3NNNA

Bef3 activated drrd receiver domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
NVRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNEPFDVVILDIMLPVHDGWEILKSMRESGVNTPVLMLTALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BINDING RESPONSE REGULATOR D
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 43
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nnnA00
5TPWA 3GRCA 3RVMA 5BQ3A 1ZGZA 3C6QA 3LFTA 3H6HA 3JPWA 3QLUA 4OG2A 4GPAA 2HSGA 4MS1A 1LBHA 4PICA 4PYRA 4FE7A 5TQ0B 1Z16A 3R0JA 3F6CA 2WRZA 1JL3A 4MAAA 4XAQA 4G97A 1D4ZA 5TQ2B 1DBQA 3RVLA 2WJAA 3LUHA 5JS2A 2PUAA 4L4UA 1E6MA 4L85A 2FN8A 1E2BA 4Q6WA 3EQ2A 1FSPA 1YMUA 3CG0A 4IMJB 2HJ9A 4XXHA 2O20A 4YR7A 4NCBA 1DG9A 2ZWMA 3MF4A 4N76A 3LUCA 2KYRA 1A2OA 1M5TA 4PE5B 4YGXB 4N47A 1U8TA 3ILYA 4QICA 4E7PA 2F8SA 4OBBA 4Y9TA 4JB0A 4W5OA 4G0MA 4Z9AA 2LPMA 1S8NA 3HCWA 4KRFA 1Z15A 1JYFA 1Z25A 1A0OA 1D2AA 4JA2A 4RXTA 4D6YA 2GBPA 2VYCA 3SG0A 1MVOA 2E4UA 4MLDA 5JNVA 1WETA 3T6KA 4N41A 3I5AA 1SXIA 2CWDA 3IPCA 3RQIA 1BAPA 1XWWA 2FLKA 3MMNA 4MPTA 3C3WA 5HQJA 5JNWA 5CNMA 4IMIB 3N8IA 2FN9A 2MSLA 4TN5A 4TMYA 6ABPA 1HEYA 4N03A 3KS9A 2H3HA 2IPLA 3OM1A 2Q5CA 4LRQA 1LJUA 1ZH4A 4G0ZA 3HEBA 2RGYA 3C3KA 1QPZA 3Q41A 4O1HA 4RY9A 4NICA 4MS4B 5FWYA 2A9RA 4G86A 4UHJA 2WY2D 3O1JC 3KYJB 2HQOA 4YS6A 3EJWA 4KK3A 4B09A 3B2NA 4NCAA 2QR3A 3NNNA 7ABPA 5B3JC 3O75A 3BRSA 1K68A 2J48A 4Z4CA 2P9HA 3SM9A 3OLYA 1QO0A 2PAFA 4ZMSA 1P8AA 2ZAYA 2PUCA 3GV0A 3H1EA 5KI6A 5IC5A 2PUBA 3M9WA 4HNSA 1EAYA 4Z0NA 2ID7A 2JBAB 3LOPA 1USIA 4ZJPA 3BBLA 3O21A 1PNTA 1Z18A 3IP7A 1ZDMA 1MB3A 2H0AA 3E61A 4WXEA 5JNTA 1M2FA 1URPA 5TPZD 1CHNA 4RXMA 3CLKA 1YK1A 2JVIA 5GOTA 4S04A 3N75A 3LTEA 3Q15C 4F8JA 3OQNA 4W5NA 3MIZA 3HDVA 3O2SB 4KK4A 2FLWA 3CRNA 3ROTA 2QZJA 1LK0A 4N0PA 3LKVA 1YS6A 2MYPA 3KG2A 2FXIA 3O74A 4QYWA 5EWMB 1JX6A 1XHFA 5DKFA 5HKOA 3N6VA 4MR9B 3H5VA 4YO7A 1FFGA 1QP4A 4S05A 1Z12A 3OQOA 3HUTA 3EQZA 2R48A 4Z9BA 2PKXA 3KTOA 4FB4A 1PEYA 4ZYLA 2ID9A 3CFYA 4KVFA 3H5LA 2W42A 4YP9A 2MYUA 3M9XA 3EGCA 2MYTA 1ISRA 2NZVG 5PNTA 1QQBA 3T95A 1NXVA 3LUAA 3GBVA 2IPMA 1JFVA 1KGSA 4HNQA 4KQCA 3EODA 4MS1B 3IP9A 3QX9A 4OLBA 3TB6A 3H75A 4HYEA 2BGGA 4NQRA 3H5TA 2FW0A 4ML3A 2MYNA 3H5OA 2GI4A 5EWJA 1JFSA 3Q9SA 3QK7A 2F8TA 4IF4A 1K66A 2LIVA 2QU7A 3DGEC 2NT3A 3M6MD 3SNKA 4G0XA 1FFWA 1USKA 1ZGGA 4RY0A 2FMIA 2GKGA 1DCKA 9ABPA 3FFTA 4MR7B 2YHAA 3HJFA 5KC9A 3A0RB 3TMYA 4RWEA 2HPHA 1MB0A 1BDIA 4O1IA 3K4HA 3NHZA 1APBA 4MRMA 2CHFA 1R8JA 3QEKA 4XFKA 3FFXA 3HO1A 4MS3A 4ETIA 2P4UA 1F4VA 5KQGA 3TD9A 3H5IA 4MQEB 1EWTA 3KLNA 3CS3A 1YIOA 3FDFA 2JVJA 3TX6A 4RK1A 3UUGA 3EULA 2B4AA 5IULC 3DLBA 1EWVA 3MM4A 5TPZA 8ABPA 3MYYA 3QEMA 3HXMA 1BDHA 3LUJA 1CYEA 4MGEA 2TMYA 3K9CA 1OXBB 3NHMA 3P9YA 5DCLA 1L5YA 5FWXA 4W5QA 4P1ZA 1GCGA 4GNRA 3CNBA 3URMA 3G1WA 2VUIB 4PZ0A 1ZY2A 4EVQA 5KQPA 3QEMB 4UHKA 5D2CA 4KQ9A 1EHCA 4MR7A 4G0QA 1W25A 2FMHA 2CHEA 3F7NA 3OM0A 1RXEA 3OMWA 1TMYA 3F6PA 1Z26A 4YV7A 1NXOA 3JY6A 4MS3B 3BRQA 5DLEA 3N0RA 5EWLB 3GYBA 1Z13A 3H1FA 3L6UA 4Z4HA 3HVRA 3QLVC 3RVQA 1MAVA 1YS7A 3W9SA 3O1HB 3LKBA 4ZPJA 4XLTA 4Z4IA 2WB4A 1D1PA 1QNLA 2LBPA 3T8YA 1JLKA 5T7BA 4MLCA 3SAJA 1FQWA 2IYNA 1PUXA 4RZSA 2FEWB 2GWRA 4TLMB 2JVKA 4EYQA 1Y1LA 5IEBA 3FGZA 4ETNA 1JH9A 3FFWA 4LE2A 5KC8A 2FQWA 5EWJB 3EDCA 3HZHA 4O5AA 3KYIB 1DRKA 1U04A 1TM2A 2PJUA 1D5WA 2VK2A 4D74A 1ZH2A 1NXTA 3JVDA 2AYZA 2QVCA 3QLVA 1RZRD 3C3MA 1XHEA 5E3JA 4D6XA 1JDNA 4KMRA 5FBHA 3CZCA 1AB6A 1KRWA 3GL9A 5B3JA 5TQ2A 4F12A 4Q7EA 1TLFA 3OLVA 2QV0A 3JPYA 2VUHB 3LMKA 1ABEA 2A9PA 2IOYA 1C0EA 1SXGA 2WWVD 3RVSA 2JBAA 1T34A 1DZ3A 4EVRA 1I3CA 3LUFA 3QLTA 1RPJA 2CD7A 4JAVC 2NT4A 4WXMA 1U2PA 3QELA 2E4VA 4N0QA 4RY8A 4EYKA 4XARA 1SXHA 3GWGA 3HK2A 3SY8A 3RVKA 5I4CA 3D8UA 2NUBA 2QXYA 2E4XA 5JNUA 5IEJA 5TQ0A 1ABFA 1JYEA 3LUKA 6CHYA 1TJYA 2PUDA 2E4WA 3NBMA 3MQ4A 2FEKA 4WWHA 4YWHA 4CBVA 3DLHA 4KZKA 5HM6A 3OLWA 1BDJA 1GUDA 1LBIA 2AYXA 4RK0A 5DTEA 2L2QA 1NTRA 4YCSA 3RVPA 2B1JA 4WT7A 3I45A 2FMKA 2QW1A 1ISSA 1U2QA 1UDRA 1EFAA 5FBKA 1SRRA 3I42A 4YRZA 3RVNA 1FFSA 4F11A 2JRLA 4RXUA 1H9CA 1USGA 3S99A 4EY3A 2PUGA 3VNBA 3O1IC 2LUOA 4OTZA 4Z4EA 2OQRA 2FTKE 4NV3A 3MA0A 3LUGA 4RV5A 4RU1A 3DZDA 4H3HB 4RK5A 1MIHA 4MS4A 3H6GA 4QYMA 3DBIA 1NXPA 3GT7A 3RVOA 4RKRA 1QKKA 2M1ZA 5EWLA 3DGFC 1DP4A 4Z4GA 2FQYA 4IILA 4W5TA 5FWXB 2LP4Y 4H3KB 4LDZA 3EAFA 3KJXA 3I09A 3BREA 4OATA 1D1QA 2FKAA 3OLXA 2JK1A 4H60A 3H5WA 1PNRA 4MR8A 5CHYA 1GCAA 4RSMA 1P2FA 5CNJA 5KWSA 2E4YA 3LUDA 2L17A 2PLNA 2HQBA 1EWKA 1M5UA 3NNDA 3A10A 1NXSA 2E4ZA 3UK0A 4LX8A 2IDMA 3IPAA 4EGSA 1JWLA 1YTUA 3ILHA 4MQEA 1NXXA 1DC7A 5BRJA 3IDOA 2M98A 3BILA 5GQSA 2XDYA 1ZVVA 1YVUA 3OMXA 4LE0A 2R25B 5CNIA 2V0NA 3RVRA 2WMYA 1NY5A 1P6UA 4KREA 3HV2A 3L49A 1E6LA 3C97A 2OENG 5F64A 4RK6A 4EYOA 1C4WA 2FSPA 3O2JA 4JASB 2FQXA 1BVHA 3QX8A 5TPWB 3VNAA 3Q7RA 5IUNC 1PEAA 5ABPA 1ZN2A 3FMVA 2IPAB 2PL9A 2PUEA 1RXIA 4RKQA 3GA5A 2A9OA 4F3TA 1W9HA 3IP6A 1L5ZA 1QP7A 1KRXA 3A0UA 1ZESA 4TLLB 1YMVA 3E3MA 3N53A 1RNLA 4HNRA 2FMFA 5JS1A 4JP1A 2MSKA 2QVGA 1SD5A 5IUJC 1VRVA 2R4QA 4MQFA 3CG4A 5ED4A 3F73A 5KQLA 5IUKC 1JDPA 1JBEA 1P6QA 2PL1A 5JNRA 4ZMRA 4EVSA 2IPNA 1OXKB 1VKRA 4YLEA 3N0WA 1Z2DA 4EUKA 3G85A 3D02A 4WUTA 4RDCA 1NXWA 2YHBA 3QLUC 4MR9A 3GBPA 4RK7A 3NNSA 2A9QA 4ETMA 3OQMA 3KLOA 2QSJA 2N9UA 5C5CA 2JCGA 4LE1A 1YK0A 4DADA 2IKSA 2JB9A 4RK4A 3IP5A 4LDAA 1LJLA 5IX8A 4DN6A 2L18A 1JFTA 3ROFA 1DCFA 4G0YA 3CHYA 5HSGA 3TO5A 4KFCA 3Q7SA 3OLZA 2FEPA 1IIBA 3CTPA 1QMPA 4WZZA 5TE9A 3T38A 1A04A 1CEYA 1DC8A 5JNSA 5EWMA 2GX6A 1B00A 3HS3A 2I6FA 4LZLA 1VPWA 1DJMA 3KKEA 3JVIA 1TVMA 3HSYA 3CKMA 1JF8A 3KSMA 4QPJC 5BR1A 3KCNA 4Z99A 4F06A 1Z17A 1ZITA 4IGAA 1GLGA 3HDGA 5BRAA 2PE5A 5KQMA 1Z2EA 1BA2A 3Q7TA 2RJNA 1QP0A 4Z4FA 5C5EA 4MRMB 4XASA 4W5RA 2RJOA 4KV7A 5IBQA 4G0PA 3CZ5A 4MYRA 3CU5A 2PMCA 4Q6BA 1JHZA 3O2QB 2PUFA 4MR8B 4P98A 3RH0A 2MSWA 1DRJA 3KHTA 1J56A 5CNKA 1RZRA 1PHRA 3JTEA 2DRIA 5TQJA 2RDMA 4KNYA 4JB2A 4FE4A 2R47A 4G0OA 1F51E 3RVJA 5FWYB 2L19A 1E6KA 3H1GA 4MQFB 1KMIY 3HUUA 2NZUG 1ZAYA 3A3KA 1QQAA 1GUBA 5DGCA 1QO0D 4M88A 2WJWA 3OO1A 4DQDA 1NATA 4EYGA 1DBPA 3N0XA 1AB5A 3OO0A 2X7XA 1DCMA 5T3YA 4JOQA 1DBWA 2HQRA 4RS3A 1U0SY 4PEVA 4OLAA 4E7OA 4KPYA 3JS5A 1VLZA 1M2EA 3SQNA 3UKJA 2FVYA 3HM9A 1ZHHA 4IRXA 3QELB
chains in the Genus database with same CATH superfamily
3PQDA 3UO8B 5DTMA 5TJ9A 2JAPA 1BXKA 1X7WB 1ZGZA 3NH6A 3P27A 1OLSB 1PW7A 4GSLA 1LK7A 5YASA 3LFHA 2CGEA 2HSGA 3EOZA 1QYRA 4GXQA 5FLYA 3RFVA 4A92A 3PL1A 4FE7A 5JXJA 1IUOA 3BTVA 1H3EA 2FAXA 4RM3A 3RG2A 5E6SB 3OBBA 4V3CA 2O3UA 3NDJA 5E4FA 4OH7A 4RQUA 3PVZA 4DIDA 4CEIB 4C4OA 2Y1KA 1V26A 5JH7F 1P17A 4EG4A 1HNWB 2J5QA 3OWOA 5CA1B 1KZHA 3KTDA 1SA0B 3TR6A 4Q6WA 3QTLA 1CJUC 2Q5JA 3PC3A 1SJ9A 3OIFA 3HCRA 2FOXA 2IXBA 3I6BA 2VA9A 1DG9A 1DIRA 2A3RA 3G7NA 5KTOA 2XDWA 2ZRKA 1AHPA 1CS4C 1T15A 3TKAA 4ZZ3A 3Q87B 3GXBA 4FYVA 3ETLA 4DDKA 4MPPA 3USCS 2BDEA 2OOSA 1Y37A 3I0ZA 4EHKA 1GP2A 4Y9TA 3I1JA 1UFOA 2AXNA 3D8NA 3FPAA 4BXOA 2XUOA 3HC7A 4KLRA 3G8CA 3LI2A 4B3DA 3KAQA 4HNTA 2I9KA 3BK1A 4MLPA 2BKVA 3SG0A 1G60A 1Y9EA 1DEAA 2NV2B 5H70A 1IXYA 3P8ZA 4PAQA 4II7A 4ANFA 3UK2A 2NO1A 3IUBA 5CTJA 1Z83A 4G41A 2BFPA 3ISJA 2P30A 3ESZA 3KKPA 5DN6A 4AULA 5H8WA 1UK9A 4OHZA 5B55A 3EGIA 1VP9A 3VYTB 1C0PA 1VE1A 2BSAA 3LGAA 3GJ6A 3KZCA 4IRMA 2Q3CA 1P81A 4YECA 2HDHA 1BGXT 2AJCA 4H7FA 2KW5A 2O2ZA 3NWEA 4KX5A 4MS4B 3TIGA 2OFFA 3A32A 4IHAA 2BE7A 2QTBA 4RVFA 1XTQA 3G3EA 3DMTA 2VDLB 2Q1TA 2CUTA 1TMOA 2WJPA 1JR3D 4O4HA 3AR3A 2GPTA 4UBLA 4P93A 1DKUA 1DX6A 4J1SA 3W2EA 4J2HA 1KFEB 3TW8A 1CERA 4XM2A 2VQ3A 1LS1A 1BDMA 4Q3NA 4US2R 4E3WA 3VKGA 2QB5A 4FNGA 1PZHA 1PIWA 1T4GA 1EVZA 3TGLA 2ZIXB 1ISIA 1NDHA 5KJ6A 1L8AA 1GY8A 1P0IA 4FU0A 2VZ9A 3MLAA 1RYNA 1IQUA 2GUWA 3QI2A 1EFPA 2ZPTX 1QH0A 4L08A 5ALDA 4IEIA 3CX8A 3ILXA 4XA8A 2B36A 3FPSA 1JHVA 4PFSA 5A3QA 2WEKA 3P9PA 2IRWA 1R12A 1NUQA 1VHLA 1RXYA 2XQJA 3MD0A 4FI3C 4FHEA 2ENWA 1UMCB 4IDOA 3IP7A 4QBKA 3NOXA 4G24A 3O4FA 2EQBA 4G9BA 4OJKA 3U5TA 1IN8A 5MN5A 2PT7A 1QHHB 1Z4PX 4BFZA 3EZNA 5IP5A 1TQHA 1U2SA 5EJ4A 3CXRA 3VQTA 3AEKB 2D13A 4BMCA 3ZDCA 4P7GA 4OHPA 4Y6QA 2HV9A 3X1KA 4KMMA 3ZPXA 1SCBA 4BS9A 4LHVA 3RABA 1E6WA 3BOSA 3HHPA 4N0DA 4U2BA 3GZTB 3DEJA 1MU0A 5EFZA 1MQ9A 2PNFA 2YFQA 3TSZA 4AN1A 5FH9A 5F3WB 4YV0A 3IUNA 3B70A 1Z3CA 1UZUA 1MABA 3U7JA 1KI6A 2WHPA 5KOJA 1NXVA 3GDGA 3LUAA 2NACA 2IPMA 2CT8A 1JFVA 4PXSA 1RLIA 1BDBA 1J0CA 1FTGA 2W58A 2WV9A 3ORHA 4ZAWA 4ZCSA 2NU8A 4Z6KA 1IIRA 4ZXPA 5T4HA 1GPMA 1VM6A 1AKMA 3IBFA 3LX8A 3ZY4A 3PFWO 4KIGA 1T1EA 4W5JA 2MCFA 4PZ9A 3D4PA 1ZMOA 2WHQA 3EH2A 3NEYA 4JIGA 5DNEA 3SNKA 4JQYA 3FLBA 3DLIA 4I8XA 1UJCA 1T9BA 5J5VA 1XQXA 2Q4BA 3B5IA 4J1NA 5DT9A 3OZGA 1CIVA 1E3MA 2NU8B 4MIKA 2HPHA 4TUYA 4Y9RA 5LZ8A 4YV1A 4DCGA 5G4KB 4Z3DA 2WHPB 4B8YA 1FSGA 1XZKA 3EIOA 1XQYA 4RA6A 3MRVA 2O57A 2WHEA 4HAWA 4ZC8A 3FFXA 5IK2D 3O4VA 1L7OA 3G8DA 3QF4B 5KTRA 2ZG6A 4QU9A 1TUEA 1QK3A 2C98A 4EFKA 1OH7A 4MQEB 4IDDA 4KPFC 4AUKA 1GGMA 2QYOA 1D2EA 2BM9A 3QUTA 5IZ4A 4BPBA 3CZAA 5EZ6B 4MIYA 3BXZA 3CRMA 3FMPB 1KI3A 1WZNA 5SY6A 5F2NA 5CIQA 4EY6A 1RQLA 3FNGA 1DINA 4IDFA 3TL6A 5HPYB 1CYEA 3OMLA 4PG8A 4ZARA 4BQNA 5DMXA 1N3BA 3UVEA 5BW4A 1KXZA 3NHMA 3P9YA 4P7KA 1VL6A 1V3TA 3TDMA 4EQ6A 5BY2A 1W59A 2W2OA 5FWXA 2FW6A 4YJGA 3WIVA 4RCZA 4NX2A 1KYZA 4MRAA 1GT6A 5JAHA 1JZSA 5SZHB 1FB5A 2VPTA 1RKVA 1XNQB 2AXQA 5DTQA 2PX5A 2ZDGA 2ZB7A 2YIJA 3CLSD 3AF3A 3JQAA 3Q8XB 4MR7A 2VTVA 4LHZA 5KYNA 1C8BA 1MN6A 1Z0ZA 2UUBB 4YI5A 3LQ4A 2QBYA 5B4VA 2ZYUX 1HE4A 3NOQA 3BIXA 3DC7A 1XWIA 1QHNA 1PJRA 1BX0A 1MPTA 2SCUA 3PR1A 1Z45A 4JEMA 5E8RA 3A9CA 1Q92A 3ESXA 3N6XA 4UTOA 3ZJ4A 2FETA 3PIIA 2AZXA 2GRJA 4KE7A 1F8FA 1TCAA 1XDWA 4OGFA 3MN1A 3ZNOA 3D6FA 2NYAA 4V0OA 4X64B 3AVVA 4KITB 4EGCB 2O0JA 3GDOA 3NHJA 4X1IB 1HFWA 4NU8X 5GONF 2OSVA 1BX3A 1K0UA 1EB8A 1JDZA 3L7YA 1SCAA 4Z4IA 5JJLA 4GUAA 3IJEB 1J8DA 1P29A 4YT2A 1ZK4A 2W6CX 3LYUA 4UXHA 2HT1A 1PR3A 2IYNA 2OYSA 4ARZB 2Y66A 1HYGA 1JPVA 1R6DA 3PUIA 4QD3A 5K6TA 3SE0A 3PUHA 4H7KA 4RACA 5DHTA 4ETNA 4MVJM 1YULA 1GG2A 3UA3A 4EJSC 3U17A 3ZIDA 2DH6A 3VR6H 3OM9A 3VV3A 3VR5H 1Q3KA 3ZKWB 3CLRC 3D3QA 1D5WA 3B5JA 3JYPA 4W6ZA 1YRLA 4ZO8A 1XHEA 3SKVA 2CXHA 1JEQA 3GCDA 5DE3A 2D2FA 4CQLA 2YYZA 5EYPB 1N5LA 3M6UA 1ZUHA 3FZGA 3P9KA 4MUXA 1DXYA 1XA4A 2IYUA 1CRPA 1E6CA 2JS7A 1QUEA 3IQEA 2Q4EA 5HJEA 4IO0A 3PNSA 4BC1A 2WM2A 5JEEA 4XEUA 3I61A 3SQWA 1M67A 5C5DA 4WXMA 1M76A 3FUWA 1CJTC 1PE0A 2RHRA 1C2TA 4WQMA 2C07A 1Y5LA 2NQTA 3O7WA 5C32A 2XH8A 3L92A 4TV8F 1DOHA 4YDQA 1MB2A 1R3DA 5LQCA 1ZCJA 4U3JB 5EMLA 3N7UA 1E4VA 2PMDA 4HQNA 1RT9A 1U94A 4RFSB 5IEJA 3BH0A 3IT2A 1BWSA 5TNXA 2J3IA 4ITRC 1YHZA 1DOZA 4NZPA 4RKYA 1ZI6A 4D57A 3C5HA 1IZ9A 3P5SA 3BVPA 4KWHA 1P61B 4MDHA 4MRVA 3FPEA 4RCYA 4PVCA 3DLHA 2YV2A 4DZRA 3N5KA 4EFMA 3PGMA 1JG4A 1LBIA 3L9XA 4CF7A 5EZSA 4B82A 3KJZA 4BQRA 1L7NA 3A1EA 3LCMA 4R1OA 1JR2A 2G83A 4FYJA 4L28A 1Y89A 4Q82A 3KYBA 1C0IA 5I8ZA 1Q83A 3C8HA 3KUKA 4EHFA 1LPMA 1EIZA 3CEMA 4HGQA 5DHSA 4F11A 4YFVA 1KYYA 3WAKA 5HKBA 4NABA 4RXUA 3WK9A 1YDEA 4XSGA 1AO3A 4UC0A 2I6TA 3VM6A 2Z3WA 1T0PA 4NV3A 3R7BA 2OSBA 3AVPA 4NFLA 1KPIA 1II9A 4CN8A 1J0BA 4QNMA 1OYWA 3AHCA 3GP8A 4WOJA 1JKMA 3KOOA 3D6JA 3RRXA 4KR0A 3TQOA 4Z4GA 1O3YA 1NV9A 1MOPA 1UL1X 3SDBA 4ZDIA 1YB1A 2Q1YA 3W4KA 1H8HA 4GLBA 4KTVE 4U3JA 5DYTA 3D1VA 2QJFA 4ZTUB 5C1IA 3AWDA 1P2TA 3HNOA 3FPCA 1H9BA 4MAFA 4MSUA 3ICOA 4JB3A 4TYYA 3TTVA 1CT9A 4HEA1 2O2SA 4EWLA 5EGNA 5MFZA 3SR0A 1NXSA 2JGFA 2GB4A 1X8JA 2IY7A 4LZNA 2F3SA 5JXHA 1G41A 1Z9BA 1IRIA 4ZJZA 5AW4A 1SXQA 4G4JA 2XDYA 4B9EA 4QUDA 1V1MB 2A9KA 3HFSA 2O7RA 4H4CA 1ZD5A 1KAEA 1KI8A 1YBMA 3T5PA 1MAWA 1NY5A 3T5GA 5BV0A 2HF8A 4MJXA 2J3EA 2WSLA 3SHQA 3IJRA 5LYJB 4L16A 4Z1MA 1WPGA 2HA0A 3EEIA 5JH7A 1B74A 4HDRA 5A5EA 5IT5A 4TQUS 3Q8LA 4ZICA 2P75A 2WUFA 3UMSA 1SXJA 3QX8A 1VPTA 1BMFD 3SDZA 1QQ5A 1ZNYA 4YAGA 1R4NB 4NE2A 5EIBC 1PEAA 3CLHA 5K20A 3OTIA 2PZJA 3FMVA 4R7GA 3IV7A 3WGMA 2G7MC 4H08A 5GJBA 2F9LA 3JYOA 2YZ7A 5KSPA 3ZWOA 4HN9A 2NW6A 3QJGA 3CKYA 1LSOA 1A69A 2VNHA 2XUKA 1SQGA 3NBXX 4QUHA 2UUOA 3OOWA 2IS2A 3N53A 1U8FO 1B3RA 5EJ8A 4N5IX 1WUTA 4WN9A 5TVKA 1C2YA 2MSKA 2QVGA 3RVDA 4B1FA 1TA9A 2GDZA 1P72A 3MJCA 4MQFA 8LDHA 2I8AA 3FTCA 2X15A 2IQ5A 4D4MA 3S68A 2QRNA 3FETA 1JBEA 4J07A 4B4OA 1N6LA 1OX6A 4IYRA 5TGDA 3V7YA 3LT2A 4TKLA 1CCWA 4B4DA 3FNQA 3PNKA 2IX3A 4KLCA 3LWDA 1PTJA 3HDTA 4BMZA 1ZGCA 1H1LA 2C57A 5I9IA 3G13A 5IF9A 5I7OA 4JUIA 3D8TA 4CLOB 3LC0A 1EDBA 4LV5B 1W0KA 1EVLA 2DH5A 3DO6A 3HSKA 1MT0A 4XE5A 1PI3A 4ZKEA 3C3BA 5I45A 1DWUA 4N1AA 1ULSA 3ZV3A 3BJMA 5TT1A 5J3JA 2JB9A 3DEIA 5EHQA 4UTXA 3I6ZA 3UK1A 4HDMB 3BJEA 4PRLA 3U0VA 3Q88A 4E22A 4R9SA 4D99A 2ZAOA 3OIUA 2X6RA 2R2GA 4LVUA 1E2EA 2A5JA 5DWDA 5FFFA 5KNCH 2DLNA 3H1PA 3FPFA 3UBTA 3PVCA 3UAOA 4YJFB 1Z7WA 4E94A 4Z4QA 5KNDH 5IAOA 1WU7A 2VK8A 3Q7SA 1FUIA 3OLZA 4TUYF 1WBDA 3UG6A 4ND7A 3OZVA 2YFYA 3RHZA 1U2RA 3T52A 1SWVA 2P62A 3R1IA 4XJSA 3LH5A 4BX3A 2ZJOA 1T2FA 1U31A 4IIFA 1F6DA 2WWFA 1GDHA 3LS2A 3MWDB 3IQXA 3N9IA 2PR7A 4MV1A 3OZ7A 3TR5A 4IH4A 3DE1X 1TZMA 4TKVA 3MWJA 2WQZA 1P39A 4GHWA 5K4AA 4YRQA 4PQGA 5LQSA 4WZAB 3TOSA 5JANA 2C96A 4ZODA 3BT7A 2FYTA 4A03A 3ZHXA 1LBEA 4DG8A 4BZZA 2BMDA 2XRFA 2XDQA 2QE6A 2HFJA 3P19A 1G2OA 1AKEA 5CVJA 3U80A 3HCPA 4XASA 1J7JA 1U2EA 2PHZA 2AOXA 3DYIA 1DT5A 5HUJA 1XZAA 4JJ8A 4LX0A 5ANRB 4PAOA 3RRJA 3WIBA 3WDSA 4D7AA 5AUNB 1XEXA 3L6OO 5A05A 3ZVMA 1A8SA 1I4WA 1UPTA 1KYWA 3H2YA 1E2UA 3VDMA 3EVGA 4URFA 4L57A 3A6DA 2P2SA 3EGXA 5AKJA 4PG5A 5EI5A 5H1YA 3M6LA 3F6SA 1E7MA 2BEVB 3R3JA 4M1ZA 1BIFA 1DIGA 3VJKA 3SBOA 2Z58A 2J7PA 1PG2A 1E2PA 2SICE 4H4EA 2G1KA 1BWQA 3M0EA 3PQ4A 5K1ZA 3P9RA 4EG1A 1XSEA 3F3MA 3TAXA 4DQDA 4F5WA 4FYXA 1WF3A 2QQGA 3PA6A 2CDBA 1TUGA 2W8BA 2O0HA 1W5EA 4OXKA 4JOQA 3I5MA 5CVDA 4RS3A 1G8MA 5BV8A 2WU3A 4L0QA 5DYWA 2D1FA 3D54D 3E15A 3OPNA 1UBCA 1Z5WA 3ACDA 1QKIA 5H02A 4ZVTA 2P9GA 3L0DA 3MJRA 1L5SA 3C8UA 1NVVR 4Q1AA 3SGLA 3RIMA 3PD1A 3PWTA 4FHDA 4WEQA 5D7NA 4W1QA 3BXXA 2JJ2D 2OORA 1GG9A 1UEXC 3DCYA 1QX3A 4EB3A 1Q0TA 1H4SA 3VO2A 5I51A 4KUEA 1A76A 2RAPA 1SR8A 5FOSA 3HKEA 4GDFA 4U2DA 3OA2A 4RE6A 4QPCA 1YZLA 3NEPX 4FQ7A 2OWDA 1ESMA 3WRYA 3ZNNA 4D5GA 1AMOA 1KDPA 1MDBA 1GNVA 2IUEA 1KSGA 3OZDA 4ZEWA 1O0BA 2O3QA 2XA2A 3DFZA 4JI6B 2RMKA 1D0IA 2P4EA 2QMEA 1E3DA 4HWGA 4OBWA 2FSHA 5IAKA 3KBBA 1G3QA 1AQYA 4QDZA 4BLQA 4C07A 5AUQA 5ITZA 3ADOA 1QBGA 3WLIA 3DEKA 5E7JA 4BX8A 2GA8A 1O95C 4F2GA 3UB4A 5FNVF 1XL0A 1A5SB 1CC1S 1EFRD 2UUPA 3I28A 1ZXXA 2PKQO 3KDAA 3S40A 2XNDA 4E7PA 2PBFA 5COBA 4QFDA 2ZSUA 1NP3A 1ATZA 2OD9A 1F8YA 3MJTA 3IB6A 4IXTA 4YAFA 3K70D 4G0VA 4L3OA 4L4ZA 4RXTA 4WE3A 4DTIA 3KR9A 4MLDA 4PZCA 4YRAA 5JNVA 1AGPA 4WFQA 3WGJA 1N36B 2VRCD 4KYVA 1NRJB 1XWWA 3FB1A 4MPTA 1Z5OA 3DLPX 3C3WA 1D4FA 4TSKA 3TTXA 1DC3A 1C3EA 3E0QA 4GX5A 1JBQA 4IH1A 2GD6A 2JFGA 3EXEA 2GCPA 1OMOA 4KCGA 3ZVRA 2CKDA 3UQZA 3KPWA 2QX8A 2GYVA 5BWBA 2HF7A 2GK6A 2E18A 1R8SA 4GS5A 3THOA 2CL5A 4EI7A 5T6MA 2BKUA 3QEOA 4Y7DA 2F7SA 5CG1A 1Y42X 3UWPA 2X77A 5ELMA 1MNAA 1QIHA 5K0TA 2B4KA 4N5DA 1HDEA 1FNNA 1W4LA 3OZCA 2OK8A 2X58A 5FKJA 4N65A 4I4LA 1NVFA 3FYTA 1SGWA 2FUNB 3TNYA 5ENDA 4KR9A 3EA5A 3UG7A 4E12A 2BPOA 4ARCA 2AUTA 1T6BY 2QYSA 1ZK0A 3S2GA 3RHTA 4IUBS 1QTRA 3QKIA 2AHRA 4L4YA 4RF2A 5BSTA 2DQKA 2K87A 2IZ7A 3ONFA 4YIHA 3O6VA 5FUWA 1YQEA 4O2AA 2AKAB 1NW3A 4XPIB 1V95A 1V37A 3W5UA 3BHIA 2QDKA 3JWIA 3SIWA 4KWCA 4CQMB 4OMCA 2OR3A 1B14A 4RXMA 4EX7A 1UZLA 2HRDA 4BJ6A 4MW7A 1U8EA 4YJ3B 4PZLA 1JDBB 2JAHA 3LRXA 3SYKA 2BTQA 3RUHA 3WIOA 4QEKA 4PIPA 2UXDB 2FXIA 3I9JA 3BSWA 3ILVA 3RK1A 4N0MA 3ZC3A 1U5BB 2J30A 2YWDA 1HLPA 4O02B 5B58T 3W4JA 3IDZA 4HI0E 3T3PB 2IIPA 1F6BA 1GLVA 1U9IA 1SUDA 3G1UA 3JD1A 2X1MA 4IVRA 3DHWC 4OY3A 3T15A 4J2TA 1YL7A 3FN4A 3M5CA 4YJFA 1YKFA 3L7OA 1N34B 1TTQB 2P0AA 4L8GA 2PKXA 2QN3A 2OCDA 4A36A 3VYVA 1GYQA 2MYUA 5CM2Z 5MGBA 2B9EA 2QTWB 2RCYA 1ZSNA 5J47A 3QQ5A 3W5JA 5JAZA 4ZQBA 2JFHA 3B52X 2QQEA 3JQCA 5TMBA 3FNHA 2ZBGA 3IP9A 4PLCA 3I1FA 4I9NA 4KAJA 1XU4A 2XMPA 1VQ1A 1MQSA 2I8LA 2VH1A 2XB8A 2VBFA 3MWEA 4NQRA 5EE9A 4JVMA 5AHWA 3ZS9A 4KWIA 1PJTA 1Q2UA 4NYJR 2V8BA 3SU8A 4N82A 4AECA 2DPXA 2LIVA 4QUJA 2NT3A 3ORYA 3KHSA 4Z1OA 5B6PA 3GVXA 4ZAGA 1FFWA 1HFJA 2XWJI 3MWEB 1B0AA 2BFCB 3VYUB 2F1HA 1ZVJA 5D87A 4KR6A 1XNGA 4FXPA 4TYQA 1WDLA 5F2OA 1SCJA 2E1RA 4YMGA 1S5PA 3OSUA 2B98A 1BDIA 3EXHB 5E0KB 4ZJUA 4URWR 4AJNA 3LQYA 4MRMA 3U4QB 4E33A 2CHFA 1U7UA 1F1BA 3UJ9A 3R9XA 2HIHA 2ZWVA 3QIVA 5CH8A 4DTCA 3D6HA 3VNVA 3PLNA 2C88A 2N75A 3L18A 1TF5A 4RPIA 3RUAA 1CQWA 1JXAA 4P5EA 3A2LA 1CRWG 3CLUC 3VKFA 3TD9A 3HZZA 2CHQA 5C81A 1F0NA 1XTSA 1XOIA 4E5YA 4DSTA 3JCZA 1T4DA 5F98A 4LNHA 1CQJA 3NC0C 3K2IA 5TPZA 3PDUA 8ABPA 2FKNA 2EATA 2IP2A 2Y68A 1N6OA 4BGIA 1T36B 2AI1A 3UJ8A 3UT0A 1FYVA 4TTTS 1S2NA 2DU8A 2JHCA 4C3OB 2LTAA 1L5YA 4B48A 4W5QA 2FN7A 1MLDA 2CEKA 1CPYA 2IUYA 2ZJ3A 2I65A 2YCBA 2Z5LA 4KO2S 5KQPA 5IAJA 2GXQA 4JI1B 4DUYB 1E62A 1LW7A 3LX4A 3EF3A 3QX3A 4PONA 4B3HA 5EP2A 4M2LA 4AD8A 4ISBA 4MW2A 3PHHA 1GGJA 4XIIA 2IH2A 2B8EA 4DG5A 4EHJA 5JD3A 4D98A 4EEZA 1TAQA 1TQDA 4HZUB 4AZ3B 3UMRA 4HX9A 4XDHA 4J2OA 1PL7A 4YV2A 3LIPA 4M6WA 2Y76A 3D3EA 4UZFA 2VYNA 4ERXA 1X13A 1MA3A 2DBZA 2VQEB 4HEHA 4TMVA 3V8QA 2AR0A 3SP1A 3D6NB 4M9ZA 1XCGB 4MW0A 4W9NC 4X7PA 4DMKA 5K01A 3MTDA 4KQWA 3W3AD 2O4CA 2WAMA 5JBQA 1IWPB 1D0VA 5JECA 1NE7A 2OBLA 5IDYA 3IO3A 3GUUA 4E2XA 5IJ0A 3N2YA 2NAFA 4ZOLF 2F6RA 2OILA 1A4UA 2B99A 5FUBA 1OZGA 1FQOA 3QITA 4OK3A 4J4HA 4MCHA 4RD1A 5IEBA 4LE2A 3VZDA 1BYUA 3KEFA 2LR0A 2XY4A 2WMOB 3ML1A 4HGPA 3ZZ1A 3U7HB 1Z75A 3BS4A 3EPRA 1GT91 1R1DA 1ZJ6A 2ZQ5A 3FBTA 2PJUA 1N4DA 3NM6B 4L02A 1O97C 4P83A 4W1SA 1IHXA 4V1CI 5JZ9A 4CQMD 5LWHA 3CONA 4DMFA 1SIOA 5DYNA 2ET6A 1ZW6A 5E3JA 2YZMA 4K9LA 1GSHA 1WNTA 4QHSA 4EA9A 5JEDA 5F5LA 4EGAA 2ZWOA 4JCCA 4A0QA 4XD2A 4BMNA 2NTYC 3OU6A 2EX1A 4LDQA 4P5PA 1I33A 1CFZA 1V16B 3K71B 2VTBB 3W5IA 1Y8ZA 2GARA 5BW5A 1ST3A 1ZJWA 3OPQA 1XELA 2QAJA 4HH4A 4HQ6A 4OL9A 5CB4F 5DRTA 3RE1A 1A27A 3GLGE 3K7EA 1H0HA 2O06A 4PLVA 5ES3A 3OOSA 5J23A 2AE1A 1FFDA 1OGJA 1W94A 1H5NA 3KYCB 4AZTA 1DKLA 1P9LA 4BNIA 2W83A 5EIOA 3Q4GA 2J5XA 1OPXA 1TOAA 2F59A 3MWLA 1NJFA 1WEHA 2WTBA 5C7YA 1UEJA 2C61A 4NHOA 3TGPA 1SUEA 2DVMA 5BRNA 3CGWA 1H1TA 1HNXB 4FMCF 3TQIA 3C2QA 5IAAA 1SOVA 4WDQA 1KHTA 3GROA 4X71A 4CKWB 4V1CB 2ZUSA 3H86A 1SCKA 2B1JA 3M3DA 3TQQA 3LZCA 1FS4A 3GMIA 3T35A 4AG6A 5KU7A 2DTEA 2WT9A 4ZVMA 1M9NA 1Q1QA 2JFPA 4H3VA 4UE3S 4BZPA 1S89A 3TLMA 2RI6A 5AHOA 3B53X 4Z4EA 1T0UA 4BNVA 2ZBRA 2FTKE 1CNFA 4CKWA 3MA0A 4HRYA 4P33A 2P90A 4NKRA 2QRHA 5ILQA 4Q19A 4KXYA 2HWKA 3IPLA 5LYJF 3A3OA 3H6GA 4J9UE 7GPBA 2BCJQ 2IHZA 1G7TA 3DXZA 3JQGA 4BNMA 1R74A 1XZLA 3O0DA 2Z2JA 2O9JA 2JAWA 3ADKA 3AR6A 4I1VA 2ETVA 3PRKE 3T4EA 3THXA 3ZBTA 1X1DA 2LP4Y 1YCFA 4RH0A 4E6PA 2F8MA 3NV7A 4LDZA 3EIUA 5TR9A 3DHEA 4FFSA 2BE9A 3TL3A 1RD4A 1FFXA 2ZGVA 1Q0ZA 3R5XA 4FVTA 3RDPA 1V0JA 6GPBA 2DWCA 2A8YA 3Q10A 3A6KA 2NU6B 4NFHA 3H3XA 3I5UA 3JQAB 5E95A 3CUYA 3SR4A 1FOEB 3PT9A 3REQA 3UHFA 2H5JA 4XFJA 2JIDA 1HZZA 4EUHA 1A72A 4FFBA 1LRKA 1ZR4A 2VVTA 2I29A 5ALIA 3TFQA 1L6RA 3V97A 4WXHA 2V3WA 3LCVB 3ENWA 3ZH9B 5HE8A 4IP0A 2GXSA 3M83A 3LC1O 2R8XA 2FOLA 5DYGA 3ZI4A 4QNNA 5A7GA 4B4WA 1DDIA 1JJBA 3QQPA 2BFEB 2PKWA 1E6LA 1UBUS 1VHWA 4EYOA 1B0UA 1RQ2A 1K6MA 3NVDA 3OOHA 4KUHA 1L7DA 3QH4A 1P1RA 4IDAA 1NI3A 3PHJA 1XMVA 4PS1A 1YS9A 1KDTA 4WERA 4U39A 3MMXA 5FFMA 5IT9A 1N77A 2AS0A 3QOYA 2GFHA 1WQ3A 4CNQA 2QN1A 5BSUA 3DTTA 2ZRAA 3QYJA 4H7EA 2BT4A 3A3NA 1XRLA 1MQ8B 4TLLB 2AD1A 2JJ1A 3QYAA 4A8JA 3GLGA 3HKBA 1R9NA 1EPUA 3W34A 3QPUA 4GP7A 3AKYA 4GWLA 4X44A 2ZI6A 4IIVA 4D81A 3PITA 4K9NA 1LTQA 4XRGA 3IA7A 1UWCA 3F73A 3FROA 4P0TA 3CEPB 3ECAA 3DFIA 3THRA 4UNRA 1Z2PX 2C4WA 1L8LA 4XCQA 4PN3A 1NQ5A 1JLMA 2CDNA 4HYYA 4EJSA 3KTAA 4TV8B 1MOSA 3DEHA 2A4MA 1VKRA 2O50A 4AY5A 2X2FA 1W6UA 1ADYA 3H5RA 4HS4A 3TJMA 4EUKA 2VJLA 1HYHA 2OFPA 1NSYA 4ND2A 2J1LA 1JE0A 3I04M 1QR2A 1PQPA 2ZQYA 4R1TA 3IX7A 4GEKA 1WY7A 1M10A 2GPWA 4GBMA 5H80A 2FG6C 4EX6A 1EG2A 4RHEA 3F0TA 4R01A 4OQ4A 2IODA 4X94A 3DL7A 2VJPA 1T24A 1E9AA 1XGKA 3WQSB 3UPTA 1EGHA 4Y1RA 3X1JA 2RONA 1A98A 3L0PA 4KQGA 4JL8A 5JWHA 8OHMA 2X9VA 4KRYA 1UPBA 3B78A 7YASA 1LPPA 2QTAA 5L95A 3H99A 1G5QA 3OTQA 1R4NA 3FR8A 1GGHA 2QROA 3CTPA 1QMPA 4DR3B 1CEYA 3AT1A 1N5DA 1COZA 3QG1A 4KGXA 3E48A 4I4NA 2F2TA 3EBPA 3NXKA 3RYCA 4LZLA 3E5HA 3ZI7A 4GX2A 2PLAA 3UH0A 1YS1X 2B5OA 5HKKA 3BKWA 3K9LA 3OCJA 1HMPA 1U9IC 4D8VA 3EWAA 3ZE1B 1RHUA 1NU6A 3B6KA 4O59O 1NSFA 1MNQA 2Q4RA 4E5NA 3QVLA 1HEUA 1ZL2A 2GAOA 1ZITA 4GPTA 2IYVA 4HQKA 4RAQA 2V1UA 4YONB 2ZAMA 5BQOA 3NEJA 3ZWWA 3ZWAA 3U1BA 4CIDA 1H6DA 2FX3A 4OQMA 3BZBA 4MRMB 2IDKA 3U4QA 2M6LA 1TMGE 2RJOA 2WUDA 1AD2A 4FJ0A 3EXHA 4ME6A 3HR8A 2QWXA 4G0PA 4G5XA 1R6AA 3JWHA 1FUKA 1OLUA 4LK3A 5D3MA 5H82A 3ECCA 3V7FA 4YRGA 2FPMA 1OFUA 3O2QB 1JMYA 1O95A 3IDSA 4JYAB 2FVXA 4NY1A 5JZVA 3JRNA 2UYHA 2VAMA 3T9DA 4AJHA 4DIFA 4TXHA 5CX1B 3QNUA 4MVXA 4UQOA 1DFHA 2PVPA 2P2ZA 4IY1A 4KQKA 4YNBA 4ER7A 1FU8A 5LZ5A 2LW7A 4AF8A 3D3JA 2P11A 4YQEA 2ICAA 3RSQA 4PC3A 2N3ZA 1WPQA 5JCXA 1PD0A 2G9UA 3PUKA 5HKKD 1A5BB 2HSEA 3OQ6A 4TKUA 5EMMA 1H2ZA 2NTJA 2BFMA 2V65A 3THWB 1Z63A 2BELA 4QJ4A 1E1RD 1WP9A 3A6LA 3FJYA 1JSXA 3LY7A 3W3AH 4EB0A 3ED5A 2NP7A 3F71A 3G0HA 2AG0A 2HO5A 3H9QA 1EM6A 4IVPA 2FR0A 3COZA 5ALJA 4OLAA 3Q2IA 4Q4JB 4MCJA 3C43A 2AMJA 4CG0A 1RYHA 5ALOA 5B1EA 4ZYTA 3D5EA 4LHWA 2W6MA 3GLHB 1RCFA 2QQ0A 3KK0A 4REQA 4EZEA 2POQX 3RVMA 3CF6R 2XTJA 3NUGA 2JI8A 4Y2UA 3BIJA 2B4QA 3VYRB 4M1TA 5F2KA 4ARSA 1WUJS 3ZWVA 4S0ZA 1GPDG 5K9ZA 2YXBA 4OHWA 2VF7A 1D0SA 1LDEA 2Q7OE 4K8RB 4L2IA 3RU2A 4DMCA 3OEEA 1XLVA 1S01A 2WJAA 4J0QA 3TDNA 5JS2A 2VHEA 4UAGA 2VSYA 5GONA 4L85A 2MOKA 5L3RA 4K88A 5DGXA 2GFIA 3ETJA 1QOZA 2GJ4A 4JI0B 1CW2B 1FRVA 1WZCA 2BI7A 3CG0A 2VTKA 2JKVA 2ZRHA 3UWSA 1R0BA 2WFLB 2C3OA 4CF3A 4AX4A 5FHQA 4GI5A 1QWOA 2GGSA 4HXFB 3CIOA 4HLQB 1U6KA 2A9FA 2C0CA 4UTZA 3SYMA 1S8OA 3PCTA 1DAKA 3UMMA 2QKYA 4LWZA 4D3FA 2EYUA 2LPMA 5AYVA 1Z15A 1B2LA 5D3ZA 1Q1EA 2XYGA 3IVGA 4YUVA 4RULA 4OCZA 1EH5A 1EFPB 4KPUB 5KDLA 3T6KA 1GTZA 3MSXA 3VNQA 3J7AC 3C14C 4HAVA 5IJZA 4PFKA 2Q2WA 1YA4A 4UVHA 3WLOA 5B7NA 1DG3A 3DO5A 5KX5A 3QEAZ 5JJ5A 1PX0A 3VOBA 1KTVA 3DYBA 1NMYA 4N03A 2RAFA 2F1JA 1JEOA 2L42A 2O7SA 2DE0X 4FZ3A 4M0KA 3TD6A 1YVEI 3GJRA 3H4VA 4JI2B 1QGYA 3NPAA 4M0CA 4BKRA 1PG0A 2OCBA 3I8OA 5BN3B 1OREA 4QXPA 4D56A 1Q0QA 4DLBA 1TIBA 3STYA 1U7PA 5B2FA 4BBPA 1U2TA 4FDAA 2ZI3A 2OCIA 3FCOA 4U5QA 5E6RB 3G9TA 2ZYVX 4L50A 3B20A 2ZRGA 1O5TA 4S1TA 2PYDA 3WQHA 4PAGA 7ABPA 3VZPA 4UQLA 2QRPA 4D0SA 3HEAA 2WNSA 3N1UA 2A58A 4I36A 2OLJA 3M34A 4N12A 4BYGA 4ER5A 2QBYB 1JP7A 4KJXA 2HX1A 4MVJA 3RANA 2G17A 5JATA 1ZN9A 4Z9XA 3ZQKA 2H1SA 5EKUA 3L02A 1CF2O 4FC7A 4XQGA 3EIEA 2WYUA 4FMDF 3UAWA 4DFDA 4JI7B 3DZIA 2OAP1 3A1VA 1VOTA 1MG0A 4K26A 5HGXA 1IONA 1IN5A 5I9SA 5FLXA 1UWKA 2QLNA 1VDZA 4GGOA 4Z0NA 3BZWA 3BTOA 5DBEX 4ZREA 4ZEOA 1M2JA 3L8ZA 4ZCPA 3YASA 1V5GA 1YOVB 1R8XA 2EEZA 2JCBA 4A0FA 1ORRA 3CX6A 5DI3A 4ZK2A 2GETA 4IIBA 1QE0A 1YDWA 1E3JA 1R0KA 3EN0A 4GH5A 1PL0A 1G8GA 4MV7A 3UCEA 4GL2A 1A96A 2GHTA 3QUSA 3TI9A 4KYUA 3MNFA 3K9QO 4EB6B 3VX3A 5CFZA 5LSAA 1GM5A 1IEVA 2Q5EA 3PC8A 4V2IA 3ZWKA 5B30A 3L8GA 3CRZA 1FFCA 2QD4A 4F4JA 2Y2VA 1ONBA 3D6AA 2B35A 4KV9A 4OHFA 1PV2A 5CB4A 2QMHA 1TM1E 2WJZB 3KC2A 5A5GA 4CLOA 1P77A 2QSYA 4Q3DA 1MRZA 1SO8A 1Y82A 4RNCA 1O54A 4TQGA 4V0MA 3WSVA 4CNBA 1GKUB 1Q0RA 1A4RA 1ZOSA 2WP0A 4FE3A 2HMUA 4UD2A 5GJWC 2COKA 3HUTA 4Z9BA 5LQKA 1PEYA 4I19A 5ALLA 3D31A 1KJYA 2GF0A 3DP9A 4MVJG 3B7PA 4XM1A 3R7AA 3M5PA 1J4AA 3VHQA 3W5HA 4C06A 4MHOA 1GZ4A 3T95A 1MCZA 3LIIA 3R76A 2V6MA 3G9UA 3QE4A 1KP9A 1I6LA 2L69A 2QG4A 4LMBA 4MVJD 4BO4A 4UUNA 5BUQA 5KVCA 1G8AA 4FEGA 4P58A 2BGWA 1W52X 2QAGA 3OOJA 4XR9A 3UMJA 4C0HA 1M2HA 4DREA 2BGGA 2VHYA 1GWNA 1STOA 4BO3A 4Q9NA 3EGXB 2NO0A 1XZIA 2QF7A 3D8RA 3EPPA 5JPCA 2G08A 3L7AA 4CHGA 1SVSA 5CDTA 2Q0XA 2J0VA 5JG7A 1NNI1 2YJZA 1W36B 1BW9A 4B7XA 1L7AA 1T3SA 1JI3A 2QMZA 2ZS8A 2CVPA 3ICPA 3JAKA 1SQ6A 3BJRA 2A5YB 4RY2A 4ENUA 2VFAA 3SVLA 4WOCA 5JH7B 1UF9A 1CUEA 4F2HA 3G0GA 5HBRA 1XMIA 3HKBB 4HXYA 5CYPA 4EUNA 4EB6A 4DANA 3SHOA 5IHXA 4TZKA 4FP9A 3GEMA 3VI3B 4I6EA 1PDOA 1W76A 3P4XA 5HTKA 1GFWA 1AG9A 4HLUC 5K3CA 1ODFA 1SWWA 2Q21A 5CLQA 5G0SA 4EELA 1DX9A 1R15A 3NR2A 3O4HA 1UBEA 3E9MA 1NT4A 3KKQA 3TQRA 3ZLBA 1YAHA 1GUFA 3O8DA 5G2OA 5T8KC 2QTVB 4C1NA 3P9NA 1X3LA 1N57A 2MSDB 3VX4A 2JVJA 2W43A 3NHWA 1N6IA 4C0WA 2NVUB 5FO0A 5KVAA 1TLTA 2FK7A 2FNAA 4M7WA 3Q0TA 4B43A 4XOIA 5DNCA 3RS3A 1BDHA 2ZSAA 2G5CA 3FF4A 4NFSA 4YBZA 3WI7A 5TVGA 3FX2A 4JI4B 1LD3A 3N2IA 4JT9A 1IPFA 3H2IA 1H2FA 4LA4A 5IM5A 1QHIA 1QGDA 1BC5A 1XR3A 3M33A 3DMYA 3L4SO 1CQIA 1K2WA 3JQRA 3AESA 4JUDX 1UKYA 4KI0A 4NZZA 4RKFA 1CUAA 1DMSA 2R4UA 1L4KA 2YJ6A 4LDRA 3TOVA 3UAXA 3OZRA 4GZ3A 4EYSA 2G36A 3M4YA 1UFVA 3OF5A 4CR6A 4CIAA 1A1VA 5AIBA 3ER8A 4WGFA 5KPJA 2DT5A 4Y6SA 2V7EA 5F9FA 4BCCA 2H5IA 2I2XB 3MTAA 2NP6A 4UMVA 3FSJX 2AZDA 1N2IA 3HJAA 4NRDA 3HYLA 3WK8A 1R3UA 2HZ7A 4GBGA 4R8LA 1XZFA 3G0CA 1JI0A 4ITVA 3JY6A 4MRNA 1OVMA 3FVTA 4TTJA 2C1XA 1HNNA 1H66A 3KWFA 3NAZA 4OQZA 2O7QA 2Q4DA 2QIPA 1D07A 2OG1A 4QLBA 1U3FA 2E5LB 2MDTA 1ZINA 1I6MA 1AUVA 3LDUA 3UTDA 4AYWA 3GJTA 5KOJB 1Z62A 4RE5A 2D1TA 5EE0A 2JD0A 3AHJA 4LEIA 3DC2A 1Z8NA 1KJIA 2C5AA 4NFYA 2JFNA 4BEWA 4ZMBA 5ETJA 3TIFA 3HNRA 1EWQA 2P3QA 4F4IA 3VSDA 3G2LA 2ST1A 1VIMA 3VSAA 4NJEB 2G72A 5J5CA 3KYIB 1N3LA 3KJHA 4OLFA 5AM1A 4QUBA 3WB0A 1TM2A 3KXIA 1KEVA 2HMAA 4D74A 4F1WA 3KZXA 1IBLB 4ZYXA 2O54A 5AO9A 4HAOA 4C4YA 1H3FA 3T5MA 4ZZIA 3GLFB 2XOKA 2E5WA 2XHEA 4AL4A 1JB9A 1H05A 3N07A 2COEA 3OLVA 4KQXA 4YRRA 1EFDN 4IX9A 2FW1A 1ABEA 2X19A 3K96A 4NYMR 4EG7A 1NASA 4AQYB 1SD1A 4MQ4A 1HQCA 3QFRA 1AUOA 2F90A 4IHQA 1LB1B 1EBBA 1N0UA 1YD7A 4RUKA 3SEQA 4F7WA 4N0QA 4N6OA 5HDBB 5I8PA 3O38A 4CL2A 3FKSA 4Z0TA 3SY8A 1XJQA 1QJ4A 2A0XA 2RG1A 4NYIR 3U9LA 1HO3A 2FWMX 4FD3A 2NO7A 1WVMA 2QUBA 3TW8B 4G25A 3C85A 3AEXA 4EAAA 1CYDA 1CR4A 1NUPA 1UK7A 1P4HA 3P7MA 5IKXA 4YQYA 4Q7QA 1A8HA 3HBLA 2UYYA 2JBWA 1OLSA 2WMNB 3PGLA 4BLVA 4DCUA 5KNDD 2XOXA 1C7EA 3HRKA 4ARUA 4EI9A 1BDJA 3SR3A 2JNWA 3RI3A 2A7XA 5K0CA 1KMNA 1NTOA 2QD5A 3MCUA 1OZAA 2XQGA 2C8LA 3O8QB 2JIZD 5CW1A 3ZGOA 4TL9A 1ETHA 2R6FA 4LGYA 3S7ZA 5B2EA 3ZE0B 3JYHA 3AVQA 4K6OA 3W5BA 3ZIUA 1AGYA 1QFMA 1KQGA 4J0GA 4DZTA 1FDRA 3H9JA 3TNLA 5JZOA 1DUIA 3N8HA 3EWNA 1GR0A 3DZDA 4I1RA 1DSSG 4LWPA 4BAGA 2HT6A 5F52A 1JR6A 1NN5A 4GECA 4QYMA 2GHIA 3WMGA 3VNSA 2BAGA 1W88A 3B1XA 4AAYA 1QH8A 4X7MA 4BXOB 13PKA 1JNYA 2YJ4A 5B3LA 1EB9A 3TM4A 3HXPA 2DBVO 2I2CA 3O91A 4ISCA 2V54A 1CDZA 3G02A 2CL7X 3IBSA 3H2BA 2O1EA 4FEYA 4XOUA 1HYQA 4YMHA 4URZR 1FMLA 2B3TA 4DHEA 4UPVA 3KDPA 3QXJA 4RLSA 2JBHA 3TZEA 3DMHA 3VVBA 4OLHA 2BP7A 3NHBA 2QRVB 3UK0A 1G42A 4AJOA 3TBHA 3EFOB 4ARIA 1D6JA 1TKCA 2OHVA 3ILHA 1XTKA 1VE3A 3A14A 4A91A 2ZR0A 2BD0A 3WLPA 3H6KA 2QG9A 3IDOA 2OP1A 5HFJA 4WSOA 2GJ8A 4DCJA 4OK6A 4AY2A 1QTNA 3OX1A 4WBNB 1ZX1A 3ZJVA 2QUJA 3NYRA 5HIJA 3DH0A 2VXOA 1JEQB 3S28A 1VLQA 3HP1A 4LRYA 1U8YA 5F64A 3HB0A 1HTBA 3WQBA 4N39A 1U0OC 5KVVA 4OJYA 1I30A 1UUFA 4OHMA 5BVGB 4TVOA 4ALLA 3V1MA 1BVHA 2WSMA 3GLHA 2ZAIA 3JAKB 5DEOA 3T1OA 1KQNA 3UJCA 4DDWA 3RUFA 2PD6A 3VR6A 1ONNA 2FP3A 4BX0A 4MO2A 1RAHA 2AOUA 2LCIA 3Q72A 2XHZA 2H4XA 3E27A 1ICEA 3QKRB 3K6SA 2YBEA 3TEFA 1N32B 3ZVLA 2Y1LA 2Y9PB 3BMQB 3LOUA 3PA8A 3PKZA 4LHYA 1VHTA 1BOOA 1KRXA 2JGAA 2QPLA 1M0WA 4Q3AA 4RZQA 4EAQA 2FMFA 4IG4A 4B74A 4D8WA 5A5VA 2ONZA 1QFYA 2IFTA 3IERA 1EGAA 4NEHB 1SAYA 3H7IA 1QH1A 3MJFA 2K7FA 5JR3A 4JEUA 1U1CA 5KYXA 2RARA 1GRRA 2W2LA 4TM7A 2R5WA 4OJMX 1I51A 3CUUA 3L5OA 3P2YA 4MJ3A 4CT0A 4ECAA 1P4JA 2WINI 3AP3A 5JMWA 3KFVA 2IHBA 3Q3CA 3VAZA 3PZBA 5CDHA 4FSHA 1KU0A 1NBWB 7REQA 4XIGS 1YTLA 1WMFA 4PANA 1L7EA 4Q03A 4RBNA 1CTQA 4O8CA 5DK4A 1W581 4LI0A 2H07A 3K3PA 1KERA 3MTIA 3C1UA 3ZS8A 1RI5A 1CF4A 1L7PA 1XLTA 3M1IA 1ZZGA 3V4ZA 1LJLA 2J6BA 3EFBA 1Y9DA 1GN9A 2JI6A 1XJ5A 4M1WA 2JD2A 4NEGA 3JD2A 3UT6A 2W2XA 3ZW8A 4BQOA 1SQ0A 4XQCA 4XYLA 4DJTA 1V45E 2P8SA 3IKMB 3U4DA 2M9MA 3IYLW 4IGEA 3CWZA 1IIBA 1VI5A 3I05A 2JIRA 2SKEA 3KAPA 2AYYA 4P08A 5CT9A 3X2FA 1CSEE 1IDOA 1LW6E 1YJBA 5HCIA 2A0WA 3FGPA 4OOEA 3LUPA 4U5XA 4YRLA 4A16A 1I4DD 3AINA 4X8OA 1FFYA 4E15A 5JYBA 1BU8A 4OXXA 1LC0A 3IDFA 2GZMA 4F71A 1JN0A 3B8HA 2B25A 1JPNA 4BO2A 3DKVA 4FK8A 3FPLA 4X61A 1S0UA 3DVQX 3D59A 1EFHA 1FZTA 4JYCA 1IOZA 2BGIA 1JVSA 4MUHA 1QIMA 3JQGB 1T6NA 1NP6A 5G4LA 5HFNA 5BOVA 2HU2A 1YJXA 3SHVA 5C1PA 2ZVJA 3AW9A 3LG2A 4GR5A 4H6VA 4HXEB 4FYYA 3SSAA 2O8DB 1V6SA 2YH2A 1IHOA 2WJJA 3W6PA 2GEVA 3KU1A 3BB4A 4KE9A 4EW1A 1DPFA 1EQAA 1ADFA 1XK6A 2ZEJA 4FWTA 1N8KA 4F5EA 4MITA 2ZBEA 2G76A 1DT3A 1IBSA 3SXUB 3TZQA 5KTSA 3FTDA 4PV7A 2EFHB 4X24A 1RMQA 2IOFK 1EBUA 3E58A 3H1GA 3L40A 3NKVA 4XDYA 2NZUG 1QHGA 3NDPA 5KZMB 2D8AA 3MTGA 3FWYA 2DPYA 4LXHA 4QBIA 4KC0A 5DGCA 2GM9A 4JYPA 1EK0A 3ZTWA 3OU7A 4DNQA 3IHKA 1KI6B 3KUUA 4KQ1A 1MOQA 3D1JA 3LCRA 4FYPA 4EYGA 4CKZA 5AI8A 4W9RA 3K9FC 1XD8A 2G9QA 2XOKD 3DDCA 1GQYA 1TEVA 2J9FB 3BFJA 3E2MA 3QGMA 1M5RA 2Y93A 2P9QA 4A3SA 1M2EA 1I2AA 2Y05A 4RD0A 4WCFB 3H2KA 1NQVA 2RKOA 4IIXA 4IQFA 4TMFA 1TFUA 3LP8A 3CA8A 1JHAA 1SEPA 2ZB3A 5G0UA 3EXFA 3SJAA 1MRSA 4LJRA 2VQSA 3PX3A 4ZO6A 3CPSA 2H2IA 1KY5A 2O2JA 3OIYA 3P9SA 4H7PA 2XJ4A 3R9IA 1KEEA 4KODA 1QAQA 3BH7A 4DRXA 3HA7A 4G97A 3A25A 3ZWBA 4FGJA 2X1LA 5LP6B 3LSYA 2OV3A 1IHPA 3NBQA 3L01A 2PO7A 4BNKA 2YX1A 3LYLA 2O07A 3WGUA 3UBMA 1V4BA 4K2HA 4RNDB 1NHGA 3ASYA 4JBHA 2I9PA 4OREX 4F3KA 4D8TA 4Q1DA 2O20A 2GLUA 1HK7A 4PRYA 3NWPA 2ZIXA 1M8GA 2R7KA 2XNDD 1NT2A 4ND4A 5F1YA 2QYHA 3RM3A 3U49A 3BK7A 2P5YA 3UCXA 3EGOA 4I2NA 4QG3A 5K0SA 2IBSA 1P4GA 4MKGA 3HKEB 2FZGA 2REXB 3DWGA 1G7SA 1PAUA 1XTRA 4QICA 2VHTA 3TTUA 5A3JA 1FX0A 2H1VA 1YC5A 4BQFA 4W5OA 3P9IA 2C7QA 4C76A 3HCWA 3IKLA 4FUTA 2ZT8A 2PGXA 5KNCA 2HJWA 1Q12A 4TWIA 4MW5A 4KLZA 3LXXA 3L4EA 3EYWA 1T43A 3W8DA 2OEPA 1N8SA 5BWMA 2DPGA 5AXDA 3RVBA 5M7EA 4JLOA 2G1AA 2WTEA 3U7RA 3VYWA 2R1TA 2XXAA 1RC1A 4H6PA 1QHSA 2C2BA 1A2KC 4TMYA 1P1JA 3BSSA 4Z9YA 3NTRA 2V7XA 5EPUA 4NXMB 2PRZA 3E9ZA 5IBQA 3ZE9A 1Y7LA 2JIQA 1OLUB 4LRQA 4WY5A 1MX9A 2C9OA 4PN7A 3LXUX 4PLTA 2GEJA 4HDAA 4L8VA 5K0ZA 2QAGC 3L8YA 1UBGA 4QSMA 4CM4B 4URUR 1WCV1 5I7HA 2H16A 1U0BB 2QR3A 1LNSA 4CM5A 3DZ8A 4M60A 1X1BA 2V8OA 3AFOA 1DAEA 1TD1A 4E2ZA 2J67A 1U1FA 5IMSA 1QU2A 4MWCA 1YUMA 1GQQA 1SXJC 5BYJA 1WB4A 1E77A 2VDUE 3PKIA 5ILGA 2C2OA 1VXRA 1TF2A 1ETUA 2AG6A 3ZV4A 4KDRA 2O8BA 5K8UA 1H93A 5DF1A 2ODTX 4LYGA 1Z4LA 3AR2A 2DT8A 5CM9C 5FQOA 4FYMA 1AGXA 3SEAA 2PXAA 3GNSA 5IW8A 1YRHA 4QFCA 3O21A 5A7HA 4NENB 4QYTA 3ZJYA 2YWEA 1AKTA 5D1NA 1JXOA 4OYHA 3LP5A 5B36A 4OGLA 2ZRQA 4EIWA 3I4CA 3CLKA 1YK1A 2C54A 1SHTX 2B8WA 3PR2B 2YHIA 5A06A 5BSWA 2DUWA 3HDVA 4R1SA 3V34A 1CEQA 2QZJA 4PHCA 3ASUA 3K1AA 3RASA 3PHGA 4RFVA 1N4AA 1SK9A 1NONA 2OXEA 3RS0A 3SC6A 2CSXA 1KFJB 4QNRA 2ZB4A 2WIJA 4LXGA 3SWWA 4QARA 1CUSA 1PG5A 2CCGA 5AK6A 3X1DA 1PSWA 2AMYA 2YIVX 3OJWA 1I14A 3DEFA 1CY4A 1L7MA 1Q20A 3DD5A 3K0SA 3VAAA 4XUCA 1VPDA 1T2UA 3EG5A 4JC0A 1E7RA 3T54A 1WV1A 2NZVG 3PFIA 5I48A 3U4GA 1SIUA 2VDVE 2VKTA 3FLAA 3P0IA 5L4LA 2V3CC 3A1TA 4P35A 1S7GA 3DDHA 1VCHA 3BHJA 4YMTA 1NI5A 1IY8A 4QYIB 2VNJA 4Z51A 3E1GA 1DUVG 4CVNA 1H8ED 2AJBA 2OBMA 2PLWA 3V6LA 1JFSA 1EJ6A 3WL5A 1L8XA 1NW5A 1RI4A 4KMOA 4DLXA 4IF4A 3DGEC 3WYCA 2GNAA 1FP4B 4S3MA 4DMGA 1TM7E 4H1TA 3ZXIA 3F78A 4K9DA 1M6YA 2PZ8A 3HJFA 1G20A 3Q98A 1S3SA 1FTSA 3FGOA 4RMHA 1KBOA 3B48A 3PUYA 4JV5B 1GV1A 4FI3F 3RIYA 1VLMA 4GOLD 5FPPA 1CJMA 5CAEA 2O2EA 1K9SA 1HSZA 4ILEA 3PWKA 1MH1A 3E4DA 2IWRA 2X76A 3W78A 3SX2A 3NYWA 3AKZA 3GAAA 2VH5R 2UVQA 3KLNA 5FTMA 5JE8A 4CMAA 3FOEC 1THMA 4AY6A 1LXCA 1QLWA 4KOAA 2YW2A 1CS0B 2J3HA 2CDRA 4IUYA 4JZYA 1WW3A 1EP9A 1JQKA 1M7GA 3ABOB 5BQ5A 5EP3A 1EWVA 1CUWA 3ZDEA 3IMKA 3NHSA 4UTRA 1JQBA 5EZYB 3HXMA 2ZRNA 2BBOA 3QY0A 1C81A 2TMYA 5JI2E 4XVRA 4U9IS 1IM8A 4G36A 1KDYA 3WVNA 1E58A 5JQGA 5CVUA 3NWOA 1XN1A 2CYBA 2D59A 2GPBA 2OBFA 3FM9A 3EWSA 4C6TB 1Z2OX 2JH8A 2ODBA 1O08A 1GL6A 2ZIWB 3ESDA 1BMFA 3TX2A 3KQNA 4AKSA 5JD5A 5K0FA 3I4FA 3KWJA 3MAAC 2I5PO 1GN8A 4OYLA 4Q01A 1UC4B 2JGRA 3A1UA 5B4UA 4CU2A 3DXFA 1T3HA 1NR5A 3CY6A 4LIPD 3WICA 1AOXA 3HR7A 1T3TA 3K1TA 3H1TA 5K8IA 2JJ1D 4KN8A 4L0CA 3ZVNA 1OY1A 1NUTA 4D4JA 3ESBA 1V1JA 5E8JA 2LKDA 4ZT6A 4GE3A 3NRBA 4BVHA 1NXOA 2I3BA 4G1CA 1J1UA 1J8MF 2CLEB 1PWXA 1WIWA 3UKOA 1WU8A 4KAFA 2OZEA 4LXQA 2Z4RA 5IDQA 3DYVA 1BXGA 3H9BA 4JVNA 4YK7A 3KHKA 2H31A 4YP5A 3PUVA 4CKBB 3U3OA 4BQIA 4FEAA 2H0RA 2XZTA 1YZNA 1BFDA 3CYFA 4RKWA 3IPRA 4BIMA 1O9HA 2PH3A 1FQWA 2A78A 1G9XA 1Z5UA 1BQ3A 2FB9A 2VYVA 2Z8YM 3PD0A 3ET5A 4MB6A 4I8DA 4KHZA 4ZVLA 3TQCA 3V8VA 1ZXBA 1NLUA 1XPUA 3AL0C 4NOMA 3U3MA 1TGYA 2IYLD 2FQWA 4FR5A 3WNCA 4TXLA 1V5FA 3L9WA 1G9TA 1P3DA 5DHPA 3U62A 4OSOA 1CUUA 1E1CB 4N54A 2FP4A 1RMTA 1NXTA 3C5EA 3KUXA 3U0BA 2XR1A 1N7JA 2LE0A 3HVKA 4EW6A 4GMFA 1I10A 1TXGA 2HO4A 3GL9A 3KSUA 5CBKA 2C00A 4GYWA 3DPIA 1OWPA 4FZJA 4IZIA 4OIFA 3OICA 5ITSA 1ISMA 3P2KA 5D8DA 5I4BA 5KTNA 1AKWA 3FAKA 3GO4A 3K9GA 4LUCA 4TWBA 3RVSA 3J80A 1O94A 1ZMBA 2HMVA 4PYOA 1I3CA 1U0NA 2BKEA 5KQSA 3AY3A 4QXMA 1QRTA 5AVKA 4BLTA 1Q57A 4Q15A 1EYZA 2IUUA 1W1UA 1Y7IA 3JQBC 2PANA 3RU9A 5SZIA 3JWPA 1YJAA 3DS8A 4EYKA 4I6JA 4OF4A 2F43B 3WB2A 3VU1A 1WUYA 1P3Y1 1T13A 4RGYA 5IJWA 1UANA 3D8UA 5EYPA 2NUBA 4BB5A 4NH0A 3DF9A 3CN9A 3MVEA 3MWGA 4DLUA 3P0FA 3AUKA 3KOYA 1UOQA 1VYTA 5IYZF 5LCXA 3MQ4A 2P6RA 5DEIA 2Y67A 4EG6A 1SZDA 1VG8A 3ZXSA 4QTZA 3LYAA 5BN4A 4AJPA 2O5CA 4E08A 4M1KA 3SJCA 4DV7B 3VOTA 4YCSA 4KO8A 4B31A 4LJ4A 4GP6A 1N0VC 1H65A 1T5IA 3NUQA 3TZCA 1N2SA 3AIOA 1HKHA 4ZYZA 1EFAA 4RTQA 5E9AA 1VRCA 3NRCA 4CV3A 3G0IA 2OPHA 1JHXA 4YROA 2OQRA 3L8CA 3B1WA 3HCBA 4TS3A 5TXGA 3HZOA 1N0HA 1YSCA 4NMHA 2O8DA 1HA3A 1R0ZA 4KDFA 4ZEMA 1WD7A 5EINA 4U6QA 4ENVA 3WK4A 5C8YA 5FP0A 4RKRA 1FMFA 1HKUA 3MQ2A 4YQFA 2AW5A 4JI8B 3E9NA 3ICCA 4LC9A 1ODLA 1V35A 3LKZA 5JUWA 3FWNA 5JRJA 3NANA 2JZCA 1NM5A 8MHTA 4HX5A 4BFWA 2PD4A 4WX2B 1G21A 4QE3A 5CA0A 4KVAA 5JU6A 1VMDA 3F98A 2B2XA 3OIWA 3RIHA 4DXHA 4B3RB 1ADJA 1SURA 3FHJA 2CHGA 5F1KA 1F0YA 4N8DA 1S7CA 2OYRA 3WZMA 2WC1A 3PJGA 4O3FA 5CFRA 4OQQA 3AW8A 1SG9A 3ZHRA 1TKRA 1LNZA 1XYVA 1PFUA 3WQRA 3GN2A 3C6BA 1P73A 3D64A 3EGWA 4CLHA 4CR8A 1TCVA 2R1VA 4KAAA 3OY2A 1XF1A 1G5FA 2A0UA 4IBOA 3W9UA 2ZU0C 1HL3A 1U11A 4OHYA 3BORA 1GSOA 5LU9A 3KOMA 2ZYAA 2OYCA 4FW8A 5G1OA 3H0EA 3K6KA 4QASA 2G9ZA 4HDMA 3LP6A 3PQ7A 1J0XO 3OH8A 1F17A 3AYXB 6NULA 2BHLA 2EP5A 3P5BA 2Z6VA 3AFMA 3UJ7A 4MX8A 3PEWA 1SUPA 4TTIA 4DV0B 4EJ0A 1B8PA 5GADl 4DBLC 1ZR2A 1Q6YA 4FGZA 3DVRX 4AICA 1CZNA 5J4LA 1RJFA 1ZN2A 4I50A 1MO6A 5F7JA 3OIDA 4F6RA 5JDIC 4OFBA 5K0NA 2A33A 3DTVB 4JDPA 4RKQA 5DLQC 1U8CB 4ZANA 2BSXA 4DJDC 1HE8B 5KHOC 3KQTA 3MG9A 1SRQA 3SJZA 3COJA 1XZJA 3D2AA 3RSLA 4M1OA 3PXDA 2YFKA 4DWVA 3A6GA 1JQEA 4CMCA 3KSDO 1M6VB 4S35A 1U81A 3KQQA 4JP1A 1GFIA 3I52A 4LYHA 4BE4A 3T1HB 2PV7A 1Y7HA 4U7FA 1G66A 1V3UA 2H8KA 3W6UA 1DAPA 1L3BA 2EKPA 2JAOA 1IEQA 1C4XA 2YVKA 3W5VA 2IPNA 3S2YA 1YFKA 2R3SA 1MO2A 3BSFA 4YLEA 1QHFA 3G2JA 1AGNA 2AFVA 2K2WA 4ZO7A 4BBZA 3OQHA 1UC8A 4WK6A 2PGNA 4MW9A 4ENQA 4MV8A 3SN6A 5I01A 4RTNA 2A9QA 2CYAA 4IMRA 4O33A 3OQMA 1U8ZA 3GQVA 5CLHA 3WOHA 1GZHB 2EVWX 3JQFA 4F7DA 5SY9A 3S0JA 4CUJA 4ESOA 5JSFA 3L7DA 1Z33A 2BSQA 3OZFA 3U48A 5JXWA 3PFKA 2ABWA 1UZMA 2RHLA 3DAGA 3VTAA 2WG1A 2BM8A 3R0VA 2HRQA 4WK4B 3KSAC 2L18A 2WFMA 4YDHB 4WBNA 3GFSA 3Q6MA 5U4XA 4G0YA 1I7SB 2C7PA 3K94A 4JJ7A 1X0XA 3HA3A 2R00C 4EY7A 1PEDA 2R5FA 1VJRA 3R3HA 4O2AB 4QYXA 1QSGA 3UGJA 1K75A 5E38A 2BP7B 2D8MA 3HQ4O 3HS3A 3M3HA 1QIEA 1VPWA 2V45A 4TLDA 1EDDA 3GIDA 5AT1A 4EG0A 3NTQA 3O3NB 1ENOA 3IVCA 3KSMA 5BR1A 3K5IA 3E9CA 4BP8A 2GZDA 2JGMA 4HRXA 1VIYA 4BCBA 2W2KA 4ATNA 2ZTUA 3R8FA 4AW9A 3VU3A 2NLOA 3AI2A 3C3AA 3FY4A 1MOZA 1QJCA 1H6AA 4Q24A 3WK7A 3GLVA 3L0CA 2XQFA 1YQUA 1OA1A 2Z8YA 4AZSA 1RTKA 3DQZA 1QZZA 1HBJA 1NSTA 2A5LA 5I7FA 5LQMA 4M4SA 4MVJF 1VCOA 3EMKA 3OECA 3WOVA 3U40A 3PD7A 5KDDA 3CLTD 3WGLA 5EHGA 5BMVB 1J0DA 4MR8B 2HQSA 4UBIA 1ECCA 4KDCA 3GVHA 2OCKA 2Q50A 1E7QA 5TQJA 3WGKA 2YJNA 2O19A 2QW8A 1GCUA 1RYDA 5C53B 4DB4A 4WZAE 4ZZ1A 3F4KA 4ZVSA 4MAMA 1NWHA 2CFOA 4P38A 1GAEO 5ARCA 2YINC 3JD3A 4MQFB 2QOEA 3DAFA 3TLKA 2HA3A 3I58A 4DQVA 5JPDA 1HOXA 5A5DA 1E5QA 3DMDA 5T6BA 4QELA 4A5OA 1YVPA 1X87A 4ZVPA 1N25A 3KTFA 4CCYB 2RGRA 5FTJA 1JFRA 1F38A 1GRVA 5TV2A 2RGNA 1DBPA 4RSHA 4F2DA 5IABA 4IOLA 1M7BA 3CX4A 3GPCA 4F6CA 2HW8A 4CWAA 1EXVA 3ZU6A 4LBYA 4KVGA 2D2VA 1C9DB 2PH1A 1ZHHA 2DSNA 3HYNA 4FUQA 3K5PA 1WXWA 2EC5A 1WV0A 1KC3A 3GRCA 3OC6A 3GT0A 2RGAA 4HHEA 3QY9A 4WZBA 4WASA 2NUTB 1CLEA 4HGYA 4HT3B 1H4VB 4PHHA 4XYGA 4GPIB 3D2BA 4DG9A 5CDFE 1OI3A 2ZBPA 3P9CA 2GXAA 5JVDA 2XEDA 2GPSA 4Q9JA 1JL3A 1I36A 2VJDA 3BMQA 3KVOA 4YAOA 1W5TA 1PDVA 2WOOA 1EE9A 2GDJA 4XJXA 4PQRA 1WZEA 1KI2A 4ZT3A 5KSOA 4F3NA 1J39A 1UC9A 3I9V1 2BEUB 2H06A 3GFQA 5K3EA 4YJ2A 1T0BA 4LOHA 3EVEA 4OAPA 1NG9A 3HJCA 2I78A 4MWTA 1M6HA 1O0CA 1K89A 2BEJA 3DDUA 3EASA 3T7SA 3OHSX 4R40A 4JYMA 1RPNA 4NEQA 2NAPA 1HRKA 4KTTE 4MROA 4OQPA 5COAA 1RAGA 1VB3A 5I7AA 3UJHA 5JS6A 4YJDA 1ZL0A 3SICE 1PYOA 4N47A 1Q0PA 1UK6A 2QGFA 1CG6A 2DBQA 4JB0A 4HQ0A 3BXEA 3DL4A 2NO6A 4BKUA 3IA2A 3E7XA 3MD9A 3MW8A 4JUCA 1DAMA 1O4WA 4FCTA 4OI4A 4D3YA 5GZ3A 4UBMA 4MMXB 4OSPA 1UM9A 1QYXA 4D9FA 1ATIA 2QNIA 4XDGA 4DLYA 2Z2XA 1SXIA 2F17A 4AROA 1FUYB 3HU1A 3WRWA 2OZVA 5AJVB 3GVCA 5JNWA 3GHHA 4TLAA 2D3TA 3DPUA 5CNMA 2HN9A 3AZOA 3OE1A 2Q2NA 1DXOA 1ZYUA 2XTZA 4O2AF 1H5UA 2O52A 1Z06A 3QUCA 2Q0QA 4OM8A 4A8JC 1FFBA 4L7VA 1Y98A 2Q5CA 4X6UA 2G28A 1ZH4A 4EHHA 4G0ZA 1AO0A 2QL9A 4YVFA 5ELXA 1WNFA 2JH9A 5JFGA 4S0XA 4UUPA 4YJ3F 2V0CA 3L4KA 5C80A 1F2UA 2H9AA 1CQIB 3DEYX 5FWYA 4UHJA 3BE8A 1N3YA 2AEEA 2AZMA 2H7VA 4LOIA 4YS6A 4B09A 2DTDA 3V7UA 2CBGA 1WXXA 3OESA 2G9RA 4WZAA 5THQA 4GOXA 3DJYA 4DLNA 4MUBA 3FA2A 2CFRA 3GDFA 2Q3FA 3DLTA 3O8BA 2GN1A 4KNWA 4C4XA 5AVUA 5K09A 5JTTA 3FMFA 5DTRA 3VMFA 1J21A 1FDIA 4TRMA 3MIIA 4UU1A 5D7BA 1Z6GA 3BMXA 2ZUFA 1IBKB 1U0FA 5KYVA 2C2KA 3U4CA 1XRRA 2WILA 2ZUTA 5DGDA 2JBAB 4MUMA 3TINA 2ZPAA 3BFXA 1GU1A 4FSDA 3RV3A 1UCFA 2JFZA 4MQMA 1Z18A 3PTLA 1GNTA 3E61A 4XTRA 1ZK2A 4JNKA 5DGTA 1DI0A 2XT6A 2WWTA 1NDQA 3E82A 1J33A 1IMOA 1JJIA 1LLUA 3HKDA 3MEQA 1NLZA 4PQYA 4RA6B 4HUQA 3SPXA 4OB6A 4ARBA 4S04A 5G4KA 2Q1WA 4RF3A 3AFNA 3URKA 1LK0A 4UOEA 1Y6QA 4N18A 4DV1B 3WFZA 2HJSA 2R6GA 2J7PD 3E18A 1HT0A 5JQGF 2FPIB 3CT6A 2ZYTX 2I99A 4OHOA 3UHOA 4DSNA 2IE8A 2DX7A 4BRSA 2OXIA 3VR3A 2AEFA 3ZXUB 1K86A 1SUBA 2EGUA 1L7BA 1T1SA 3VXKA 4LPKA 2ID9A 2P6UA 4MRSA 1MJ5A 4YP9A 4BASA 4DQXA 1VG1A 2MYTA 2EU8A 3H8WA 1UEIA 4ZGGA 3EFEA 1ZMTA 3KWLA 4LGCA 1P0FA 2NUAA 4LJYA 4PPGA 1TU3A 5KINB 3GPBA 3SI7A 5FNVB 1IBRA 3H5OA 4KKVA 5KBYA 4J0EA 5CLFA 2OBXA 4OU5A 4LN1A 3DONA 4YMUA 1M2GA 3GNTA 1ZD2P 2OP0A 4M22A 1ULAA 5HCUA 3RADC 3KJQA 4KSYA 2B8NA 3HWX1 4JLAA 1T8TA 4A0GA 3QMMA 4PYLA 2Z98A 4TV9F 3KZ1E 4PBTA 2A5DA 4MR7B 4JROA 5CVEA 1XKQA 3A2NA 3I01M 1I24A 1WLSA 4CRWB 4BNGA 1DBIA 2WWHA 1DKMA 4C0JA 1GTG1 1FVHA 2JFBA 3PC7A 2H2HA 1OBFO 3B2QA 1AXRA 1R8JA 2FEMA 5DWVA 2W6NA 1I7QB 3GGSA 4B3BA 1LSUA 3V1UA 1MC4A 4C2UA 1G63A 3C15C 1OT3A 5HUHA 4HY3A 4MVJP 5GIPE 1GLNA 1F4VA 4YRTA 3EC1A 5KS2A 3GRRA 1O6CA 2CUKA 4R6WA 3GAZA 5HF9A 3CS3A 5KTTA 1W0CA 1YIOA 5BMVA 1TEZA 1LBTA 4KSBA 2FUG6 3NBUA 1FJGB 3F9RA 5EIHA 1I3OA 4TWJA 4NDAA 2CK3D 2ZANA 3AEUA 3L4BC 3LLSA 3PV0A 2V7PA 1FQJA 1AQNA 2CVFA 1A8UA 1J07A 4G8CA 1W4CA 2EFYA 1BH6A 4KU4A 4UEKA 4QQNA 2PGLA 3ZE2B 2BFDB 4Q1BA 2RE8A 5IYZB 2FLVA 5AI5A 4FDVA 4Z3OA 2WFAA 5CD1A 2DPMA 5J4YA 5TS3A 2BBSA 4YCAA 3QNWA 2W2LD 3X0DA 4C3UA 2O2YA 2OGSA 3GLUA 4OFXA 5GJVC 1DRVA 2NVUA 4C29A 3ICQB 2P40A 2Q4TA 3G2NA 5U4QA 5FJIA 3RRYA 2PVCA 2OUIA 2FMHA 1X8LA 3EBOA 1M8PA 4HBGA 1HDCA 1TMYA 1KK2A 3KX2A 3GLFE 1E5DA 1IY0A 4YV7A 1KFCB 3KQUA 2WWYA 4L4SA 1JLSA 5DLEA 5E2IA 3TBKA 1HE5A 4Q4HA 3P2EA 1J8FA 1THGA 2X0IA 4CODB 3BPSA 3TSWA 4DJEC 3TNDA 3CNLA 3V3KA 1OAOC 3HVRA 1IMJA 3DL2A 1HE3A 4NZYA 4A27A 1Z39A 1U1GA 5JTUA 4N48A 5EC8A 2O48X 3B6ZA 1QAMA 3GGCA 5KWEA 3SBEA 3FOBA 3NASA 4OYRA 1UJBA 3SAJA 4PU0A 2M1XA 4WZ6A 3EVZA 2G0NA 4LJ6A 4UXJA 4DE5A 5K5EA 4GLOA 2MMCA 3H65A 4LJLA 1U0LA 1IZ8A 3EUWA 2ZWIA 1SU7A 5KAMA 4R1PA 4AZ0A 3R6LA 1JH9A 2WF5A 1UKBA 2P6NA 3GGJA 4QDJA 3KXLA 3C4JA 3EIWA 1E2NA 5BV7A 2VK2A 4YLGA 3PNMA 3R0QA 2JI9A 2AYZA 3C3CA 4BEJA 2C1EA 1M6VA 2HYDA 1CJKC 4O4JA 2RIPA 2GASA 1GRCA 4JHXA 3LF1A 4QBGB 2VLBA 1CUHA 3WQQA 2H1LA 2PZLA 1KVUA 5HXAA 4Z7OB 5LQDA 3Q85A 4XGKA 1LNQA 4E46A 3TAUA 1ZUD1 2ZJ4A 1KEWA 3JVVA 3OZTA 5ULLA 4F56A 3KD3A 5MDHA 3BRWA 4TWZA 4EARA 1CIJA 1RPTA 2QUZA 3KD2A 4X63A 5B7GA 5IC4A 3CIFA 3LA6A 1ZGJA 3EAGA 1KVTA 3IPYA 3AJEA 2QSUA 5DULA 1RXSA 3BMNB 3IUEA 4XSVA 3ZW7A 4M0FA 4G26A 1PT5A 4DMUB 5LZ9A 3IQHX 3TLGB 5F2EA 3V9PA 1SC9A 3D5TA 2IY8A 1G55A 4IFBA 3IEVA 1VECA 5J2UA 3ONNA 4FZVA 5ICCA 4A2QA 1WMBA 3WZ2A 1UAYA 1W5FA 1GZ3A 3DXYA 3JWGA 4Q48A 4EHNA 1CUBA 1NIPA 1TECE 4IIDA 3NBMA 4IDCA 2CWWA 2FEKA 1R6VA 1P80A 3OPYB 4HH3C 4PNHA 1F4LA 4U7HA 2OQ2A 4J9VA 1QS0A 2BEWB 4OM7A 4AJLA