGA 2CDNA 3ASYA 2OV4A 2QF7A 1Y9ZA 2YL2A 5A3JA 5BSEA 4EY8A 4W5QA 2HO4A 1PJBA 4YO7A 3QJYA 1YC5A 4Y6PA 5EXSA 2P91A 1JHQA 4PRYA 1IMJA 1WJGA 2V3WA 3PZBA 4K9PA 2A78A 1A9YA 1XZDA 2B2CA 3KT3A 2Z2XA 1E9DA 5A6SB 3GPIA 1KJ9A 4IFBA 3UOGA 4BN0A 2NMVA 3T5GA 4GR5A 3F1LA 4TTPA 3Q6MA 4JBHA 1V5EA 4JR1A 4PSAA 2Z6AA 2M6RA 2QRNA 3AB8A 3BSYA 4HB0A 3W78A 1ADFA 5EP1A 3U4AA 3WICA 4BX3A 4X60A 1WDLA 1WR8A 3F96A 4X45A 3TOXA 4HN4B 3SC6A 3EEQA 1TQ6A 5FUQA 1HNNA 4WN9B 5TPWB 1A69A 5CURA 4DB2A 1H1LB 2G70A 3UHJA 3P9CA 1AE1A 4OGGA 2PO7A 2LR0A 4MUBA 3WNCA 3OWHA 4C5AA 4E32A 2XCTB 1EUYA 4A6XA 2YWRA 2YCLA 3G7NA 3CLRD 5GIPE 3SX4A 3R3ZA 4QATA 1E6WA 1KORA 1YBFA 3IBCA 2Z4SA 5D1HA 1N5KA 4I2VA 4CU2A 2AWNA 3L1UA 1DC3A 2P9GA 4OL0A 3F67A 4OJYA 4UUBA 1I1QB 5AQ1A 3HUFA 4M9UA 1KDOA 1ML4A 3OT4A 4G0YA 3KSAC 1SCUA 1DWPA 1MOPA 4QSHA 4YJ3F 1R6XA 1ZM3A 2OWEA 2W2NA 3WMFA 4C0WA 2OHIA 4I14A 1Q22A 1ZD1A 1L7QA 1KKUA 4EO7A 1F2TB 4B9EA 4UHCA 4S2EA 3TRKA 4CQNA 2GBPA 3AG5A 4IJUA 4NENA 3U3KA 1SXIA 4J0GA 3HE3A 1UOOA 5FIUA 1U98A 4FU0A 1TJ4A 4J0CA 5D5HA 4AKEA 3SZRA 4DANA 1AZSC 2VHQA 3DF7A 3ZDFA 1LBIA 2EJWA 1FDVA 4OKIA 5CT8A 1TC1A 1UM8A 4FYJA 2FAXA 4PGHA 3SLGA 1YQXA 4RK1A 1RDFA 2VWPA 2N1BA 4MX8A 1NYQA 4TQ9A 3T7DA 4TS1A 4CTNA 4B46A 4R68A 4NNOA 4EPXA 1E3SA 4H15A 3OZSA 1NBMA 5CIWA 1VPVA 1BE6A 2J3EA 2ZE8A 4M7OA 1EFVB 1WWKA 2EZUA 3TKAA 4B43A 3E7WA 1AXGA 1RLJA 1Y5MA 5BNIA 4LDRA 1RC0A 1UMKA 3I9FA 1B76A 5KYXB 3V4RA 4PEVA 4KBYA 2WK1A 1CUGA 4HS4A 1JTVA 3T7IA 4IDAA 4Q37A 1XQ1A 4HRAA 3J81A 1TAUA 4CL3A 2XE8A 3LDGA 2W6ID 4PPYA 1RM4A 5FO0A 5CNMA 3OJEA 1R64A 1QRRA 4GSLA 3RRMA 3WNBA 4BLUA 4BV9A 2O8CA 1FNDA 1BO6A 5A5FA 1I7LA 1CVIA 4P58A 4JV5B 1IY9A 1FSSA 2INGX 4A6PA 4DREA 5T57A 4EX6A 1E79D 4MSUA 1RHRA 2ZP1A 3EAQA 1MGPA 1TZBA 4GYYA 1FTQA 4HFRA 2P79A 3OCYA 3TN7A 5L3QB 4GPEA 2ZREA 2HCTA 4PAWA 3VSBA 2ZI3A 3NBYC 2FSVA 1DHRA 5J2UB 3RAFC 2IHUA 4K40A 1IPHA 2HU8A 5CCEA 3IMKA 3IS3A 3NVKI 4F2HA 4M0KA 2BFNA 3PFBA 3QPVA 3EIFA 5HJEA 1JLRA 2GPSA 3KQQA 3HBMA 5IS2A 2X0FA 1XA0A 2MSCB 2WUEA 4JZYA 1PZGA 4L07A 1DGQA 3LUFA 3U7EB 5K8VA 2H2AA 3L49A 1U0SY 3UMRA 2DERA 3C7TA 1Y42X 2PZAA 1GU1A 1VLZA 1NONA 1Q74A 2XE6A 2AZDA 3G8AA 4QPNA 4WK4B 5EE0A 1XXHE 4MVCA 3QVKA 4IDHA 4KWIA 3SU8A 2WQ7A 3OUZA 2AN3A 2WILA 4JLBA 2ZB8A 2WP8J 1N2HA 1SG6A 1UBEA 1IAVA 4CLHA 2YWJA 2JFGA 4G4SP 4MRNA 3BMNA 5JUWA 4Z4GA 1EWQA 1U2ZA 2J4DA 2JFVA 3DDCA 5GV7A 1EHIA 5KNCA 4GECA 1KAOA 1S2OA 2ZWAA 3JD4A 3SXUA 3STXA 5U4XA 3WNQA 2F1OA 3DQPA 2I6SA 2NXJA 5CT4A 1AG9A 3LJKA 3W2EA 2IVFA 4RNCA 1NVVR 4FX2A 4Y7DA 2YY5A 2ALJA 2WV7A 1K5DA 3IKVA 2FQYA 4KMOA 1EP2B 2JCXA 2W90A 4Q16A 3U9LA 5AUOB 4J4HA 5JXHA 2OC4A 3MCZA 1QIEA 2BMAA 5DHQA 3P2KA 3ZJYA 3GPDG 4DLZA 4ZO7A 1ODTC 4JGGA 4LRYA 4NS1A 4X7BA 3RIGA 3ZGLA 3KZKA 5JDIC 4TWIA 1C2YA 1HT1E 4G26A 2X6TA 3MILA 1NW9B 4S35A 5KSZA 4II7A 1M2HA 1LFAA 2R5WA 3QUBA 4GP7A 3TLEA 4QLAA 3DL7A 3LFUA 2XRYA 5E9JA 3TZEA 3I09A 1XLVA 1TMGE 1FYWA 1ETUA 1IONA 3KZNA 2ZIZA 2QTMA 4ZVPA 2XVAA 3RANA 1GYRA 2UZ1A 1NJFA 2CL7X 3MERA 4PW0A 3PKIA 3T5DA 3VNBA 1N36B 1RI3A 1UKBA 1VA4A 4E5KA 4QARA 2GN0A 4ABTA 2O3RA 4URYR 4YTEA 3WGKA 5FQOA 4LXIA 4V1CI 4YECA 1GCGA 3BB1A 3WIEA 3WQRA 4LMAA 1RQ2A 1KDTA 1KF0A 3OLWA 4LDQA 1W1IA 1JH8A 1FNMA 4IR7A 2QTVA 1LFDB 5IM5A 1UC8A 4X1IB 3RT7A 3F6CA 1UADA 1W7AA 4BECA 1N75A 2O8BA 4D0LB 4YJHB 4DCOA 3EFOA 3EF1A 2WF7A 4ND8B 4Q4JB 3QU4A 3R3SA 3AI7A 3AGPA 1N7HA 3KWMA 4YEDA 4Q9AA 4QAJA 1T9AA 1X7DA 1R9GA 4L4ZA 2VJBA 1Q15A 4PXSA 2I7VA 4C04A 2PV0A 3RSSA 3UMSA 2BH2A 5D6OA 3GLUA 1REQA 1OBOA 2AFHA 4RKFA 4YAEA 5BQXA 5FFMA 3Q9NA 3EIHA 4DNFA 3D6MA 3IOYA 2NU6A 1AZLA 3P2EA 1Z5UA 1UPAA 2GARA 3H0KA 3QBEA 1AKEA 1I5RA 4OMFG 4TT8A 1UWVA 4UHBA 2PZJA 1J5PA 1NJSA 3DV0A 4ONEA 4XYEA 2YC4C 5DLPA 2NYAA 3FFWA 2ODEA 1OXXK 4QLOA 3T1YB 3BJMA 5HILA 3FB4A 1UEIA 3G2MA 2XGMA 1GV1A 1XZAA 3TFWA 4JB2A 4U7HA 2O4UX 3G1WA 3HCNA 3LIIA 3ZTWA 2C9MA 3EIWA 4D42A 3PTZA 4MV6A 5EUBA 3KT6A 2PMCA 3GNLA 2P9EA 1HYBA 5BN5B 5B7QA 1BWPA 5FCDA 3BA6A 2LZ0A 4E94A 2PR2A 3DUFB 1R0WA 1FLVA 4HDMA 4J2HA 5ES3A 4F5YA 2DPXA 1DJLA 1LTQA 1V8ZA 4H7EA 3UJCA 3G89A 4N6GA 2BHNA 2ZI4A 3P0HA 3BEDA 1QH8A 3H13A 1FP2A 4F12A 3K2BA 2AG0A 5EIFA 5CLJA 2O8DA 2QR5A 4K6OA 1FLNA 4JVOA 4D4HA 1A50B 1HE2A 4Q15A 4RQUA 5ALEA 3RUEA 3H2JA 3U37A 3O8QA 1UBLS 2VNSA 3KALA 2EWWA 2Y1EA 5I9LA 2O48X 2O2EA 5CB8A 4KNYA 2FP4B 3LUKA 1R74A 2ZBFA 5FBKA 1XWFA 1MB3A 4ERNA 1P1JA 2CY0A 3PXAA 5AKYA 4CG1A 1J8VA 1TM3E 1JBQA 2C4UA 2GPJA 4FSDA 4HQFA 4P6VF 3JVIA 2OTCA 1GQOA 1ESCA 1T9BA 3D4LA 4IGIA 2D5IA 3GH3A 4RIHA 3K96A 3MRVA 3QA9A 3STYA 3FBWA 3T3EA 1C1HA 3KAKA 3AEXA 1M8FA 1KHTA 2ZRLA 3OFVA 2Z3WA 3P9SA 4KE8A 1Z2OX 1LX7A 5FI1B 2XJ9A 3MPUA 3MYRA 5IK2A 3KR9A 1YB2A 2GSDA 4LSZA 3VZDA 4FKZA 2ZM5A 3V6MA 4LFCB 3KPVA 3VUFA 4YT5A 2I1VB 4DSNA 4ZJYA 3OM8A 4X3PA 5T6BA 2M6LA 3T9BA 1EUCA 3A32A 5LMCA 4JWKA 3L0DA 2H5IA 3SJBA 1FF9A 1PK7A 3GPCA 3G2JA 4RE6A 4V02A 5P21A 3UO8B 3ZWKA 3WL7A 4E0BA 1N2GA 5KEIA 1Y3HA 1NDQA 3R0ZA 3CLUC 1D1PA 2ODNA 2C4MA 1H2BA 3L7AA 1L3IA 1PR6A 2I99A 2P6OA 4PCAA 5BNWA 4IIGA 3W05A 4PZAA 3JQFC 1I1HA 2VZEA 1S1CA 2UZ3A 3KKLA 4CR7A 3CWZA 1FFAA 3ML1A 2P6MA 4GXRA 1F4PA 2FPPA 2GEDA 4J2OA 1NU8A 3DOEA 1I80A 2WAAA 3N07A 4LJ6A 4M53A 1QHFA 3ZE1B 1W2GA 4HWPA 1J20A 2SICE 1QMPA 3NFYA 4NONA 4CQMD 3G6WA 5LKAA 1GITA 2HWWA 4FT4A 5LQMA 3YASA 4GH5A 3AL2A 2YR0A 4LF7B 4G5OA 4AYXA 4EI7A 4PFJA 2LW7A 3GI1A 1V2HE 1DT5A 2BFPA 2FSSA 1W2WB 4PNHA 1C30A 5KHAA 4AX4A 4Z1OA 2HXSA 4RZQA 2PUTA 3AJEA 2ZQ5A 2NV0A 3PNPA 1X13A 1FVXA 1YQGA 3SHQA 3BMCA 1K5HA 1T4CA 4I36A 4K6CA 3KLBA 1K4YA 3C97A 5B2ZA 1OH6A 2HNKA 1HWYA 3CLSC 2ORED 1LPMA 5I7HA 2Z95A 1S3SA 1PWXA 4X1YB 4FGZA 2D5CA 3D6HA 1RYMA 1E2IA 2VYNA 4KC0A 1YZYA 2IUTA 3QUCA 5DKFA 5FA6A 3EXFB 3L41A 4XPIA 4YMTA 4IXTA 2ZYVX 1RRCA 5KS2A 5M3BA 1TJYA 1GGEA 3HYRA 3TQCA 1KP3A 2B4YA 4M1WA 2B8WA 4GM4A 5MFPA 1KE1A 4J7UA 1W34A 1O8BA 3IEPA 3C8DA 3I9OA 3R75A 3TW8B 3AQ4A 4KACA 2ORYA 4BLSA 1AMOA 1OT5A 2H4WA 4YP7A 5EPEA 4YMUA 2XQVA 1LI7A 2CXHA 2AE2A 2G83A 3PPVA 2E4UA 3QTLA 4JR2A 5EGNA 4B4KA 5EJEA 2TRSB 3RC2A 3IUEA 4XCVA 3SGLA 1S01A 4BBZA 4W9RA 4GGMX 3HV0A 5HOEA 3K5WA 5HPYB 1S96A 5C0OE 1VKJA 4LIPD 4N5IX 3OESA 3SZMA 2MSLA 3RTAA 2H1WA 3UXYA 2P77A 4H1UA 4NYIR 3NAQA 2A52A 2VSYA 3AB3A 2XLCA 2B7BA 2WSSD 2C3YA 5JJCA 5H82A 3KM0A 1AUPA 1PS8A 3D4BA 3AY7A 3NALA 1FNBA 2YWXA 3AR8A 3R40A 5DP2A 3TSOA 4UUQA 3P2JA 1FYVA 1AHHA 4BV3A 4WZAA 4FCTA 3MS2A 1OD6A 2MTBA 2X23A 1QTIA 1KRWA 3Q7QA 3QYAA 3R9IA 2WR8A 3VNRA 3EMOA 5KO2A 1JIKA 2Z43A 3EZ6A 4B3RB 4FDLA 1Q1QA 3UC5A 1X1SA 3AM3A 4RPJA 3HYTA 4BNHA 4GKBA 3FNRA 3SXJA 2GN1A 2C2YA 4KE6A 3BXXA 1CEXA 3SYMA 3PD0A 1NW7A 1NLZA 1HV8A 1UJBA 1UKCA 3KZCA 1IK4A 1M2JA 3LHSA 1W5SA 4P4GA 3PPXA 3I8SA 5I4KA 2HA5A 2V6IA 4Z9XA 5ICCA 2JD0A 1TQ4A 1RWPA 3K32A 4AAYA 2OPBA 2GZDA 4KWEA 3J81k 4V0MA 2QI9C 2QZSA 3JQCA 2I7CA 4X6XA 1UJCA 1XLTA 2X8JA 5AM2A 2OG1A 2R00C 3CEMA 3A3KA 4EKNB 1L3CA 3ABRB 4PONA 2YY6A 2ZBVA 1LKZA 5GJVC 4QG3A 3CI0I 4B85A 5AVQA 1XMXA 1FS5A 1ZC4A 4CEIA 5FLKA 5L6LB 1Y81A 1ZIOA 4BNDA 3SQLA 3SZOA 4KXUA 3EZ2A 5M2QA 1SULA 1YBMA 2HNBA 1UBSB 3W5SA 3NAMA 1SMKA 1PZMA 1FCJA 5EWJB 5B57C 5JXJA 1F2UA 4DAOA 2G1PA 2C95A 3BX1A 1APBA 2W37A 1NRXA 2PKXA 5LKRA 1OZHA 1E2DA 3ZCXA 1HDRA 1OU4A 2BGMA 2JFBA 1S6YA 3FKQA 1ZGHA 3E3OA 4TQUS 3MZ0A 2HQ1A 3UXEA 1AO3A 3H5VA 4MICA 4DCTA 1BG6A 5BW0B 1GZ5A 2DWCA 4L8WB 1SVOA 3BUSA 4RMIA 3TKYA 2VK2A 5FBHA 1P31A 1P6UA 5JAQA 1K27A 4F5WA 5EAIA 4EO9A 1LRKA 5FBQB 2X0JA 4DCCA 3K05A 1BMTA 4BKQA 4JU9A 1FJHA 2E6UX 4E21A 1L5WA 1XC7A 1N32B 2Q0QA 4A0QA 3ZJVA 4WRRA 1N2SA 1RYNA 1DQNA 3EAGA 3FW1A 5G4LA 4B74A 1YB1A 3TIFA 1F12A 3UMFA 2W48A 1U8UA 3AINA 3GJRA 3JQAB 3W6ZA 4B7XA 1D2AA 2M1XA 4WJLA 4MMZB 5A5DA 4O2RA 1FQKA 1JEAA 2EV9A 3GP8A 4KAFA 1V9CA 3GPBA 5F2EA 4BV2A 1Y8QA 1XNGA 1JJVA 2QTHA 1OIWA 3FZQA 1KETA 1KBZA 1ZLXA 4TYMA 2R6R1 4FMDF 3X0DA 4B6GA 1HQCA 1NVVQ 5BV1A 2BFWA 1PL7A 4R0NA 3QLUA 4LRUA 3DGFC 1GPH1 3HKEB 1KSFX 2WHRA 4FD2A 1KFCB 4KJXA 4Y2HA 3ZOZA 3IL2A 2HK9A 1TK2A 5EUQB 2NU9A 1UPBA 2WWFA 3CE9A 3FLBA 1Y6GA 2DHRA 1M8JA 2O23A 3W8NA 6CHYA 3ZOKA 1KI4A 2DC1A 2AMYA 5KU7A 4H3KB 3RUAA 3HLKA 1T91A 1XELA 2VCYA 3WGLA 4ILEA 4MJLA 1JQLB 1FTGA 2YW2A 2FW6A 3KVOA 2XT0A 2BGWA 3PFHA 4ASUD 2P6UA 4LTDA 3A1DA 1XALA 4MQEB 1L7PA 5KJ6A 1H2AS 4TV8F 1Z7WA 4XSHA 5BN4B 3SFZA 4CTKA 2HRDA 4BFYA 4EYQA 3DOIA 3E53A 4FR2A 3HL0A 1XHFA 3V7YA 1HOTA 3VR6H 1WUJS 1Z8HA 3BD8A 3K6JA 4A73A 4GLOA 1LPBB 3H7IA 2X1HA 4M86A 3C6KA 3L1HA 4CM3A 2VDPB 2WD7A 1JJBA 3Q9SA 4PCLA 4RVCA 1A95A 1QRAA 1JV2B 4ZI7B 1MQ8B 2ZUSA 1SJ9A 3M2PA 3C98A 3K9HA 4KE9A 4RKWA 4CMCA 3JAKA 1Z22A 3S5JA 3H3XA 1ZONA 1GAEO 3WLNA 3GCDA 1E6EA 1QCYA 4JMLA 2PGDA 4X92A 4BRWA 2VBCA 4OV6B 5CXXA 3GUHA 3FZYA 4RA9A 3PXXA 1NY6A 2P6PA 2R8RA 2PKWA 1L5GB 3DB1A 3QW2A 1QIDA 1CKEA 2B5OA 3NWBA 4D45A 3BT7A 3AC0A 1F4LA 4ZI2A 3WBBA 4QPDA 1W36D 1Y6QA 5ADHA 2QV0A 4BQEA 3BN3A 4OKSA 2ZJ2A 1OX4A 1DB3A 2BFDA 2ZRMA 3T7TA 3WAJA 1RHUA 3GT7A 3X2SA 1Y7PA 3QELA 2ODPA 4CTMA 5M7EA 1JG1A 1VJTA 2A5GA 4XLZA 3N58A 5ITZA 3KZOA 1M2OB 3KOZA 3ZWWA 4FI3C 2JFQA 2OZPA 3BZBA 4UM8B 3HJHA 3RAPR 1ABEA 1KTVA 4WKGA 4X7MA 2HMTA 3WYDA 1CZRA 1YDGA 1QYRA 3IULA 1L6RA 4QUHA 3SZGA 5CB4F 5AVSA 5ALIA 3A9WA 2B82A 3H6KA 5DNEA 1UOQA 4Q7EA 4LX0A 3ZN2A 3HBLA 2CL0X 3GMDA 3MWFA 4K26A 2AFVA 4AVYA 2WWTA 4CNQA 3UWDA 3Q8XB 3DNMA 4IHQA 4QD3A 2VJQA 2WM2A 1VSQA 4IICA 4IO1A 5COQA 3AEQB 4ER3A 1XDDA 1J00A 3EAFA 5K0BA 1N6KA 2KSQA 1SCIA 4JC5A 4LEIA 1XP8A 5CDGA 3OO0A 2NUAA 3D8UA 1SVUA 1XT6A 2BR3A 1GZVA 4IO0A 4YMGA 4PC2A 3VU1A 3C8MA 3I9MA 3L8GA 3WK4A 3Q40A 4MQLA 2IL1A 4OCZA 3P27A 5KPJA 4R9SA 3PC7A 3PDUA 1A72A 1J8DA 1AM4D 4LZLA 4QPPA 3EEOA 3M6LA 4XI9A 1Z39A 4YJ2B 1TQ8A 3SJZA 3VPBA 4N01A 3R0IA 2GM3A 2HCBA 2XQKA 3RJTA 2HF9A 1E58A 2IBTA 4HY3A 4OO3A 3K6KA 4ZVNA 1RAFA 3O8LA 1T35A 5B7PA 3BREA 2H1HA 2H54A 3CB4A 4PHHA 4PO1A 2JFPA 1PZFA 1EE9A 1ORVA 4N1AA 3BQMB 3TZLA 1G4UR 4HNTA 1GWNA 2I8LA 3C6YA 5D7NA 1VGVA 3T9CA 3QMVA 1R0RE 2GEFA 2J6IA 1F4VA 5CVDA 4DM4A 3MWEB 3ONEA 4PAQA 2X14A 2E0IA 1X7YA 1FVOA 1UBOS 3BH6A 1P1FA 3A7DA 2PYZA 4QASA 2XZOA 1QHXA 2Z2JA 1G6Q1 2H4FA 2Z2KA 1E1KA 2ZSKA 1XG5A 2C1XA 1BWQA 3TZKA 3LPLA 3I5XA 1DNPA 1DQSA 1YB5A 3B3GA 4NBWA 3CONA 3CA8A 3Q7IA 1HLFA 1T15A 1X7ZA 2RGNC 2WIJA 3IV7A 1V11B 4W1RA 1VPEA 5DGCA 4MUHA 2GM9A 3R9KA 4XIIA 5F98A 2M6KA 4NBRA 2WMYA 5CIYA 1SC6A 1AKNA 2W93A 1KO4A 3P0RA 3FUUA 1TMOA 3LC2O 5AVWA 3H19A 1KZGB 3CEJA 4FE3A 1JDUA 3UC9A 3QFCA 4FYVA 2IYFA 4HPXB 1EVLA 3UVEA 2WJWA 1N2EA 1W0JD 1S5PA 1XQ6A 5I8ZA 5KQMA 4CT0A 3KEOA 4L74A 2RIRA 1J2RA 1R10A 5K3EA 1VHWA 1DVRA 2GXUA 3PGVA 3PFKA 3QHAA 1GO2A 5BYAA 1MXFA 2YYAA 3MXOA 3AIKA 2D0OB 4FOLA 1YS6A 4YRCA 4BGIA 2B1RA 4OOEA 1CQIB 3PUZA 4F46A 1OSNA 4GI2A 1UJ5A 2Y67A 4ZMRA 4C2AA 1YK1A 1B43A 2C3PA 2M1ZA 3UG6A 1II0A 2GT1A 3W8DA 5HS6A 3JR3A 1SKMA 4DR4B 4RK0A 1Y4SA 2DPHA 4HDOB 3HJAA 5UKDA 4OHCA 2PS3A 3BD9A 4DIUA 1YS1X 3WJ2A 1VHDA 3QV2A 2E4AA 4KYTA 1NASA 3GVPA 3L6BA 4MVJD 2WTEA 4QOHA 2FF7A 3FVRA 5DPMA 3KEFA 3GJ0A 1TC2A 2Y99A 1RM5A 3EGEA 2I7TA 5IAEA 2GRUA 2W7TA 2G5CA 3MJFA 4J76A 2GPAA 5FLYA 1F0KA 1J0BA 3IXQA 1A82A 1BMFD 5ALVA 2ZRHA 2VHYA 4RZUA 4CM5A 5JSZB 4TKVA 1Q12A 4DLAA 1S8FA 1IOVA 4OQPA 1DX4A 1P1IA 5A7FA 1NBME 3WMRA 3UF0A 4LYAA 5IWAB 3G8DA 4IOJA 1IU9A 1MEJA 4D6YA 3UMJA 2XUFA 3NRBA 3BYZA 3NDIA 4BFUA 1H0SA 2J9ZB 2OMEA 1CX9B 2CLEB 5CMLA 1GYQA 4EHDA 4MRPA 2HT6A 1PW5A 3DW3X 5KMGA 1BKDR 4FDTA 5JZSA 3K09A 1E1QD 3TM5A 4KQ1A 4Q4AB 4TVOA 2Q6OA 4AZ3A 5K3OA 3D0KA 3VV2A 1XCGB 2OSVA 2J45A 2I03A 3INYA 2VJPA 2YYYA 4UUAA 1MH9A 2QTFA 3IYLW 1RSZA 3H7AA 4WK2B 4ESEA 2AB0A 3GRUA 1ZK1A 3ORQA 4NWIA 1G20B 2J41A 3NLLA 2UYCA 4JLMA 5DHUA 1QB8A 3JQAD 1X9GA 4B87A 1RYFA 2BCGY 3AX6A 3ZHTA 5ALQA 4G4IA 3DP7A 5KVVA 1FMFA 4I4CA 3DNFA 4MAMA 2Z8XA 1ODIA 1G8MA 3N0XA 3T35A 2ZW9A 4M46A 1RI2A 2LCQA 3CGGA 1R5JA 1ZHHA 4OBXA 2VI5A 3WZLA 2W2QA 1LLFA 2W6MA 3CG0A 4MIYA 4W8GA 3ANXA 5J1TB 2ZRNA 1QH0A 5U4QA 5JZMA 1Z34A 3NVAA 2I6TA 2E3JA 4XGRA 5LB2A 4BOYA 4DNOA 1BVRA 1PDWA 1W5AA 5E8RA 3B9PA 4TYPA 4ZGGA 4CHGA 5TQ2A 3LC0A 4C20A 1T9DA 2B78A 1L7DA 2L19A 1F8XA 3ZHOA 1JMYA 3CLKA 7MDHA 5K0NA 2AIRA 4RFSB 1EWVA 3P96A 4DQDA 3NMUF 1PZXA 1WMSA 2I66A 1U7HA 2B4KA 2ZRPA 3LXUX 2ZUUA 3BGDA 4O4LB 1ESZA 1OLXB 2Q7XA 3KV1A 1GGMA 5SY9A 3QKUA 3WXMA 3O84A 2QTWB 2HL6A 5BRNA 1N25A 5A06A 3RGWS 4MPPA 4JUBA 3T5PA 2PZ8A 4DQXA 5KJCA 2BBSA 4GXQA 4BVAA 4DMHA 3IAAA 4MWCA 5LC1A 1DFGA 1OVGA 2Y0PA 2JAXA 3M1IA 3PQ3A 4WZAB 3PUJA 3EPJA 1G1MA 2Y1FA 5AR1A 2CLMB 3IOBA 3IUSA 3MJ4A 4GBED 2ZAGA 4TKLA 1LRJA 1AKRA 4FYMA 2V45A 1RAHA 1C7ZA 1UXIA 1S8OA 5BURA 1KR2A 1W85B 3M49A 1H4SA 1QAOA 2XT6A 1PP4A 4POOA 2VJDA 2JW5A 3DOJA 2HSGA 3IAFA 4GRDA 1FFGA 2Z58A 2GAOA 3VYTB 2AI2A 4M9XA 1WQ3A 3O38A 2OGSA 3QXHA 3HN2A 1QUEA 1CY0A 1FS6A 3F47A 1Z56C 5AI5A 5JALA 1Q1AA 3EXEB 3T4XA 3HZRA 1ORTA 1V16B 3UTCA 3QEMA 3GCWA 2EQAA 2RHCA 1JT9A 1DAGA 1RP1A 3LHDA 1KBQA 1LU9A 4JVNA 1E1YA 2XB4A 4HC4A 5LXTF 4AMZA 1NKTA 3ZXYA 4RZIA 3OQOA 1QG2A 4HRVA 4A27A 2I55A 2IU4A 2OV2A 2VN8A 3VKFA 2OC9A 1E5LA 1URPA 1Y5LA 4PYNA 5A02A 1KL7A 1GP2A 1QONA 1EFUA 5DTRA 1RABA 4YK7A 3UN1A 1OXMA 1T0BA 2DQZA 3WK7A 3PLAE 1FQOA 5JS1A 4Y7CA 3PJGA 3CZRA 5K3FB 2XMBA 5KYNA 1XTIA 2BFCA 4K28A 1CRQA 2R6CA 3GJ7A 5AXAA 1QO9A 4TWAA 4AM8A 4HLUC 5K0GA 2I4RA 4BL5A 1NP3A 3O4HA 2G1JA 3DLPX 1TJPB 1Y33E 3AW8A 3NC4A 1YULA 1ZVMA 3VPGA 4H1WA 1DRVA 2PS0A 4IDFA 4MW1A 3VRHA 1XTTA 3ZGYA 2WINI 3NTUA 2COEA 1NC3A 1M1NA 2RGDA 3C39A 5D51S 1T5IA 1XCJA 1SBTA 3AHIA 3ELWA 2YIJA 4AN4A 1WPRA 3C8ZA 4H9GA 1F5SA 1U2QA 2PYDA 3ECCA 2QM7A 3RRZA 1QP4A 1LBHA 2WKSA 3I34X 4M54A 5HF9A 4HNRA 3I45A 4U8GA 2HDWA 3HB0A 3C3EA 5FOQA 4C4YA 3MGKA 2Q1YA 1HDGO 1KKLA 3SKXA 4H6XA 1AJEA 4YLGA 3VI4B 1W8DA 1M7GA 2FW9A 1VM6A 5F73A 1Q3KA 4I1RA 4NAVA 2OAEA 2BM1A 2RHGB 5IZCA 5LVAA 3VNUA 1NRWA 2MWMA 2Y1KA 4XQGA 2QYOA 4HWGA 2FJUA 2IUYA 3T1TA 4L1KA 2VP9A 3LPDA 1YL6A 4U7TB 1T6YA 1YRBA 5AD1A 1C0PA 3GHYA 1SUAA 2H57A 4YRIA 5FH9A 1IEVA 3IPCA 3EEYA 3LBNA 4N5MA 3HO1A 3EC1A 1BKYA 3V55A 5H1YA 1WVGA 3S8EA 1ZLYA 3NO4A 3D2AA 2BSAA 1PLLA 3MOIA 4YRQA 4C3VA 1EESA 3V6LA 2BFOA 3WLAA 3A1VA 3JZIA 2GBLA 2J3MA 3ESQA 4GI1A 1KFKB 2HQBA 2F43B 3K72B 3OURA 3FXAA 4KWCA 4RX1A 3HVUA 2CBXA 1QHHA 3B7PA 4FI3F 3GRAA 2J3HA 3O90A 3R77A 5K4HA 1CZKA 1NVDA 1OBCA 4W5TA 1M0WA 1DIAA 1HK7A 5DYGA 5AVRA 1ADJA 4CLEA 1IHPA 4IS2A 4R71A 4G4JA 3K1AA 2XQGA 3U13A 4LF6B 3V8NA 1ZKDA 4F9GA 1DLIA 2AVDA 5H3CA 2O20A 5BR7A 3WKDA 2G0TA 2H00A 2YCBA 3JSXA 2P1RA 5CGQB 4UATA 1L2TA 1WDTA 2V7QD 1I10A 3QVMA 2F9FA 5C18A 3LECA 5AK6A 5GV8A 1F60A 2EFHB 4IWXA 4RDCA 1IK6A 5D01A 3QYJA 4LJSA 1XYVA 3R74A 4ARUA 4DV0B 4J0KA 2WVAA 2ZRGA 3MJDA 4Q0MA 4QGFA 5CYFA 4BB9A 4EFDA 3DHNA 1TDJA 5KU1A 5G0VA 1ZGGA 3AERA 1E6MA 1RXIA 1WSBA 1CR4A 4I5EA 1QS0A 1U9IA 4IIHA 2D2FA 4P5DA 1JTFA 3WE7A 3JALB 4EVIA 5KNBA 2FDCA 3DZHA 1VI2A 2DSTA 3VPCA 2XMSA 5AHRA 3LG2A 3V1MA 3M5DA 2RHMA 3NHZA 1SOMA 4N5HX 1ZU5A 5BR1A 4HZIA 3TTUA 1TM2A 5FBZA 3IRUA 4JODA 2QLNA 2E89A 2D5AA 4WLOA 3WKEA 5EC8A 2A14A 3FYUC 4GNKA 1EX6A