3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
3AB4B 3DHXA 2RQMA 4PZUA 3NRBA 2PA3A 1RBQA 4EW3A 3OBIA 1JKXA 4ZYYA 4GMKA 1YBAA 1LK5A 3Q0IA 3O1LA 2J0WA 4ZZ3A 1NJSA 2P9EA 1ZLYA 5IS2A 2QMXA 3OFHA 2JHEA 2QSWA 4X84A 5IT0A 1ZPVA 1M0SA 4YFYA 3IXQA 3TUIC 2J0XA 2GARA 4DS3A 3HHEA 4ZYXA 3MTJA 3W7BA 3TQQA 4QPCA 2F1FA 4Q12A 1S3IA 1UJ6A 4QPDA 1LK7A 4LUBA 2QMWA 3IBWA 3OFEA 2FMTA 4GO7X 4ZYZA 2QRRA 1UJ4A 2DTJA 3P96A 3R8XA 2CFIA 2I9SA 4ZZ1A 2KO1A 4GO5X 2BW0A 3L7OA 3ENQA 1RBYA 2P9CA 3AAWB 2P9GA 4NMLA 2MDAA 1ZLXA 4ZZ2A 1RBMA 3ENVA 3LOUA 2CDQA 3U7JA 3S1TA 3OFFA 1RC0A 2RE1A 4IO1A 1RWUA 2H9ZA 1C2TA 3DC2A 3TUJC 4YFVA 1PSDA 1UJ5A 5IT4A 3DDNA 4ZYUA 2FGCA 3OFGA 1ZGHA 1CDEA 3DA8A 4ZZ0A 1RC1A 1LKZA 1YGYA 3CEDA 3LUYA 1GARA 4R8VA 4TS4A 5J9FA 1SC6A 2NYIA 2ZHOA 3N0VA 4ZYTA 3AB2B 1XTZA 1YRWA 3ENWA 4EW2A 2BLNA 5JJBA 2LVWA 1MENA 1FMTA 3GARA 3TQRA 3K5PA 3KWMA 2LQJA 3TUZC 2RQKA 1MEOA 1KS2A 4TTSA 3P9XA 5T41A 2JOQA 1RBZA 4PWUA 1CDDA 3KCQA 4ZYVA 5J63A 1O8BA 2DT9A 3MAHA 4NV1A 1MEJA 5FIIA 5CJJA 4IQFA 3AV3A 4EW1A 2YWRA 2F8MA 3DHWC 3DCJA 4ZYWA 1GRCA 2PC6A 3UW1A 4S1NA 1Y7PA 1C3EA 4TT8A 1U8SA 4M8LA 3AUFA 3MWBA
chains in the Genus database with same CATH superfamily
2ODWA 3QVMA 3UN3A 3MJFA 1Z63A 1RAIB 3UICA 3QT7A 4R1NA 2B1RA 3EXEB 1UPTA 1YS2X 5JS6A 3A9RA 5C1BA 3PFIA 3DD1A 1WACA 3ZU6A 1F14A 5B1HA 1L5NA 3SI8A 3D4PA 4FFVA 2FE1A 3BXFA 3GHHA 4RA6A 2JFOA 3DC7A 2H9AA 4ZOCA 4D6XA 1JEOA 4CO4A 4M87A 1LW2A 1DFHA 4JOBA 4P4TA 6Q21A 3NOXA 5CH8A 4H59A 4PAOA 1OO0B 2PZJA 5EP3A 2Q21A 4OAOA 5AXAA 2CZ4A 5AXMA 2QAGB 4NK5A 4N3BA 4OAPA 5L39A 3QXCA 2BGNA 3KK1B 1BX0A 3P9XA 3KK0A 1LDGA 3JVDA 2V3VA 1YI2S 1M5OC 4EG0A 1LXCA 3U16A 3FOBA 2BJVA 3BXOA 1Q91A 4UE2A 3HK2A 3M8QB 5CDFA 3V4VB 1Q7YT 4XYEA 3EEBA 1FKAF 2TS1A 2FLVA 1LPBB 3ZGXA 3MR5A 3NW9A 4QEZA 3SZGA 1RVDA 4PAWA 4EMSA 1AUXA 1WNTA 2NTVA 1XPRA 3GLVA 2QUAA 1A8QA 5KYVA 4G0QA 5BSHA 3BJIC 4C03A 1Z4QA 3PXUA 4K8RA 1RABA 1WR8A 2P0YA 2QKYA 2AR7A 2VDWA 3DT6A 2GZAA 4PSVA 3QVSA 5KJFA 3C6BA 4JLMA 3PKYA 4JB2A 1SL1A 2Y3YA 1IR1A 2QTWA 2DPXA 1KGDA 1VQSA 5IT4A 4ZP6A 3PCOB 3T6JA 1IEVA 3WLTA 2M7SA 4BNTA 4P5PA 4E03A 2OAUA 1HY3A 2K7ZA 3MXOA 5ALTA 1YBTA 1NTOA 3EZUA 1DAMA 5LIRA 1LBSA 1VISA 3MS4A 5FNVF 2QJFA 2QX9A 1WLSA 2JOQA 1HH4A 4LF9F 1E1LA 1ZMXA 2FMKA 2Q5JA 1Y1LA 1P61B 2IEDA 3G0DA 1QHGA 2OPRB 1JN0A 3TECE 1GA4A 4KSCA 4J1TC 1YL5A 5EGSA 2GIRA 3MPUB 1IBCB 5LXTA 2YZKA 1K3UB 4L3OA 4FEAA 5I8ZA 4NIMA 2R48A 2PHZA 1F2UB 3MPDA 4NMXA 3U6BA 3H86A 3LRPA 2DXDA 1X13A 1W8DA 1XZAA 4YPVA 5KFUA 7GPBA 2A57A 5HJ2A 4BQOA 4PQYA 5F21A 1G0NA 5IVIA 1FFSA 4C20A 3I42A 4EVQA 3L43A 5C3MA 2FRVA 5K0BA 3TGPA 2BVZA 1U28A 3IBGA 2ZE8A 3HU2A 3IPCA 1G8PA 3RUDA 4DSKA 2VDRB 3EGDB 4KDFA 1TK0A 3MPWA 3G0IA 3IURA 2NUAB 2P8JA 2DCMA 3PQ2A 1DKPA 1U63A 2H51B 3KQWA 2PLFA 3C2PA 2F9MA 4X1IB 3UR0A 3SCJE 3TA2A 3BFVA 3NGUA 3PFHA 3JYTB 5CA1A 3TWZA 3V2UC 1MN6A 3K73O 2J3IA 1UAWA 2C2ZA 4R4JA 1JLAB 2QV0A 1WKVA 4M1EA 4RPFA 3PHHA 3D3BJ 1RP7A 1A9NB 5ECDA 2GN1A 3NYRA 1CQJB 5EIHA 1A88A 2DMRA 2YTCA 3JYLA 4L6AA 2BW2A 4J76A 4XWGA 2FOXA 3DVSX 5L7WA 2VAPA 4WKRA 2NZYA 1SCBA 2IT1A 3JXEA 4NCGB 5DN6A 4D9KA 4Z7JA 3CEMA 3C4JA 3R75A 3VNAA 3WLOA 4B32A 1JDTA 3T3IA 1I51A 3PC7A 1QGDA 2EWMA 5AIAA 2V2VA 4R0MA 3LVRE 1I01A 2AVNA 3WHLA 1BEZA 4QBUA 1NW9B 4RTOA 2ZRQA 3AOAA 2XBUA 1E1RD 3TAPA 4YJHA 2WFZA 1E58A 2N47A 1E3LA 1EGVB 1RT3A 3N58A 2YXBA 1Z16A 1OLSB 4RPJA 4KHPJ 4IX9A 1YQQA 4GR5A 3JR7A 4PC3A 5CABA 3UWTA 2VA8A 4CWBA 2GMHA 1TCAA 3OVAA 3GAAA 3ZE2B 4V38A 1V45E 5JY1A 2XITA 4IYJA 5F23A 4C05A 3TQIA 4R2IA 3D1HA 4BMPB 2VN8A 3RC8A 2CJKA 1RFGE 2BGMA 4EABA 1K0UA 2IU3A 4IEEA 1SK8A 3G7NA 3IMFA 2XHCA 1KD1T 3UH0A 4BNMA 1JFRA 3RO7A 2FMIA 2IPOB 3DZDA 4I5GA 3R7AA 1V9OA 2P6NA 2OAQ1 1YBUA 5C0OE 3PRYA 1RE1A 2FQQB 1H9AA 2I7CA 4DL6A 4PGHA 1NXSA 2HNDA 4S1WA 4K87A 3R7SB 1U1GA 3DA8A 1C3XA 3L1UA 4Y0AA 3PNOA 5FHQA 2K2WA 2RNEA 4D7AA 2IY5B 3P0EA 2M52A 4TMYA 5AHRA 4J43A 4JJKA 1UFRA 3MERA 4M22A 3TOQA 1TC2A 1RHQB 4AQDA 5IWAJ 3J81j 5EPEA 1U3CA 5J63A 1JZSA 2OOSA 2AVDA 1PV2A 4G1EB 1PCAA 1UPUA 4MV5A 1IAQA 4Z8YA 3A1VA 1P4HA 5TNXA 4AG3A 3AR5A 1TF2A 4JKYA 1SFRA 3PZBA 2DR8A 3WLNA 1FFDA 4MUYA 4KTQA 1D09A 4UY8T 2DHGA 3I92A 3LWNA 3WLMA 3VCDA 2RONA 5LUAA 4FXOA 1JHPA 3JQAB 2HPHA 2E82A 1XHFA 4ZHSA 5CIWA 2LMIA 2ZH7A 2RHJA 2RQCA 4REQA 2YRWA 5B6IA 4NXNB 3K71B 2XY6A 1U8XX 1ZI8A 5EVCA 3CSSA 5MN6A 2DNPA 4RUCA 1U5BB 2PQMA 3SICE 2ZIFA 2KJQA 2ZE7A 3AUTA 3TFOA 3WK7A 1LPSA 5ECGC 1X94A 4RKRA 1U0SA 3S7RA 3WFJA 4UHCA 3EVZA 1H2ZA 4NENA 4Q3CA 5HKOA 4ZQCB 4S3MA 2AFIB 3PUZA 4I1VA 4O4IA 1SWWA 2HM7A 3IIMA 1X4DA 4NABA 2ONYA 4CM7A 2YHSA 4IG3B 3VJKA 4TVBA 3S27A 3L93A 5C81A 1WTBA 3RFVA 1E2MA 3UD3P 4MUBA 1QTIA 4D5GA 1PG5B 3W8FA 1ZRMA 4ZI3A 3ETOA 4MVJI 1AGNA 521PA 3FPSA 8RUCA 4WESB 4M54A 1Z1ZA 1BE0A 1B14A 3B1KA 2PBFA 2GPYA 2P4EA 1JJAA 3VDXA 1XMQF 3HN6A 2FW0A 1GN8A 4Y67A 4K7QA 2FLWA 1T03A 2BFEA 2GN9A 2Y1CA 3D3KA 2J3HA 4ZCKA 4EH1A 1IMJA 2PAAA 2KWIA 3EZNA 1RXWA 1NXTA 3VGSA 2VJOA 5DM60 3SM9A 3O3NB 5J1EB 1CUAA 2MKKA 1OY6A 3TIXB 4FQ7A 3K5MA 3AI3A 3LBHA 4HNSA 13PKA 3SQGA 1NHKL 2L42A 2XLCA 2DJWA 1K9SA 4JROA 1D5WA 3QOWA 3H5RA 4MUGA 3FG9A 4F4HA 1NHGA 3O90A 1I32A 4UQTA 3IR6B 2B7BA 1HBNB 1FXUA 1VG1A 3QJGA 4Y2YA 3TZLA 4AN0A 1XVTA 1II8A 5IN5A 3PQ3A 3D9BA 2GZRA 3R8CA 4HPJB 3FKSD 3MD3A 1S10A 1C7JA 2OPPB 4H7IA 1JJ7A 2OGTA 4NXMF 4DDMA 1NP6A 3I5AA 3UGQA 4RU2A 1T3SA 4ZVPB 3JATB 2J3MA 5DLYA 2ZRPA 1ZMRA 5IG2A 3X1XA 5I9SA 3THYB 2C2OB 3PNSA 4WCFB 4LQ9A 3K2BA 4KO8A 3QGHA 4FILA 3EH1A 3MTGA 4J9UE 1BRTA 1Q16B 3MT7A 3FYDA 4FYPA 1UOEA 4WZAA 4DFKA 3H40A 3ZY3A 2FPOA 2CPJA 3OOHA 3B8EA 1Q2XA 2AMLA 5JNWA 3UWSA 4LF8J 2O3RA 4QU5A 3GIWA 1O4VA 4UM9D 1X92A 4WH0A 3K05A 3ZI7A 4ZVTB 2LVWA 1S89A 1S1XA 2DBYA 1FDWA 5JBIA 1Z6PA 5J47A 4WCVA 1BKDR 3SZRA 2W9AA 1Y9OA 3RYIB 3BSAA 5BYJA 4J7XA 3C3MA 5IC4A 2YV5A 3EUNA 4OPMA 1YBAA 1GYPA 1LF0A 3ZJ4A 4MYCA 3Q89A 5FPKA 3CIOA 1M1YB 4DDWA 1VLZA 4EWLA 4LX8A 4C21A 2J7WA 2XAAA 1FTCA 4F06A 1TE2A 2G17A 3SE7A 1T5TA 5C42A 2WIGA 4A1OA 1I5OB 4Z6KA 4C3KA 3I4FA 1DIAA 1K68A 4QKQA 4BWGA 2JCSA 1NDCA 2Z3ZA 3ITNA 1IWAA 1OYOA 4LKRA 1SL0A 2V4JB 3M1LA 4TSFD 3RBDA 5JO0A 4NAUA 3QUCA 2IUYA 1KKLA 3LQ2A 2WBRA 1ZJ5A 5EQDA 4F72A 3T5JA 3ACDA 4JC0A 4CZ2A 5K4AA 1V6HA 4KGXB 4JVNA 4BX2A 4GKAA 5D3ZA 4BIIA 3QP9A 3G2MA 3AD7C 3ZY6A 2Q5HA 1FNXH 3K1ZA 4XJTA 3PJ9A 4INOA 5JR3A 5AE1A 3FTQA 1W9MA 1AT1B 1PV1A 3OJSA 5KWJA 2XQGA 2WTMA 1ADCA 1WBJB 4WIIA 1ENPA 3P9SA 5SZIA 4ECSA 2NZJA 4C9BA 2V4ZA 1A2QA 1NQVA 1A0OA 1XK8A 1P73A 3ZU5A 2O1SA 4DR4F 4IHAA 4R98A 4HACA 5K8LA 3I4HX 2WY2D 1LC0A 1N0IA 4DPYA 2NO4A 2QY6A 5JANA 4C6TB 2AV6A 1OPRA 1YRXA 3F74A 1UFLA 1FUKA 3LUGA 2VT6A 2PEZA 5E2QA 4C9DA 2PGXA 2VIHA 1QRDA 3MTKA 1SUWA 1E6VA 2FG5A 1RJ9B 1Z2AA 3OPYI 3KYIB 1DJQA 4MIYA 4FDAA 2G4BA 3ZR4B 3FYUC 4Q4JB 3IEPA 1ZISA 2HRCA 2PGAA 4L5IA 3QPWA 4H4DA 1DJLA 3VSAA 3OFND 4HS9A 2HLPA 5A3VA 2G07A 4RFSB 1VHIA 1S1WB 3UMGA 3GZJA 1H65A 2A0FB 4EHFA 4RF2A 3N1UA 1VKNA 4F04B 1BQ3A 1GWNA 1K97A 1AFJA 1S2LA 4BFTA 3RNLA 1KEEA 1SV5B 4NLUA 4U2GA 2VXYA 1IR2A 2ZR9A 4HWGA 2GAOA 2FZ4A 4K6OA 5KSPA 3IBTA 3QWUA 1Z74A 3JAWA 3TXYA 2VK8A 4BUJA 2NSYA 4ZU1X 4EF5A 3CLTC 1P7PA 4EKGA 2IXTA 4F84A 4MI6A 4ZOEA 3GZNB 2CQ2A 2RH3A 4ECYA 1KEVA 4PF1A 1OB5A 5MFZA 1VL6A 4ZAZA 3WGHA 2FPSA 3RABA 1R8CA 3G23A 3BS4A 2P2NA 4H77A 4D8XA 5D78A 3FSJX 1SU6A 1BXKA 2XLKA 1UZLA 3PENA 1CJKA 2O8EB 2WR8A 1FE8A 3B4MA 1G2OA 3M1YA 4C4XA 3K1JA 4I9NA 4K9NA 3E3NA 4PPGA 4Q24A 4ZI5A 4ZU3A 1BQMB 2D3WA 3IHWA 3QIDA 2KH9A 4YXWA 1S1WA 4P3XA 2P6RA 3ILOA 5KFLA 3HHNB 2IWRA 4LBHA 1S9EB 1X6VA 2Q6VA 4UZCA 1HNZJ 4LREA 2XDQB 1NK7A 3GR1A 1C1DA 4PQEA 1R16A 3VR6H 2X8JB 3FLEA 1DO8A 4ZVMA 4PO1A 5K5MA 5K4GA 1R0AB 3K0JA 3VU0A 3X1MA 3EGDA 4PG7A 3HR7A 3QF4B 2DPJA 3I0SA 4OA8A 4KHPB 1SG6A 1WDKA 2H51A 3V6DA 2OPSB 4E12A 5LKRA 4CG3A 4DLVA 5CGQB 3J81A 5J2PA 3W9UA 2ZB4A 2GJIA 2MPUA 3ILLA 4ENWA 1TKTB 3NOCA 2CUKA 4FBGA 2I7VA 3WFZA 3C3CA 1MLDA 3PKIA 3ZEAA 2E5FA 3NHKA 2D4AA 1T1IA 1XHLA 1VHJA 1CBKA 5DHPA 4LF4F 1A3CA 1EBUA 1E18A 4S0XA 2GJSA 2XUHA 1VA4A 2ACEA 4HAVA 1ES9A 2VFTA 5GZ3A 3USES 4BP1A 1AURA 3DTNA 1COWA 3DL2A 4INJA 5J2NA 2JKYA 4REOA 5HVHA 2J46A 1BXNA 2B99A 1RCXB 2Q4BA 8GPBA 4PWDA 3W62A 2GPSA 2KMLA 2TMKA 4PRYA 3PY8A 3GLHA 4FPXA 1XUOA 1GGJA 2IVFA 3IMKA 1L3SA 4USWA 1JYFA 3I5MA 4OEHA 4EI7A 3AP2A 3PQ8A 3D4NA 1AZSA 5K3CA 4TLRA 1P62B 4PSCA 1LDEA 2LZ0A 4WY5A 4QYIA 3MS7A 2VNAA 3BKUA 1YWXA 5IBPA 4HRAA 3AIKA 1WXQA 3TRIA 3WXBA 2VH1A 4DCSA 2ZFUA 4DI6A 5K8MA 4IH5A 3IDSA 3IIJA 2Y1LB 2DAPA 2PANA 3O8QA 4HEA9 2QW0X 2P6UA 2X5XA 2Q99A 1G5IA 5EIWA 4FEYA 1L5FA 1I2CA 2HWTA 4WT7A 1LVUA 4G0WA 1H0RA 5ICEA 3KQUA 1H6BA 5IM0B 1U8YA 1TTTA 4YFVA 4P0TA 5EIEA 3PD7A 4P9NA 3PHGA 2H54B 3O1HB 1I6LA 3QNMA 1NN5A 4KKOA 3OHBA 2N3ZA 1ZGAA 2Q29A 1T3OA 3LA8A 2D54A 1FX1A 3IDQA 4CEJA 5JJBA 4XUDA 3ZY5A 2DFDA 2OVFA 1XF1A 1UWBA 5LQKA 3AYZB 3R76A 3WNZA 4R8KA 3OXLA 2MQMA 2P27A 4CLOA 4JI5F 3AR3A 3Q41A 2XZLA 2MSCB 5A8KB 2J3EA 4H27A 4B7CA 2AJQA 4G9EA 1A5ZA 3IIEA 2QLTA 1FW8A 1BY9A 2R65A 3FOFC 3HYCA 1Y8RB 4EIWA 2ZJOA 3H9QA 4K4SA 2YZ2A 4IUFA 4I9UA 4NYJR 2RIRA 4C0KA 2GIQA 2FUG9 4C98A 3NG1A 5DG7A 1N0WA 1D0VA 5DNAA 3WRWA 3UDEA 3AH6A 5ESRA 2YX7A 4BV3A 1ETUA 2XCQA 2XYGB 2WOMB 2OXTA 2JIMA 2KM8C 1C7QA 2ZCVA 1ADBA 4FK8A 3FGZA 4I6EA 2XGMA 3O8RA 2C9OA 1P4JA 2VV5A 4ECZA 5IQQA 2IMOA 1C1BA 3S01A 4YO8A 5EKDA 4A91A 5DWVA 2R4UA 3IT3A 4C7XA 4WXEA 5H9WA 3FUXA 1JAIA 1UPAA 3NIDB 3VZQA 4B74A 3A8KA 3PYXA 4EBEA 4X64F 1CX9B 5C8YF 2NTJA 3K89A 2CKMA 2QMEA 2P2CB 5MGNA 1CJCA 3NWBA 3PJEA 3VNVA 3RANA 2JBAA 1BKYA 1M9NA 2VKRA 2VTBB 2YFQA 1BMDA 3KT3A 4CQMD 4RCZA 4NICA 3LKZA 3PW0A 4EGCB 1ECBA 4JHLA 1CQNA 2PMWA 3KZVA 5JLJA 3AXKA 5KU1A 4DCCA 2WOJA 2WDPA 4MHOA 1HE3A 4AM8A 2FLLA 4NZNA 1NK9A 3KOOA 5H16A 3AFGA 3E22B 3P2EA 3LGNA 2OUGA 1CY2A 4FUQA 3OMLA 4BVKA 2CFTA 2Q6IA 1P4AA 2CSXA 4UM5A 4DIFA 1Y4ZB 3UOAB 4X4OA 3AHIA 3CSUA 3C6QA 3R3YA 1KEWA 2XT0A 4HX9A 3BEGB 4I8XA 2GKGA 3FZEA 4P6VF 3A4NA 3QNWB 5HZMA 3G96A 4AY2A 2FOIA 5ETJA 3BKXA 4B8WA 1OZHA 4AZ3A 4WKOA 4ED6A 3JQGA 2XMKA 1GQ2A 4OMFG 4B3SJ 1UOPA 1SUQA 5TVKA 2GCGA 4CDNA 3LYHA 3TAMA 1V3SA 1AZTA 3VXKA 4FB5A 4UHDA 3BGOS 1WOOA 3BD9A 3W5XA 3B38A 2OK7A 5DTQA 2PL1A 2WICA 3PA6A 2YWJA 2EOAA 3IKLA 4Y6OA 3CLUC 2WTBA 1JR4A 1XDWA 2POQX 1X9GA 1Z7BA 1E2PA 4G0YA 1D0IA 1BC6A 3WISA 3C8DA 2IHUA 5DQHA 3TLGB 4BL5A 2XA1A 4IQ8A 3C3DA 3NDBB 4ZANA 4L3KA 2XZTB 3DP9A 1SZJG 2JAQA 2QSYA 4RE5A 3E05A 2W7PA 1XMOJ 2VJQA 5EWJA 1RTDB 3SF8A 4G1QB 1EFRA 1K08A 2G0NA 5LZ8A 4ZK7M 1CIJA 4AO6A 3E2PA 2OCLA 3ZE9A 2VK2A 2ZOSA 2XTJP 2MDAA 4A8PA 2QQGA 1V2GA 3LJKA 4WL0A 1I4LD 3JQKA 1SH3A 4WP9A 3AR9A 3NATA 4TV8F 1YA4A 1S1VB 3FRZA 1HYHA 1R8PA 1TB4A 2UUAF 4MV3A 3TIIA 5LQSA 4CKEA 3AQPA 2K6GA 4HB3A 5L6LB 1N75A 5HMMA 1J97A 3OHMA 4DCGA 4P38A 4CV2A 2AK2A 1EXDA 2A5JA 4HHJA 1JPUA 1ZM3A 1FX4A 5J2QB 1CS4A 1QV9A 3IQXA 4IDFA 4IDBA 2QUKA 3A36A 2W8LA 3U60B 1HLWA 5FFMA 1UL1X 1EVJA 1MXHA 4KGVB 4DWVA 4R8LA 1T1GA 4DR1F 4QD3A 5CUQA 3AF5A 2I3ZA 2UZ0A 4RD2A 4C06A 1SXJD 5FL7D 1ND6A 2G82A 2HTFA 1N52B 4P2XA 4WXMA 5FUQA 3TOCA 4AIIA 1ML3A 3AONB 4EAQA 2FMHA 4LHZA 2G8LA 3VISA 2ZH2A 1EIZA 3Q8PB 4TY9A 1NLMA 1U02A 4LI0A 3CF2A 1Q95G 4EPRA 2AD1A 2A9JA 4PQGA 2HXYA 2FP4A 1C7RA 2XZDA 1QIIA 5DHAA 2FPIA 4N7RA 3E5NA 2PEYA 3PXAA 1KMIY 3FY4A 4LYJA 2YVKA 3CVKA 1AQ6A 1QAIA 1JNZB 3OPYA 1GSIA 5J43A 3C8ZA 5AK6A 2C77A 2LKDA 2RJ3A 4O3RA 1SIOA 5L3ZA 4RH0A 4F4ZA 3R2DJ 3W2WA 1AYEA 3DB1A 1QU2A 1JMYA 4AD8A 3KNZA 3U3DA 5ALDA 3ZWCA 1FU4A 1A69A 1M1NB 4DHWA 2YYAA 2QLLA 5B2EA 2QRUA 2H65B 4EO4A 1LWNA 2CPIA 4IH1A 3PGKA 3LLMA 4EWTA 4EM6A 2JFKA 2EJVA 1PV4A 4EY5A 1EWQA 2HNYA 3UFCX 1YZ7A 1XSEA 1C8BA 5AJHA 2HFKA 2V63A 2MQQA 4DFJA 5AW6A 3G6WA 4NP6A 1AS0A 3CJTA 3GRRA 3WAJA 3BH6A 4UEJA 2PRIA 3VDNB 3QXGA 4JI6J 5EGNA 2RJOA 1S2DA 2VCEA 2UUCJ 3OZRA 3RVBA 2QXYA 5HQ3B 4JLKA 3U3OA 3FHCB 2QBYA 2CVIA 3OX1A 5SUHA 1KOGA 1J2YA 5D6GA 1BMQA 2V3CC 2DCUA 2V0GA 2IOFA 3ETDA 3LLCA 5C1PA 2YWBA 3L7LA 1FFXA 4RNCA 2FGJA 5CYFA 4B3TJ 2PH5A 3LCVB 5BQ3A 2DFVA 1DEOA 1KDZA 1V4BA 4BAGA 2SKEA 4CEHB 4JD5A 1YB6A 3H04A 5U4QA 3OTIA 3OO0A 4OI0A 4Y6LA 1RTIA 2HU2A 4WNYA 1TADA 3CEJA 2V1UA 3PU6A 5JYBA 4JI0B 3BHNA 1RAHB 5KNLA 1FJCA 5L3SA 3C3WA 3E81A 1CUVA 4UDYX 5ALIA 3KUDA 3LKBA 5B08A 4UOGA 1YVRA 3IMEA 3DHEA 1MRNA 1IMOA 2EC5A 4AS2A 1GNPA 2PCLA 4EMDA 2KB2A 5AI0A 1EFVA 3LGXA 3Q4GA 1CEEA 1ZD8A 1IVNA 3WV4A 4E4YA 5C52B 4GKJF 4CDRA 3ZY2A 1ZUIA 1NHVA 1DJPA 4BUZA 2UVUA 4TXNA 3IODA 2OCIA 4LHYA 1D4AA 1O57A 2E5WA 3AVTA 3TXXA 4PONA 2HF9A 4NPOA 3KCQA 1B00A 1X1EA 4AS1A 3F1KA 4F6CA 4GXTA 3ZH9B 4B80A 3FPHA 4DBVO 3NAZA 2C5LA 1BD4A 3T15A 3DRRB 5FTKA 3STYA 4LF7J 3WO0A 4NE2A 1C4AA 4UQLA 1PNRA 1MHTA 5DN9A 2FWPA 1D4OA 3N6VA 5J2MA 1M34A 1KZ7B 5FJJA 4JBLA 2REXB 1X9IA 2C5FA 4C5AA 1KJYA 1YZLA 2GQQA 1RPJA 3A8EA 4KR0A 1PYSB 4J6EA 1LDYA 5P21A 2EJUA 3HZHA 3W5UA 3VHXA 2RAFA 2VQEJ 3F2VA 3KKQA 4NG5A 3FBGA 3ENNA 4DV5B 3N0TA 3CCLS 2J5RA 1OJ4A 4PZ9A 1G5FA 1BW9B 5B1IA 3TI7A 1F9FA 1Z4OA 4JB8B 4NCBA 2AX3A 621PA 3W1YC 3NBMA 2Z3VA 5EWFA 3QF4A 4XGRA 3IERA 3DRPB 2VZEA 3CW8X 3DLEA 1XCGB 1VI7A 4KRYA 4FQ8A 5EEGA 1HQDA 4D92A 1BE6A 3TZKA 1DPGA 5B1EA 2VBCA 3UNYA 3C15A 2V0CA 3FMPB 3H1FA 1TGYA 2YKMA 4NSNA 1YDLA 1IKVB 2O7VA 5B3KA 1LNSA 5CIQA 1NBME 3UKJA 1EUQA 3UK6A 3H2YA 4IOLA 5EWLA 3UT0A 3LP5A 5I9BA 2ZJ7A 3LDUA 1ZW1A 1HMVB 3HKEA 2I8EA 4B87A 1GCOA 5BOVA 5EN4A 3EG9B 5EP2A 4DPUA 1X5SA 2IUEA 2PUJA 1PYTA 3RV3A 1URPA 4DPOA 1Y8AA 3IH5A 4K6GA 2QO3A 2PMBA 1FRVA 1T94A 5EXPA 4ES2A 4AWAA 5J3JA 3PYGA 2RE1A 2O0KA 4K7JA 1RHKB 3UT5A 3LBNA 3JRNA 2E5HA 2ZTVA 4AE5A 3L7AA 1NE2A 1R6YA 3BQMB 2D1YA 2HMIB 2JIOA 5A3QA 3QVLA 3PNVA 5LSOA 1GKYA 2WBMA 1NDHA 3ER6A 2O66A 2IF2A 5ESWA 3NGLA 1NKBA 3FHOA 1S72S 2QM3A 2OTJS 3HMJG 2I7TA 2W2NP 4OP1A 1O5JA 5CYJA 2GA7A 4K9KA 2XH8A 5C3UA 5A5FA 4XDGA 3KTDA 4HXYA 2O8BA 1A1SA 4RF4A 1QANA 2ATEA 4US0R 1FUEA 4Y0VA 4ND3A 3GY0A 4B3IA 5KOHB 1V2HE 4P80A 1GSHA 1DIHA 1JKXA 5T57A 5IM0A 3T5MA 4R31A 4IFVB 2AXPA 2X5KO 3I39X 4HQFA 1ZK1A 3HZZA 3L2OB 4BNVA 3W2VB 2IUUA 3SS8A 3WIUA 2Q6CA 3B20A 5GADI 3GPBA 4LW8A 3B1FA 3IAHA 4C3UA 2FPGA 1ZX1A 3DMTA 3FE2A 1MX1A 3ZGLA 4TV9F 2YKGA 2X4GA 2WV7A 2XTMA 2ZBPA 1KMHB 2DIUA 5K09A 1ZGZA 1ZUHA 1V7CA 3FHTA 4OJMX 4DLPA 1SCJA 3UK0A 4BO2A 3DDWA 1UWCA 1VQNS 2ZYSA 2XO7A 4RKYA 4OP3A 5D1HA 3FF1A 1B3TA 1PAUB 4CQJA 3MCTA 2QRNA 4N3GA 1P5FA 1T9HA 1DV1A 3HLKA 4OF4A 1E7WA 1UADA 4ZVUB 5EQFA 3MSCA 1IBLF 5BR8F 4G89A 2I3AA 3R9XA 4PGFA 2FZVA 2AH5A 4LRWA 3IV9A 1QYWA 4I4IA 2V7GA 4RGBA 3EOAI 4D9NA 4GVPA 1JIQA 5C2CA 3RW6A 2YY6A 1XNRF 3ADCA 4I81A 1D8YA 2RJZA 3AR4A 3CWCA 3PHJA 1T8TA 4ZJOA 4C2TA 4UVEA 5B64A 5KOIA 5HIMA 3U44B 5TMEA 1P9RA 1CVIA 4QPCA 3O2NA 5FOQA 4MR9A 5ETOA 1PQUA 4JUAA 2DULA 4WEOA 2G2OA 2XAUA 1BHQ1 4TKMA 1NW6A 1KMHA 4PICA 5L9AA 2RHGB 4ZQHA 4IG0A 3V3KA 4M89A 2IBSA 5IABA 3VPCA 4PKDB 1U1QA 4MWTA 3W06A 1FNDA 1ONPA 3PXGA 2B8JA 4R5MA 5LZ9A 1HWLA 2EWHA 4FXVA 2OXFA 3KT0A 4R2WA 1A95A 3W8GA 4HBGA 4TU7A 2K3IA 4GL2A 2F1OA 4B9LA 3H5LA 3PRHA 3MJVA 5AICA 2GAIA 3H4TA 1RTHB 2YNHA 4A6PA 1RU2A 2KFYA 3P27A 2BRKA 2W25A 4AZSA 1UKVY 1WMBA 1I7PA 3DFKA 4PWUA 4CBVA 1AZWA 4B3MJ 3BRWA 2BQUA 2KHDA 1O2DA 1RRVA 1DC6A 1I3OA 3B9QA 5AKJA 5LL6P 3OY2A 3UAOA 1YKFA 2BGLA 2PA3A 2ZJQQ 3ZH2A 2L19A 4V19J 4TN2A 4L8LA 4ZCLA 1JJ4A 3I64A 1DQ9A 2C4KA 3D1QA 5I5EA 3G2XA 4EKYA 3PFNA 3OKCA 1XZDA 2XWSA 2VP2A 3LF1A 1FFSB 1FRJA 2UUBF 2EFDB 2OQRA 2AF3C 4USTA 4LR7A 1ENYA 4X3CA 1JDUA 4X97A 1GN9A 1L7XA 1TL7B 2DGUA 4U95A 4EJSB 2IDZA 4K6MA 1SXGA 2D1SA 2C5SA 3X1YA 4A4DA 3KLFA 2I03A 1FRXA 5K2MA 3FPEA 1Z5PA 3X3UA 4BU0A 3CKYA 1RPNA 4WX2B 4EGFA 3DKDA 2YWCA 1T4DA 3W3AA 4IXWA 1XZKA 3KS9A 4P72A 3OJXA 2PBRA 2VFSA 3KUCA 3W2TA 5FQNA 4KGZB 4XEUA 1PGZA 4HEHA 2D59A 4HB2A 2AUTA 2R2TA 3H2VE 1HBJA 1MC4A 1OXTA 1I2ZA 4MUIA 4RVSA 3BR8A 4WA8A 1HYSB 3Q23A 3F71A 2Q2NA 2EBWA 2XUFA 3PZRA 2QMXA 2QM0A 3N79A 4RQBA 3MM7B 3JW8A 2Q9UA 3EVNA 5B1SA 5E9JA 1NXOA 1Z7WA 1Z0AA 3A8IA 1AB6A 4B84A 4BB9A 1IM8A 2AOTB 2QYCA 3B36A 4P58A 1RQ7A 4PG8A 2DWCA 4GYJA 4I50B 4HCJA 1PUXA 3VAMA 4DS5A 3PNKA 3EPRA 1NFRA 1QPBA 4Y9RA 4QR2A 1X7WA 5D3GB 2H4JA 2A8YA 4IGAA 2DB3A 4FOTA 1ULRA 1OJLA 3HTXA 3SAJA 5DBFA 3BTSA 2Z8XA 2EX0A 1KAQA 4RABA 3F3KA 1D1TA 2TSYB 3I9V9 2G0JA 2KZMA 1UBJS 1P7CA 1ESZA 3BHMA 4LOLA 1F8GA 1XGKA 3KYCA 5DLEA 5T4EA 1ABBA 2EEZA 1NJIT 5L4NA 1MRZA 1OI4A 4F3YA 1RJWA 2NU9B 5F8NA 5KFEA 5LWHA 5DDOC 5FFNA 4X8LA 4EBCA 3JARA 3F6EX 3JVUA 4UU8A 2VH2A 1FFWA 1DJMA 3CMAS 3D2CA 4OHCA 1FNMA 3MAQA 2EF0A 3EDMA 1I7DA 2IHVA 1F0YA 1NJFA 5HCIA 4G25A 2GFHA 3L09A 4Q3OA 3W3SA 5IHPA 5LQCA 4LSZB 2X4IA 3D4IA 3LPDA 3OEYA 2F8HA 1ECPA 1J33A 2QL7A 3I58A 5EVJA 4DPLA 2C00A 4X93A 4MYDA 4Y2UA 1E0JA 1PSZA 3HZOA 1OZ0A 1X1AA 2NG1A 2FJUA 4J9RA 2HMUA 1ORDA 3OIGA 4UTPA 4AY5A 4D1YA 2E49A 1OOEA 1UL3A 5IZCA 1SMKA 3ZGYA 4H6PA 3TQRA 3BTUA 3HL0A 1JBQA 3B12A 4V1CI 4TMVA 5ANRB 1EP2B 4UJ5A 4AYTA 5BWBA 3RBVA 3HB0A 2F8TA 4UKDA 5CFQA 4HH3C 1SH2A 1MW9X 1C9KA 2C9ZA 4INPA 1Q1QA 1F0KA 1TJ5A 5D84A 4ZCMA 1R37A 1K73T 3ZZUA 4JGIA 3JYQA 5ETLA 2F3JA 3F8WA 3OFVA 4P92A 4C2UA 3HQ4O 1CVJA 3JSYA 3GFXA 1FJXA 3VO9A 4DPWA 4ZIWA 3U19A 4D3FA 1VPDA 1FO1A 3L6EA 3A1YG 1USVA 2PXAA 5GZ1A 1IJEA 4UJ3A 1J2EA 3S3TA 3NBZC 2P2DA 3R20A 1VYHA 4DAOA 1PRYA 1PZGA 2FVPA 4RY2A 3TJMA 1I4TD 1Q0HA 1X8LA 3NGSA 1C29B 2JLSA 2CNKA 3PDIA 3OL6A 1HFKA 1X39A 4JK3A 5JAUA 5JYCA 2O19A 4DDTA 5FBVB 1OXSC 4CMAA 2CZCA 4IZHA 3UAGA 2YS6A 2VQEB 2ZRDA 1GTL1 1ZAXA 3FMBA 3KLPX 2UU9B 5IAAA 1TKDA 1XIQA 1TC1A 3KU1A 4NI2B 4NU0A 1LGYA 2ZHAA 2BFCA 2RF2A 5T64A 5CDSA 5J5VA 3DG9A 1Z0FA 1N3BA 4OHXA 4DUYJ 3N0XA 2W6ZA 3AY3A 1PFWA 3GUHA 1OXBB 2YKNB 4U7TB 1T35A 4NONA 4HI0E 1JI3A 4RY9A 2XUKA 1VKHA 3DNMA 4X6YA 4RWZA 4L5JA 3HWX1 1GTG1 4DCUA 5KPJA 4WNAB 3HFZB 1LX7A 2K8GA 4E09A 1OI7A 3D5EA 5BW6B 2QM8A 3I9MA 4DIDA 5ALPA 1Q0ZA 5ITVA 2GEUA 1OI3A 3K5OA 2M9MA 4H7DA 4PNPA 3U7JA 3NXKA 2CPDA 2C5BA 3TSWA 3S6JA 4YJ3B 2WPDD 2ZYTX 4XM1A 3BX1A 1MROA 4CDMA 3UQSA 1VL1A 5TPWB 3H5OA 2AXEA 1ZZNA 1Q4RA 3KYDB 1JYEA 3DJYA 1Z37A 1MJGM 4Q16A 4C4RA 2VJMB 3DXFA 2I3DA 1YKSA 1U6BA 3PE4A 3L77A 3JX9A 1X60A 2VYFA 2OBYA 2PV0A 3A4TA 4I4TA 4YYZA 3QQPA 1R8QA 3VO1A 3KQYA 1P7YA 4KLRA 4MKIA 5REQA 2J9EA 4Y0NA 4WD3A 1H8HD 1TQ2A 4LV8B 1CPYA 4RTQA 4Z9BA 4XLLA 5C25B 3D0QA 4YY3F 1H6CA 1B6GA 1AGYA 3K6JA 4Q7AA 4JQYA 2BI8A 2EX4A 5DNVA 3OAAA 2E9TA 5HLFB 1MG7A 2AP6A 2H57A 2OM6A 3HHLB 2OC4A 3TW0A 3TUJC 1V1RB 2GCOA 4M99A 4WVFA 2J6CA 3I9V1 1MROB 4IRXA 1NJGA 3BHJA 3KXDA 3M3DA 3A9CA 3KYLA 2Z08A 1HL3A 2QRQA 4ND8A 1H4VB 2QX6A 2QGNA 2V74B 3DZGA 1FFBA 5FUVA 1XJ0A 3W2HA 3BZBA 3R0XA 8ATCB 3HU3A 5ISMA 3U62A 3WZ0A 2IC5A 5JD5A 3R0ZA 2VPWA 4M1WA 3HDTA 2G77B 5LLTA 3VMFA 1C14A 5E6RA 4OO3A 3BQ1A 3M5CA 3P3DA 1Z47A 2HIMA 4NPHA 5CYQA 1S4FA 2UZ4A 4FU0A 3OZCA 1VYVA 1SCKA 1J99A 3ZQ4A 2XWQA 1Z4PX 3A1FA 1KFJB 4D3XA 2D2FA 1VIYA 4HX2A 2XGSA 3KQTA 3AJ9A 2IEZA 2Q3LA 4OM8A 1U5CA 4G86A 3PFOA 2R7OA 1IJBA 2H9ZA 1P8AA 4LJ5A 2V7BA 5TJHA 2CJYB 4KLCA 4MK4A 2ODAA 1XG5A 4DL4A 4YV7A 4TWJA 4E07A 4ECEA 5AHOA 2ZBCA 1W49A 4WBFA 3DNFA 2J9XB 2C8JA 4E5DA 3GCWA 1YVDA 1NZDA 5K01A 3P26A 4HFRA 2HOQA 1OIXA 2BJ1A 3LY8A 2FLNA 4KR7A 5EC8A 3W64A 2C3MA 1AT1A 3ETHA 1PKXA 3S5UA 3ZUPA 5K3BA 4L57A 4F3NA 3TD9A 1SUBA 1TIBA 4BRWA 4P3YA 1J5OB 1GNTA 3A3YA 3GWCA 1J0EA 4EZIA 1H0SA 5B0BA 2IYLD 4XM2A 1OGYA 1MQSA 1A0OB 4NEQA 3OJFA 1VG8A 4HEQA 3HNPA 1U7OA 3CXUA 2WA1A 2XQJA 4HDMA 2GBCA 4PX2A 4QA9A 2V0NA 4JI4J 2ASDA 5F52A 4M83A 3VVBA 2WZ1A 3HVWA 1I3MA 2QA5A 4Q3KA 2JJ1D 2JZOA 5CT4A 1TIPA 2J4FA 5BSFA 2W2LD 4NMXB 1PZXA 1DLIA 5AVXA 1KDVA 1E9BA 3QHPA 3C6TA 2GRAA 3HNOA 3A2MA 5GQSA 5I9IA 1HE4A 3IOMA 4FGUA 1NU8A 2OV3A 2B9EA 2B6AB 1YSCA 3NS5A 4BQFA 3B6BA 1RWNA 3NOQA 1FD8A 4C2MA 3ENWA 4RJJA 3NNCA 4V0RA 2X6QA 3HV2A 1M2NA 2WPNA 4HYKA 2C2KB 2GZMA 3D7RA 4ARSA 4Y2AA 3VOSA 5JC8A 3C85A 4KWCA 2BF7A 1XP8A 1FSPA 4HL9A 2Y1JA 4OJHA 2WVBA 3KMQA 1DIRA 2ONJA 1VLOA 3IRVA 5CLFA 1XNRB 4E5MA 2F4VB 1AHIA 1YQDA 4ZALA 4K50A 1LK5A 4BMVA 2XYPB 4XPIA 2W6PA 1QAJA 2OSBA 5DO9A 3K6SA 2EG1A 4QDZA 1RJGA 1GNVA 3V8PA 3JQFA 2V8HA 4UBJA 1T3NA 4H7KA 1A77A 4OOEA 5I7AA 5T4BA 2D3UA 1XK6A 1QQ7A 2NADA 4J94A 1I51B 2X6TA 1HNIB 1C4KA 1HQYE 1YOVB 2Q9BA 1JALA 3LOUA 3J7Z5 4KE5A 4DHEA 1I36A 1R6XA 3EWIA 4WKBA 2QMUB 5D0GA 2JKZA 1Z33A 3FMGA 4LXHA 4TZTA 3WMFA 3GV5B 3P1JA 5DI3B 1VMAA 3ET6B 4FYXB 4GI2A 3CCUS 3PJGA 4KGVA 2OCAA 1TVKB 3S1SA 1JEYB 2NP7A 2C78A 4MXDA 1VJWA 4LBZA 3NKLA 3DQZA 2EFGA 2WCXA 4F0JA 1SRRA 3LF2A 5L53A 3LPMA 1Z75A 3HP7A 1SEVA 3V6LA 1VG0B 1WF2A 1Q20A 3BJZA 1D8AA 3T4XA 2FPHX 1XXHB 1BEEA 1WUTA 4JBXA 4KAJA 2HMIA 2OIHA 3GDFA 5K8IA 3RTVA 3G9CA 4OSOA 2LQ8A 3TEMA 3VR4A 2O50A 5IK2D 4KAXA 3T7DA 4LVCA 2DBZA 5EHZA 5HJ5A 2A4MA 1IC6A 4AF7A 3GJSB 3PWSA 5FD8A 3U13A 2UXCB 4FN5A 5DSZA 3H5UA 1VCNA 5JXWA 5KCMA 3QTLA 4MMYB 1WC0A 4ANDA 4B7ZA 3DE2X 2OLJA 1NYRA 1XJQA 3IJEB 1W0KA 1DJNA 3B52X 1SIWA 2BM9A 4P81A 2WYIA 1SUFA 4UNPA 4B3BA 3RB3A 4MKYA 3JD1A 3ZW9A 2PS9A 4OYPA 4NE9C 1JEYA 2Q2QA 2VSNA 4U8HA 4K0KB 2ENWA 1KH2A 3L40A 2I1VB 2ZRIA 3Q40A 3SX4A 2YH2A 4QPPA 5I7EA 2DUWA 3VOAA 5SZHB 2V9KA 2WTUA 1XD9A 4RBUA 1FWPA 4BFXA 3PHIA 4F3CA 3KLHA 3OEED 3M89A 3SJBA 2X5NA 3BH6B 3TNJA 2R7NA 3P2KA 3BPDA 3PNLA 1EAYC 5LP6C 4ZI7A 3ZQJA 3QO9B 3UN2A 3RTCA 2FMTA 2QZ8A 1G8AA 3NC0C 3CJQA 3SCLE 1N8SA 1GZ4A 4ZP8A 3F56A 4TVSA 5HRAA 4N65A 2NU7A 5T7LB 5MGBA 3OM8A 4QW9A 2R8HA 1Y3DE 2I62A 2AQ8A 5HMXA 2B4QA 4J1TA 4LWPA 5EEHA 2J67A 4CT5A 1VHTA 3NYQA 4IDEA 1FA9A 4QBFA 2ZJ1A 3CIFA 1P1JA 4MA0A 3GDGA 3ZWAA 3QELA 3HUUA 5FT9A 4GXRA 2FEOA 5E6SB 3ZHBA 3ZHUA 4M1ZA 3QYJA 4DMCA 1VBZA 2EDAA 1X4FA 5CLQA 4KQEA 1NMXA 1S2GA 5B30A 5KYNA 1YMVA 3BYZA 5BOSA 2ISQA 2LR0A 1PR6A 4L4UA 4XQCA 4JV0A 2O6HA 2UYYA 4AB1A 5KREA 2UVDA 4F3RA 1K8AT 2D1TA 3WA7A 2ZI4A 1U81A 1JWBB 3CZ9A 3LU1A 4QWMA 1TKBA 1Z2ZA 1GKIA 1KSGA 4EITA 4WESA 3BFPA 3PC4A 5KVQA 4C87A 4R9SA 1XU7A 3MMAA 2VPZB 4MR7A 5ALOA 4JNKA 4ELUA 1RWXA 2X7JA 3RK0A 5DG9A 1PT9A 3HCRA 4ND2A 4OMUA 4A0HA 1KYQA 1L5RA 2FQYA 1FFYA 4KE7A 4TM7A 4D3ZA 1U4SA 3E6AA 4UCWA 2QA2A 3VSCA 5KTYA 1ZBTA 5B7WA 1O6XA 3O2IA 5JWHA 1N7HA 3AJRA 5AVZA 2R2UA 5LVAA 2OCDA 1YAHA 2Q27A 4D8WA 1IJFB 4DGQA 1I1OA 1R4MB 2XXAA 3OLYA 4MWBA 4J4BA 4EAAA 1DDGA 3RGIA 1LX6A 2R7TA 3DHXA 2M6KA 2R7QA 2GEDA 1KC3A 2G5CA 1UMBB 4RPLA 3OV7A 4LSNB 5HRUA 2ZQYA 2HREA 2RK6A 2WZDA 3DEJA 3UWPA 1K06A 4E94A 4Z3OA 4OYYA 3OT1B 4CP5A 2XI4A 1ICIA 1HNXF 1VHQA 3NHBA 3G2OA 1JP7A 2MYPA 4DR1J 5HUJA 3QBJA 2QRKA 3PEJA 4XWAA 3K1AB 3OQBA 4D0RA 3NIBA 4OXYA 4LZWA 3OKAA 3I76A 2BBTA 1DTTB 4HGRA 3G7UA 2HLDA 3OQ6A 1KAEA 1JECA 2CDRA 2CDNA 3QPDA 1OWMA 3HV0A 3I1YA 3ZOZA 3MXHP 4BFCA 3ML1A 1W73A 1IOLA 1IB0A 2ZCJA 1Z7YA 6NULA 3W3AH 4PC6A 4X61A 1FVFA 3WSTA 3IOCA 3TCNA 5BMVA 1Q0TA 5JAPA 3OF5A 5ARDA 3CDAA 3L6CA 3KJVA 2I1RA 4RLHA 1AB5A 4Q3DA 2JL9A 4WNAA 3AH8A 2G1DA 2YNGA 3J7ZT 5ILQA 3QIPA 4NRDA 4HLUC 3H0PA 2UZ1B 3EMBA 2IRUA 1A5AB 1PL6A 4O23A 2Z2JA 4P32A 4JJAA 1KRPA 3MM6B 1IN8A 4DREA 3ZXWA 1TA4A 3UVEA 4XX0A 4EPVA 2ALYB 3PEFA 3RIMA 4G84A 4F36A 2ID9A 3VPXA 1NOIA 4UEQA 5L51A 4IW3B 1FP2A 5L3VA 3BKTA 4AS3A 2NWQA 4MTLA 2DXEA 2QOEA 4MI3A 3ADBA 2Z4PA 1AA1B 1XWWA 2YBEA 2ADOA 3TZ6A 1RAGB 5HYVA 1UVLA 3UAXA 4OV6A 4MIAA 2WAMA 1WETA 2JGDA 1JUDA 2RC5A 1YI1A 2N7CA 1P27B 4MVJE 1TGVA 4CGYA 2RKBA 1CFZA 1M67A 1E6UA 2FG6C 4OB8A 4FGWA 2QD5A 3D7SB 5IN4A 4DA6A 4I6YA 1RKBA 1O6ZA 2CPYA 4RLFA 3BM7A 3OCJA 3LE8A 3C43A 2AR9A 1YFLA 5CGZA 1RD4A 1DWOA 5AHKA 2FN3A 2X9GA 3NM6B 4L3WA 5F3RA 5KFVA 5LMUF 2YHUA 1BXGB 1QUEA 2XHZA 1CIVA 4JV5F 3DLGA 2JK0A 5U9CA 2WMDA 4G1IA 4TV9B 1SOWA 5GPBA 4J0JA 4WN3A 3MM6A 1NBIA 3Q7EA 1HWIA 1G7CA 1QQBA 5KG2A 4D4HA 3ILYA 3DZJA 3VTKA 3HY4A 2JCXA 1CJTC 1IVZA 2J0WA 4B45A 1YBMA 4AQYB 2OMKA 5AHWA 3CKKA 5EUQB 2HV8A 1W5TA 3L9XA 3BGLA 4ALZA 5DGBA 4E7OA 4FKMA 1QHHA 4CLPA 1JWAB 4BV9A 3TZQA 4A8OA 4NXNF 3C3EA 4LSGA 1ACLA 2HUNA 3QYPA 4C89A 2AYEA 1MNEA 3ISNC 2ADFA 3A0UA 4NLSA 2CLOB 3E9RA 3K2EA 1YRUA 3RFUA 3MMPA 5KTNA 1TP7A 3A1UA 4ARIA 4IV5A 4B9EA 3Q22A 1YIJS 2E4WA 4E5SA 2VHCA 1UAAA 5JUMA 2AGOA 2YV2A 4V02A 1SEPA 4F1WA 5DGIA 4HB0A 1P1BA 3AEQB 3SYKA 4QPJC 1Y34E 2IPAB 1B8OA 4RW6A 1TFRA 2QORA 4CYUB 3HB1A 3LUAA 4UHEA 1RM4A 4CF4A 3HLUA 2JNWA 1ILWA 1E3QA 2IE8A 3RHSA 3ICLA 3K57A 2DR7A 3KDSE 5EQJB 4ECWA 4MGEA 4B3OA 2C1EB 2QTNA 3KRTA 1VHLA 3F0NA 5HM8A 3FKJA 1XQVA 3TM5A 1TAQA 3EEYA 4U7CA 4BMSA 1SHKA 2O2EA 4RGYA 2CLEB 4C3VA 2GEVA 4KO4S 2QR5A 4IY1A 3AUSA 5H82A 5IJXA 4BE7B 5M2PA 1S6UA 3DC2A 2MKHA 2V4UA 1NXQA 1VMDA 9ATCB 4XO0A 1FRFS 1CS0B 1XELA 3KO8A 3RFCA 2DUJA 3RJ9A 1FP4B 1U9JA 4G1PA 1P7WA 2XMUA 3CLRD 4V0NA 3THXA 1QKJA 4ZV7A 3N7AA 2XGPA 5IAEA 2QHXA 1U8AA 1DC3A 3EK2A 1TJYA 2XNKA 3FGOA 4YUWA 2QLBB 3QWPA 2AMJA 2QRPA 2V67A 3OT9A 4C11A 1PNTA 4MS1A 2CJBA 4UOHA 4QTTB 4ZJQA 4YIHA 1JQ5A 3C70A 4HGQA 1W5FA 4M5MA 2QPLA 3QGMA 3WY9A 4EJSA 1KI9A 3CQ9A 2R2SA 3VYTB 4FKBA 2P4SA 2O0HA 1VM6A 3HCEA 5HQMA 1KJJA 2O8CA 5L6MB 1CZNA 1Q83A 1W5EA 3KCNA 1ZAVA 2QU7A 1P5ZB 4JLUA 3TD6A 2CLIB 5DTMA 2LIVA 4IG9A 1VIOA 4P08A 4ABYA 1QFYA 4RVUA 5H68A 3FEZA 1ICEA 1AQYA 2O5CA 3T5HA 2WV9A 1TPYA 1H2BA 1Y3BE 2BV3A 3FQKA 1TK2A 4HR2A 5JSUA 3NWJA 1KR5A 3FW1A 4QIWD 4G0NA 2XY5A 2AQIA 1QDUA 3A2KA 1HKAA 2ETXA 1EDDA 4RNMA 1S7GA 1IM2A 4A47A 4UUWA 5BQPA 4NDNE 1F1JA 3Q2KA 1VG9B 1S12A 3FQLA 3Q8YA 2KG1A 2BJ7A 4FP9A 4JLAA 4NJEA 1TYZA 3RFTA 5JE8A 3T1HB 5DYNA 3I2KA 1UMKA 4DSUA 1O0SA 2PQ6A 4V0QA 3TZXA 2WABA 2MKJA 4BS2A 1YK0A 4HGYA 4ND8B 3S2UA 1GV0A 4BNDB 3K17A 3OUUA 3MW8A 1VDZA 3KHUA 5BMVF 5A4JA 3N9UC 2W83A 3KVVA 4CEIB 1JEJA 1A9QA 2B4UA 1RM5A 2FQQA 3NPAA 3IWNC 2ODBA 3NUQA 2E89A 2VK1A 3TO5A 3H8VA 3DDNA 1RZUA 2J0QD 3I6PA 2WONA 4M0CA 4AMBA 2GHPA 3EJ6A 4L5CA 3OOSA 3TQ1A 4M1YA 2CHQA 4LRDA 1ZIOA 2V7QD 4EEYA 2RGWA 3EXAA 2NUHA 1E60A 1QOPB 5CVJA 1A2BA 1JIIA 1VJ0A 4C4WA 3PG5A 1NU4A 5G0RB 2W9BB 3U1MA 3CVOA 4YP1A 2PBLA 2BJWA 3FCOA 4LDAA 2A10A 4CFZA 5BNWA 3HPRA 4IR9A 3I12A 2XMGA 4LFAJ 3U09A 1E0SA 3DVAB 2QEQA 1P2TA 4QUDA 4PFKA 2I4LA 3G17A 4D56A 1V5IB 1GTMA 3FPCA 2PZBA 1U2TA 5DLQC 3EISA 3M8SA 2CE2X 4UVIA 4XE5A 3I0NA 3UXMA 3G89A 3UXHA 5BUCA 4DZ6A 2WHPB 4DARA 1ZONA 4N4AA 3M3PA 4PBTA 4QIEA 3QWBA 2FZWA 3J81U 2NU6B 2QUJA 2G7ZA 4MKHA 1QQTA 1PBNA 1P5HA 2H08A 2RGRA 4FHZA 2V6BA 3EIWA 1IAVA 3STVA 3RT1A 2U2FA 3TUPA 3C8MA 1YCFA 5EIBC 1FNOA 1OILA 1YT5A 1MFPA 3GG9A 1O96A 1SXJA 1QYIA 4DF3A 3V7UA 4JLBA 5G0RA 2W9BA 3HXPA 4DSOA 3CBQA 1XBWA 1MX9A 1Q1GA 2ZW9A 4WJZA 2ECPA 4M21A 4II2A 4MJLA 3H2UB 3LF0A 1ECGA 2W4QA 4WIAA 1W4CA 4Z9XA 4K0KJ 3DKKA 1V8ZA 5WRFA 1G19A 3MEDB 4I4NA 3HDGA 2RHLA 5IAKA 4QODA 4CLLA 3RAJA 3MCUA 4JENA 4KKVA 4Y1FA 4DUPA 3W2VA 1FC0A 3BVPA 3V4OA 4RLQA 1L5ZA 3LCUA 4N5DA 3GYXB 3H19A 1SWVA 4X63A 1QE1B 2ZYRA 3K9HA 1GRRA 3F5MA 1PW5A 1BZYA 1NURA 1TEVA 2APJA 2F17A 4U8VA 5BR8J 1MPTA 4BDSA 1WF3A 2NVUB 4LRQA 4GI1A 1EH5A 1KEKA 2ZB8A 3LBFA 5JBQA 3C14A 2DQKA 3LVQE 3O4JA 2NYRA 4KHRA 3GA5A 3HMKA 3UN5A 4YUZA 4EY3A 3RVQA 3AI7A 3KG1A 4QBKA 3AJEA 2FJDB 2GZDA 2I4OA 5DP2A 3E01B 3FDFA 3H5IA 4JJ6A 1FHTA 3OF2A 5CA0B 2C3YA 4TMTA 3E70C 2RKIB 4NS4A 1U0EA 1A9XA 2GHWA 1YS9A 5CCXA 1MH1A 3IKTA 4HHHA 2J4DA 3UA4A 1T4CA 3FCSB 4S1NA 4P3OA 1Y0HA 1PEAA 3IT1A 5DBGA 3U40A 3QENA 1JFFB 2B37A 4QGBA 2YWFA 4BZXA 2C2EA 1O94C 5IS2A 1IKXA 5DLFA 1L7RA 3MT0A 4Y9TA 2FVRA 2XHEA 5F1KA 3OTOF 1Y8QB 1MDBA 1MOSA 1J8QA 5AFSA 4Y2TA 1Z8FA 3AG6A 2HQ3A 5A6WA 4QOJA 3COSA 3NMUF 4CGZA 3NP5A 3FIUA 1T3TA 3SEOA 4MQFA 4R8SA 1N5YA 3GEDA 3JQQA 1AG9A 3M6LA 3FJOA 3UFBA 1XR5A 3HBLA 1BHSA 1EETA 3LTOA 4OZ0A 3TS1A 2YXEA 5HBMA 1PR2A 1X42A 2Q5QA 4I8DA 1RE0A 1WUKS 4Q1VA 3KAPA 1XRLA 2WD9A 5IH7A 4NHEA 2NCKL 5HPYB 4U7GA 4OLBA 3GAFA 4ZCIA 5HAOA 4QUHA 3WYNA 4F9FA 4DR2B 4WUVA 2HGLA 3EGZA 2H2HA 5CK5A 4X00A 1M6YA 4N5NA 4IIHA 5BSEA 4BWYA 4A26A 2X0JA 4KEAA 4ENUA 2VICA 1BS9A 4RK1A 4B31A 3GB0A 2Y4OA 4NJMB 4F2PA 3BSWA 1XEAA 2WYOA 5EYPA 3EZ5A 2PKQP 3KT6A 4IOBA 1EA7A 1UK8A 4YDHB 3RG2A 1K6EA 3H42B 3GG0A 1BE8A 1GAOA 1E8DA 4YP6A 2QSZA 2VD3A 5FUXA 2FZEA 3CB2A 4PEVA 5D87A 3GCXA 3MHPA 1AKRA 5SV2A 4YAFA 3VGPA 2K2PA 2JKVA 3HRKA 1Y9JA 5J4VA 1W52X 3PNPA 5BXIA 4YPFA 5HS6A 4EUNA 5C8VA 5EJAA 3GARA 3ZV4A 3MECB 2FSUA 1XPJA 1O6CA 1MIOB 4YASA 2ZG6A 5KTPA 4KYTA 1GEGA 4L3VA 1T8EA 2RHMA 2JFGA 5F7XA 3OQNA 2N4CA 3BPSA 3RIHA 4HEA6 3CVVA 5AUOB 3MWBA 3D4BA 1EFUA 1C7EA 1D2GA 5AYVA 1P5JA 3B13B 3U48A 2WSLA 2X2EA 1QC5B 4P2BA 1SHJA 2PKRA 4QGHA 1Y5IB 2HI0A 1YBHA 1QV7A 3DXBA 4H6WA 4RW8A 3KG0A 4II3A 2FHJA 5CW1A 2JK1A 3D3NA 2DRDA 4ZP7A 3K70B 4HAZA 4UUPA 2ZM6F 3VYVA 1EHIA 2CFIA 3SJUA 3UGKA 4MVYA 3GEPA 5L95A 1RJEA 4XLTA 4KQZA 1Q7EA 2YBDA 3BFXA 1PT6A 1QF9A 2ZFHA 3FDXA 3GLIE 1THMA 4UHJA 3KWFA 3VGUA 3H2HA 4D3HA 3PW7A 4UVHA 4FGZA 1KFBB 1Z6ZA 4ZLNA 4KH1B 1ZAWA 4OX9F 2RH4A 1U0RA 2AIRB 5F0UA 1GYRA 1H8HA 4W98A 4WV3A 1AE1A 2MQNA 2W24A 1X4GA 2B4AA 3KL2A 1CJVC 4I67A 4J0GA 2XOKA 3UFXA 4Y2IA 1TAGA 1TL7C 1T36A 3ZDCA 2DGWA 1S76D 3G1TA 4J9SA 5KFRA 4LF9J 2JDIA 1PG0A 1KMCA 2X0DA 4TL7A 4O1MA 2VBXA 4ZOLB 5I5GA 2YNMD 1D9DA 1XC9A 1J21A 5LDHA 3QLJA 3MEQA 4B6QA 2ZUBA 3NWOA 1KOLA 4Z1MA 4PRFA 1AUSL 3DOFA 5KNBA 1ZA2B 4Y2HA 3JVVA 3ZJUA 1KI4A 4DMFA 3TXAA 1I1NA 1Q0SA 5LA6B 1Q7LB 3EGWB 2ID7A 3HULA 3FYSA 3CZQA 5IW8A 3BAZA 1EDEA 3H3FA 4G67A 1D9ZA 5I7FA 3R5BA 5JEDA 2XZWA 1Z4MA 4D3DA 4XJSA 1FSGA 5DXJA 3ZU4A 4L95C 3LL7A 2IITA 3QE9Y 4FEEA 1TVEA 4LRCA 1XN9A 1OGIA 2W58A 4I69A 3JZFA 4HDHA 3F6YA 5GMKa 3BN4A 1TYAE 1SKMA 5F77A 1GR0A 4XGQA 3DRYA 1ZMTA 2H48A 1IL0A 5ALVA 1FJEB 3HCBA 5TGZA 5A3SA 2UVPA 5T3YA 3SBXA 3CISA 4DOMA 3PUVA 1GVHA 4M1OA 2XT9A 2IV3A 2VF7A 5A8RB 3MWLA 2CL0X 2ZAGA 3CDBA 3D43A 4FFPA 4ZZIA 4HAUA 5H81A 2I29A 1JSCA 1NRIA 1LW7A 8AT1B 2XGQA 4DSAA 1BEUB 1P6XA 4JNCA 4YBRA 4UTZA 3OESA 1T8WA 1L9XA 3NGKA 1YE3A 1IHDA 3MWKA 4BMDA 4O44A 1MUUA 5E3RA 1IBKB 3CJRA 4O4HF 1O0PA 4N18A 2BMAA 5EOVA 1OIWA 2HRYA 5EWEA 5B0CA 2QU8A 2PD1A 4MITA 2I38A 2CPXA 2V65A 4D46A 2VOEA 4ZMBA 4CO1A 3RE1A 5IBRA 3DVQX 2GW8A 4CG2A 4ZPXA 1S57A 3OT4A 5DTIA 3U80A 3AVWA 1UEXC 1GQRA 3P0RA 5BT8A 1PQ4A 2EP7A 2YFYA 1BH6A 4ZVOA 2E4YA 5GVSA 4DB4A 1ODFA 4RK0A 4IH9A 4Q48A 2CG8A 4M0LA 1E2UA 1M2OA 3KSAC 4FSDA 2RH8A 2QYTA 1U0OC 2DSTA 1IWBB 1UVNA 3B5EA 4M9RA 3QA3E 1P17A 1VIVA 3EVDA 4GKKJ 3PPVA 4MB0A 5C24A 1RAAB 2KS6A 2EU8A 2LIPA 3T8YA 3CR8A 1JXEA 1HQEB 3HKDA 5LD2C 1GGVA 1U7WA 1UZAA 1JB1A 1VIMA 4PQUA 1AV7A 4JLWA 8AT1A 4I4BA 2JGRA 4QEDA 4S0ZA 4JEUA 4Q7JB 4WYLA 3EVBA 4HP8A 4F5YA 1ODLA 1Z6YA 4FOSA 5A0YA 3MI7X 1KY2A 2EV9A 4FW8A 3RSFA 1EG7A 3QWFA 4OYLA 1WF0A 2BYCA 1JPNA 1Y9ZA 3GUYA 2VYND 1Y3AA 2VZLA 3QSIA 4GF5A 2WD8A 4PO9A 2AN1A 5AHXA 1ZGGA 4ZCSA 1HDRA 1Q0UA 1IQUA 2JANA 4NDAA 2AFIA 2E29A 1NK6A 3MVEA 2VL1A 4BASA 4AMYA 3Q9UA 1EUCB 1R4ZA 1XF9A 3K5PA 2LQJA 3WL3A 4M94A 2NO0A 1GOTA 2M2BA 3HUTA 1A7GE 3H2GA 2KZZA 2Q3DA 5G41A 1CZLA 4F21A 2JVIA 4N0DA 1IR0A 4ZYWA 4WK1A 4YJ2A 3FWPA 5LDDC 4DLNA 3WMRA 1EFKA 4L50A 3W4JA 1KNXA 1T8SA 3DV9A 3W8PA 4P86A 1QCDA 1PW7A 1KLMA 2VB6A 4NE9A 3EICA 4NE7A 3Q8SB 4IS2A 4M5KA 1LLUA 3E9QA 2ASEA 4MEAA 1ZINA 3P6YC 1WXHA 3IGVA 4YRAA 1Y8ZA 5AW0A 1G3MA 3ZPXA 4GYWA 2CHEA 5EA2A 1DFDA 1POWA 2JLEA 1NRKA 3GRAA 3LZCA 2W2OP 3C8YA 4NOMA 2DE0X 4R3UC 1LWXA 1F9AA 4O2BB 2P2CA 3AGPA 3RGGA 1J4AA 2IYSA 4UUMA 5CYGA 3KUUA 4D4LA 1UJBA 3A11A 5EZ6B 2OCPA 1JXAA 3WKCA 3WBJA 2OPBA 4OK3A 1QAXA 5A4KA 3BXGA 3MWGA 2O0LA 3M8RA 1PQPA 5L7TA 3QQ5A 2WAQD 2CFRA 2O52A 1EJ7L 1NPYA 1JHVA 1XKLA 1CUBA 2FDRA 4N7JA 3F44A 5ALXA 3NDIA 5TB5A 3MAAA 4GOXA 4LDJA 3NUGA 3DFFA 1Z3CA 2J9ZB 3MUTP 4F5WA 4XZ3A 3T9BA 4KPCA 1MOQA 1SUQB 1T0HB 1XD8A 4IXMA 4P8RA 4NLQA 2QT9A 1UDXA 2PA8D 2R2GA 5CFZA 3EYAA 1SXHA 4MULA 3V9AA 1L6IA 1BVYF 4PEOA 1G7TA 4C0WA 4NOJA 2IKQA 2PJRA 4KH0B 1KC1A 4TL9A 5DGDA 4D4MA 2PZGA 4M8KA 1ZN7A 5DHRA 3W8RA 5MDHA 3RS8A 4LVNP 2X5OA 4IRCA 1Y1TA 3V8NA 2F4VJ 4F4KA 4YPOA 2W2PP 3SDSA 1EDZA 3NEKA 2EHDA 1XTIA 4I36A 4K2AA 4OHKA 2V03A 1Q74A 5AIBA 2W6ID 2E37A 3D0OA 2DUNA 1DOZA 4BX0A 2QMHA 5K8CA 2NVUA 1UMCB 3T6KA 3IBYA 3MR6A 4KXWA 5E7MA 4YR3A 1WHWA 2KE5A 3N70A 3O92A 4A6EA 1ZTWA 3TUIC 2QTTA 1DS6A 4UU7A 3WDMA 1HBMB 1PD1A 5KFDA 2FHOB 2D0OB 2PFDA 1TJ4A 1ORIA 4IZ6A 3JS9A 2BBOA 3IP3A 1BVRA 3DI6A 3GJ6A 1CEYA 1DB3A 3QSYB 1SH0A 5GTDA 5KQPA 3BMXA 1EK5A 1GR1A 1TM3E 3JSMA 5JVDA 3L0ZA 1RWVB 2PSFA 3AKZA 3K0HA 1TPZA 1OLOA 1NN1A 3GP8A 3CHYA 3N9IA 3AL3A 1QIFA 2QXUA 3Q2SC 4TL8A 2XHWA 4EDHA 3W8EA 3PDCA 1QSGA 5F3WB 2H1FA 1D9XA 2QM7A 1OLXB 3HY6A 3R5AA 5GV8A 3JD2A 4IIJA 4Z8XA 4HZIA 4TYBA 3PFCA 4RYLA 4OYRA 3QGIA 3TTUA 2RRBA 5F4ZA 3VQSA 1EJ0A 3UATA 1JJFA 1Q0LA 1YA6A 3PJFA 2TMGA 4ETMA 2C2WA 3RCBA 4URZR 1DKLA 4GKJJ 2FAXA 1XDGA 3SR4A 3NFYA 3LALA 4MO2A 4B9AA 2J5XA 4L85A 3CCJS 4CM9D 5FWXB 1ZA1B 2CVHA 4U6SA 1U4BA 1P2SA 2UDPA 4CT9A 3T1YF 4PCLA 1VE9A 2GJKA 4LQLA 3E27A 5HZHA 5GGYA 4LVOP 4X8MA 3E9ZA 2MSWA 2HHVA 3U4IA 4ZCPA 2ZRMA 1UK7A 4BP8A 4CLZA 2QGFB 1R74A 3DM5A 3S28A 4KYIB 3I2YX 4Q9AA 1NZJA 2F64A 5CTJA 2BGIA 4X90A 4BNXA 5ICCA 1UFVA 1M0TA 4CR6A 4DLXA 2P4UA 1DCFA 1KK0A 1N2ZA 3CKLA 1Q19A 2POKA 2ZZTA 2GHRA 2D1RA 3KUGA 4M95A 1G6Q1 4IIJB 4JLNA 3D66A 1WPXA 3GLKA 1SC3B 1OZGA 2UUOA 3Q72A 1VPWA 1V6CA 2O54A 1II0A 3COZA 1XMXA 2EG9A 1JDPA 121PA 1CP3A 5LQUA 5KFCA 1EXMA 4PPNA 1UXJA 3O4VA 4KIJA 1WB4A 1U2GC 3FUYA 1JLMA 4MS4A 1G1AA 2LXUA 3NU1A 1NWCA 2F3UA 3UMCA 4A6DA 3JAWB 4MUHA 5B58T 3TYXA 3M2VB 1H66A 3TZWA 3ONFA 2QX0A 1NKSA 3DLLQ 3T0IA 2IDEA 1SURA 2IXEA 2ZSBA 3W1VA 2V50A 4QICA 4K88A 3DTYA 3IT2A 1LFAA 4IKAA 4D4KA 2GA9A 3WGJA 1XZGA 2BKAA 3GSDA 1WOMA 3E1GA 3THVA 1N5LA 1J06A 1DHMA 2A0XA 1YGYA 3E03A 5DZ7A 2NGRA 2VRBA 2HBZB 2AE1A 3SZOA 1DEHA 2DXFA 3MTIA 4XPZA 2R3SA 1LW6E 3GLSA 4WFAQ 1G7SA 3KHKA 1U4NA 4FT2A 3BMNA 5LZ4A 2ZSKA 4RPCA 4B2PA 4RSMA 2E4UA 4KTVE 3ROFA 1NASA 2B4YA 1EDOA 4ZAFA 1WMEA 1D2EA 3KZCA 5IU6A 2PS1A 3COJA 1U3UA 1CQZA 4OLJA 2DNMA 3QZ8A 3T1TA 1IPFA 3HB9A 4MA5A 4ER5A 2PR2A 3STTA 2FZ5A 3C97A 3LXRA 2LUOA 4DGSA 3N2ZB 1I7LA 1EFPA 3ZE6A 2BBSA 3ZZTA 1T4CB 1VJTA 2J0VA 2EFNA 2JVOA 3H8JA 4EJFA 1U8UA 1KO5A 2DITA 2QSFA 4UZEA 1JFFA 4LXGA 2W6CX 1GT8A 3M6VA 4J49A 1P3DA 2IH4A 1KDNA 4UM7A 2D2IA 3KELA 1CG2A 2DWPA 2RHTA 4GLBA 1Z4IA 2C7VA 3BH7B 1K7FB 3AMVA 3DZ8A 2VDKB 1NKVA 1WHSB 3B85A 5C80A 1EQ2A 3HJFA 2GERA 3EF3A 5B57C 3JTPA 4I0WA 4Z7OB 3W7VA 1DO2A 4YRLA 2JRCA 3W6ZA 2RI0A 1B99A 4ZMRA 1EA5A 3OIVA 1KJIA 3H9BA 3AF6A 4Q02A 4KTTE 3G2QA 3EAQA 2CDCA 1AO3A 2G13A 4F50A 1A4IA 1PJAA 2CLKB 4B4KA 2L08A 3ECCA 1PZHA 5HKLA 4BFUA 4M1MA 4JI7F 4QTZA 2A3NA 5DM7Q 5T6MA 3CU5A 1SVSA 4ZVSB 2H5EA 3S2IA 1A9PA 1ZN2A 2JGLA 4LOKA 1EP3B 1NVGA 3NWPA 3IVMA 1AXRA 5B36A 1H3DA 1UXGA 2B8PA 1ANKA 1IY2A 3TFQA 4JI8J 3P49B 2UVPB 2FSIA 4FFNA 4XRGA 5EJFA 3SSMA 5FI1B 5TQ2A 3VAKA 1TMOA 2H1RA 3FGVA 5AW1A 5IT5A 5IKOA 5IZHA 1W9HA 4OQNA 1XDSA 1I3NA 2OQ2A 3PACA 1CJVA 1JAHA 3N3BC 3JSRA 2HHHB 2EX1A 3AUYA 1RKUA 5IWAF 3G49A 4EGJA 3T3MB 1VYUA 4JUBA 2II6A 1P5RA 3L1HA 1XKQA 2R7LA 3BMQB 2QT0A 3U17A 1IY0A 5KG4A 3OSPA 4YX9A 4LFAB 1Z36A 5D2CA 5A05A 3RBEA 2GPBA 5CT8A 1MIOA 3C7DB 1XJ5A 1I94B 1RYYA 5HQJA 4U67Q 2EZUA 3FPGA 4U8GA 4C0SA 4LF9B 4DDKA 4PGMA 3V1YA 5B2ZA 3TE6A 2J5KA 3AVOA 1N2SA 2ZVPX 5CH5A 3N6XA 1P2BA 4K6KA 1KIFA 3A7DA 1YJBA 1OMOA 4RW9B 3RRYA 4ZT7A 3NBAA 3I04A 1R6UA 3C5WP 5LQNA 1R0LA 5F8HA 1IZYA 3VSEA 3FMOB 2IRXA 2HK3A 3ZV7A 4BWVA 3EAGA 5AT1B 3O5TB 2F4NA 4HYTA 3I1FA 1XU4A 5AP9A 1OJ7A 2G40A 3TX0A 4IZOA 2BY4A 4Z2YA 2WRZA 3KJFB 1IN6A 4DCVA 4UUAA 2HK6A 3MR7A 4RKUC 4O2BF 4CUJA 3OQ1A 2XE7A 2ZAOA 2O5EA 1G2QA 5KQRA 1ZJYA 3HSSA 3N0RA 3TX8A 2ZIGA 4DRXA 2RB4A 5EIBD 3SY8A 2MR5A 4QYMA 5CM8B 4Y34A 5EHNA 1VRWA 1NK8A 5CIYA 1KY3A 2YDXA 3CVWA 4ZAGA 1RHQA 1QHSA 1A2OA 3HCAA 3ASYA 3LT4A 4QTUB 1FRNA 1JDJA 1VCMA 1HZZC 1NPRA 4R1OA 2Z4RA 5ETRA 1K6MA 4YHHF 3G9QA 5K0FA 1NDKA 2QPTA 5DNCA 3L01A 4RC9A 4DJFC 3NHFA 4B5LA 4E3WA 1CJMA 3PEYA 4KPUB 2V2KA 4Q6BA 2PIDA 4BNZA 3ZXXA 1ZA2A 4O2RA 4AWBA 4IVNA 3BYRA 1PKEA 4V0ME 3FB1A 3X1ZA 1ZICA 4H4OB 2G1UA 5ELLA 1AQNA 2J45A 4DLYA 2BAGA 4D43A 4IV8A 4YI5A 2HHPA 4EQZA 2VZ8A 2RD5C 4FYYB 3KEGA 4K59A 3SHVA 2QUBA 4Q1CA 1BVHA 4YS6A 2IOYA 1RTDA 2JASA 5DXAA 1HLPA 1NC3A 4WFYA 3ANLA 1N5SA 1F5SA 4M98A 4QPZA 3WTBA 2P9ZA 4PLPA 1DIGA 1Y5LB 3E9EA 4GRSA 2ZRBA 4JGGA 2NLOA 3L06A 5THWA 3IPAA 4OOFA 1EVYA 2KXNB 2HAFA 4F2WA 4XOIA 2BXJA 1W36B 3E4CA 3RUPA 1J9EA 4G26A 4OH1A 4TT3A 1DAEA 4PYKA 2EFOA 4N48A 4CL0A 3A6JA 4A8XA 1IK6A 1NVTA 3RJMB 1U0TA 2C7BA 3UK2A 4EGQA 2C2GA 1ESDA 5B7PA 3SJ7A 1C1CB 5JZVA 3G6XA 2F65A 4OXXA 1T4GA 1ZMBA 3DZIA 1NUSA 1KK3A 3B3JA 3EWSA 5FYQA 3SEZA 3E1SA 3DCJA 4WJBA 2NYUA 3PPYA 2A1BA 1DG1G 3MOGA 2IU6A 3LZ6A 1J24A 2C3OA 2NQPA 1J5EF 2R3VA 3OPQA 3K72B 2D1QA 4EO6A 2FJAB 3TCXB 1L6RA 3KDOA 3IUNA 3L8MA 2GRUA 1UH5A 1IWOA 2C83A 2GO1A 2NMVA 3BF8A 2O2DA 1JV2B 2L82A 1K63A 4GLOA 1PX0A 1G3RA 3NMRA 4YEDA 1JLKA 1AQUA 2V4QA 1M72A 3FXAA 2ILYA 1TL7A 3NNSA 4D81A 4JI8F 3HVAA 2XF2A 4QLAA 1H3FA 3Q9NA 2ZB3A 2YNFB 1YK9A 2ZROA 4CI9A 1TYCA 3GJQA 4NZOA 3H4BA 3H5WA 4PXBA 2YQ4A 1CDZA 3IAS1 1F3VA 1P72A 5AWFC 3VUEA 2VQ3A 3RJMA 3EDQA 1N9GA 4GBGA 4MAKA 3FSXA 3DW3X 4CLKA 3H1TA 1AUPA 1Q84A 3V6KA 3FOZA 5MN5A 5EXTA 1TK5A 4ZO4A 2FFRA 2XCLA 4NEHB 5TPZA 1M83A 2LWIA 1CLFA 2VDQB 3FNHA 1KC8T 3Q7SA 1FYWA 3VR1A 3IDZA 3G8DA 3E84A 4GMKA 2XWBF 1UT8A 2XV1A 3ELHA 4RK5A 2IVFB 1X1BA 2Q0HA 2VDMB 5A4FS 2J7PA 2XQCA 2O2GA 2X14A 1M5KC 5DCUA 2ZUSA 1GDTA 1JJVA 5SZTA 1AZSB 3KSRA 4YJ2B 1YWGO 2B9WA 2VKTA 2C82A 1JHUA 3T5CA 3KPUA 4FWBA 1C50A 4XB6B 2X76A 1NB7A 4JBYA 4NZZA 1X7GA 2I5PO 3ROPA 2HZBA 2OSVA 3CUEF 3HWSA 5AM0A 1TZJA 2X5JO 5J9FA 3S8SA 1S7HA 2Y1LA 4LJKA 4OKIA 4GZMA 1IM4A 1UZMA 4TYNA 3RD5A 2NVBA 1I94F 1SC4A 2ZJ8A 1SC1B 1M1YA 2DCUB 4JODA 4DLEA 1N9ZA 3GFPA 2O06A 1RWQA 3WYEA 3VBCA 3JYPA 1GX6A 3GEEA 1ZK4A 4JI4F 4G4SO 4G37A 5H5JA 4M88A 3T7AA 4D0SA 3M9XA 4FFBB 1L8LA 2CD7A 2RAPA 4HNQA 2C3PA 2ZS7A 2P40A 2NVWA 3PC8C 4RSGA 1C1XB 2VWGA 1RHRB 2EFQA 3EGXA 2PSZA 1ZWLA 4JL6A 2QC3A 1ZOOA 4LEIA 5A0FA 1IQ0A 2H3EA 5KINB 1NKCA 5LXRA 1J0AA 2D8MA 3FSGD 1CE8A 4YP9A 5JJCA 2DSNA 2JJYA 2ZUTA 3C7TA 4YCMA 1FDOA 3MYRA 3MM4A 2ZM6J 4KMMA 1DDOA 1QYCA 3ZCVA 3E5RA 3KJHA 3SYNA 4RMJA 4O4LF 4DX7A 4LJRA 1C4WA 3BRSA 4JLSA 5JRJA 2BHNA 1X9WA 2QRZA 1E64A 3QO9A 2C7OA 2D74A 2H92A 1U1LA 4MQ5A 2DGXA 4FYMA 5KDDA 1EARA 4C14A 3MGAA 221PA 2I5JA 1QG0A 4WKGA 2HSEB 4XK8C 1QD1A 1TTQB 5SY6A 3C5HA 4DC0A 1L4FA 1M5RA 2PV7A 3DMFA 1ULUA 3UJ8A 5GAHI 3HP6A 1LTHR 4ARZB 3S1LA 2XDAA 4C6TA 3UF0A 1E2LA 1NPTO 2J9YB 1ZN9A 4NNPA 1FLAA 1LSJA 2J3KA 3KLMX 4BFSA 5T7BA 2R84A 2QQ5A 3UAZA 3MFQA 4FKZA 2BKEA 4JXJA 3ISZA 1KVTA 4LE0A 3MLEA 3C45A 1YL6A 4LF5F 1QGYA 1E2GA 4PTLA 4Z9YA 3U7RA 2PY6A 5IWCA 5BV2P 2XLIA 4FDUA 1T1SA 2GR9A 3ESDA 3C87A 1JG2A 2PXCA 3R7DA 2IELA 4HT5A 3RSHA 2EATA 3EGWA 3DPUA 5C32A 2V98A 4J6FA 1KOJA 3IEKA 2BMFA 1B0UA 3DAOA 3WK4A 3WYFA 1W4LA 2X9LA 3GP5A 3IXMA 2G0TA 5IJAA 3NKYA 5LOVB 4KK4A 4CHGA 3OLXA 4S0MA 1P0IA 1FESA 4J3NA 2J1LA 4F5DA 1J90A 1QHFA 3P0FA 3DI6B 4NH4A 2FSPA 4KIUA 5K0GA 3GZNA 3DL0A 3EVCA 2IGTA 3VR5A 5HP4A 4O4LA 2W42A 1XWFA 4R7GA 5C46F 1T7PA 1S1TA 5HVGA 4LC9A 5DKFA 1MQAA 4NEYA 1WEHA 1FBTA 3ZNQA 5BNTA 1DUIA 2D2EA 1DAFA 1CR6A 1G59A 4QT4A 3ZWBA 1FDSA 4A1FA 1JXLA 1DX6A 2V3WA 3V7NA 2BZ0A 4ZOBA 3H0KA 1XZFA 3CEPB 4AP6A 1DBDA 1FKOA 4CIWA 2JGEA 3WL5A 1GQYA 2Q4RA 1YRYE 5BN1A 2R6CA 3HCPA 2PNJA 3OVMA 3TL2A 1V7PC 2EC0A 2WAYA 4Y6PA 3C14B 4K1LA 3UG6A 3LDGA 3QRQA 4ZYUA 2CDRB 3AHGA 4G1QA 1GHTA 3X1DA 3RRKA 2CQHA 2G5TA 1IXYA 5L1IA 4IJMA 1QDEA 1HQEA 1D4ZA 2HXGA 1TCUA 1G2EA 3OU2A 4HNVA 1OYYA 2WFMA 1TO2E 3UJPA 5I7WA 2G1HA 3VVCA 1Z0JA 4QYZK 2GZOA 4M8NE 2FEXA 1S9DA 1S2OA 2QRVA 1S4MA 3A28A 2ZIXB 1ZCJA 3M4JA 1I30A 4ED9A 2ZI7A 1MU0A 1BFKA 3T34A 5IXJA 2A0YA 3LHDA 4EZBA 1RLCL 4MMOA 3CF5Q 3ROEA 2HYIC 3ZCPA 2PH1A 1ZH5A 1NVWQ 5REQB 4ZARA 1XFAA 4JU8A 1R0YA 3FTCA 1WU8A 1K75A 5ERGB 3T5BA 3FPAA 3TMAA 2FUG1 1VCHA 5FWDA 3DGEC 4UDXX 5IPFA 3FTPA 2SCUA 4OLPA 1G4UR 3B1JA 5JD6A 4BO7A 5JJLA 4QUJA 3SU8A 1G9XA 2EFVA 4MS4B 7MHTA 3OCXA 1JT9A 5KNCH 3WOHA 3GFZA 2EK6A 1QJHA 2WW4A 3H84A 4YH1A 1WXEA 3HCFA 3K8WA 1H2AS 2HA7A 4D9HA 1VQ6S 1JNYA 4I5DA 4CDIA 1RK8A 1UEUA 4HEJA 3EDRA 2A1TR 4IIJF 4LJ7A 3PRJA 3TLKA 2VYVA 3D54A 1LS6A 2H31A 3G59A 4XSVA 3G2PA 4HPWA 4OK6A 4QU0A 4Y6IA 4AAYA 4L5YA 3BPSP 1NH7A 5CX1B 2HBZA 4U3JB 4JC4A 3GR0A 2E9RX 4PCAA 1GPYA 1K4MA 4ANFA 3OKFA 2REQB 3HGQA 3SBDA 1AW0A 5BUSA 1SQ5A 2WDZA 2GESA 3QXHA 4TQUS 3ICWA 1L1QA 2ZRGA 3MJSA 5B6JA 3BA6A 2C2YA 2B35A 3BM5A 3NP7A 2HT6A 4IJ5A 4MDEA 2VT7A 3GRUA 1U1PA 4FMBB 1S7IA 4NLDA 3U44A 2OFGX 2ECOA 3TNLA 3QG1A 2ZVJA 3AZPA 4DL7A 1QH9A 5FA5A 1XVIA 3BQ2A 5AI4A 2HV9A 4TKUB 2J6TA 4DYHA 3GLFE 1LD3A 3CLSD 1R88A 4ZJZA 4XIIA 3M9OB 3D6FB 3DF9A 5EQTA 2ORYA 1S6QA 1NMEA 5DNDA 2DFTA 1U0BB 5CXUA 2Q5FA 5KS2A 1Z28A 2F1IA 3QX3A 4FD3A 5IZCC 4IOMA 4M0FA 4PZAA 3DM2A 3DRSA 3X1WA 2VDWB 2XJ4A 3PFEA 1P3JA 1BFUA 5G0SA 3SMQA 5KYUB 4UU1A 1E7QA 3PIIA 4OJTA 4E0BA 1RWNB 4LF7B 5D51S 1IYZA 4EA8A 3SNKA 4O0NA 4JI6B 3TOSA 3R0JA 3R6GA 4X65B 2XIQA 3F5SA 1AMOA 3PJRA 1JSL