3O4RA

Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase/reductase SDR family member 4
publication title Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 86
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o4rA00
1XLTA 3E03A 5F1PA 2DUWA 2I67A 1E7YA 4OL9A 3PLRA 3R0IA 1NNUA 3RC9A 4E13A 1XCBA 4GLLA 1WVGA 2CVQA 4PG4A 4JK3A 4FFRA 5G4KA 1S6YA 1DJNA 3WGGA 5CDUA 3TN7A 1P9LA 9LDBA 3I6QA 4O5OA 4RVFA 4NI5A 5LC1A 1DLJA 4II2A 1C0LA 5JPIA 3WNVA 5A5EA 5DN9A 5JNLA 3I9MA 1MV8A 1JDJA 4BO6A 3TL3A 4CQMB 3KLPX 4A27A 1UAYA 1OFGA 3QWAA 4JLWA 3RU7A 1ZK4A 2O48X 4E5MA 2EW2A 3HN2A 5TGDA 1W0CA 3JQGB 3WFIA 4KZPA 4J4TA 1NVMB 5GZ3A 2JFFA 4NBRA 3GG2A 4I5FA 2AEMA 3K96A 1P3DA 1R12A 5I9MA 5BSEA 3E48A 1JAXA 3PYXA 3WIEA 3OQBA 2W2LD 3C1OA 3DWFA 5CHEA 2FR1A 2NTVA 4IDGA 3DONA 2ZYDA 4EUEA 1LTHR 1VJ1A 3VH3A 2RHCA 1PL8A 2D5AA 2V7PA 4GL4A 1LSOA 3H2ZA 4IQGA 5IN5A 4XB1A 1XG5A 3H2SA 2C0CA 3ICCA 4OXYA 5GZ6A 1MG5A 5ILGA 4C7KA 2XOXA 1E1KA 3PWZA 4CQMD 1JN0A 1AXEA 4DBZA 3JQ6A 2W98A 3OICA 1YRLA 1PQWA 1C1DA 3PXXA 4I8XA 4BKUA 1Q0HA 4HFNA 3KYDB 3LC1O 3QP9A 4AJ2A 1FDTA 3AU9A 4IS3A 2DU8A 4RPKA 3IP1A 3E5RA 3AWDA 3FNGA 3ROQA 2W2LA 4WLEA 3RUFA 3WB9A 1JU9A 1YWGO 4DLLA 3DZBA 4BMVA 5FI5A 3IMFA 1CERA 1V3UA 4ALNA 1HYEA 2F00A 3GZ4A 3PLNA 2PLAA 3B20A 2EXXA 2FN7A 1Q1NA 3B1JA 5JDIC 1QV7A 4QFCA 3LT4A 1RYEA 4U0JA 4MVJF 4D0SA 4RPGA 1NP3A 1IULA 4L76A 4PLZA 4BNVA 2J8ZA 3JQ7A 4FFOA 4JBGA 1BDMA 4MP6A 4UUOA 1DBVO 3VHRA 4B7UA 4E2WA 1RJWA 3K73O 4R69A 3HE3A 2VOJA 5JAIA 2GR9A 2B0JA 1ISHA 1E92A 2HMTA 4BUCA 3AI3A 2W2KB 1GYPA 2PH3A 1U2GA 5I8ZA 4UREA 3MJVA 3C7DB 4II3A 3HWRA 4J2OA 4ZRNA 4B3IA 3IS3A 2ZB4A 5JAQA 1QLHA 3BZUA 1XU7A 1O5IA 2WEKA 4CV0A 3GDGA 5JDIA 3BAZA 4JROA 4IY1A 1DIGA 3HFGA 4A10A 3OA0A 2PKRA 1DB3A 1P0FA 3OETA 4XX0A 2X1HA 1HZZA 3KSUA 2ZIZA 4F6CA 1N1GA 3PK0A 3SJ7A 3WYCA 4UVHA 3E82A 4XYGA 1X7HA 5BQFA 1P1HA 4UEOA 1QYXA 4CLOA 1WNTA 1WZEA 2VUUA 3RKUA 1N92A 1E77A 1ZXBA 3D64A 1PS8A 1TLTA 1UXGA 4TSKA 1VRWA 4ZICA 3K9QO 4MVJH 3U0BA 4HX5A 1R0LA 4XGKA 4CM6A 3UCEA 1X0XA 1VC2A 3ETGA 1FF9A 1WWKA 3RC2A 3JQ9C 1N8KA 3K31A 3DL2A 1V3TA 5IDQA 2JCXA 1EUCA 3BTOA 2X5KO 1VLLA 3GZNB 5A9RA 3UUWA 1IZ9A 3OJLA 2ZTMA 4YJGB 4E12A 1CDOA 1VJTA 3MWDB 3AFMA 2HRBA 1PGPA 3FBTA 3VKUA 3GG9A 4G81A 2E6UX 4UAGA 4AL4A 1Y8RA 2TMGA 1G6KA 2ZB8A 1D4FA 1SOWA 3G0OA 1NAIA 4R68A 5L7YA 2YW9A 2NVUA 2VTEA 1GEEA 2PD4A 5L4SA 1U4SA 5IDXA 2POQX 5AXDA 1VE9A 2VRCA 3RAJA 1E3LA 1M2WA 2QZ9A 3I5MA 1AXGA 4OYRA 1I3KA 4PCVA 2ZKLA 1RM3A 2CDCA 4FB5A 4A7PA 1LU9A 4XDZA 1Q7BA 4D42A 4Q39A 1KEWA 3RFXA 4EGFA 3ZU4A 5L40A 4E31A 4HFJA 3KEOA 2BF7A 3H3JA 2GZ2A 1Y7TA 3WX0A 2IEDA 3FN4A 3PQEA 3FHLA 1D1TA 1LA2A 2B36A 3D4OA 1JKIA 3INTA 4GSKA 3AOEA 2NVUB 1IE3A 3OJEA 4K9DA 4RQUA 3D7LA 2YHIB 3GHHA 4MVJP 4OKNA 2C82A 3GA0A 4OQZA 3ZU2A 5DDIP 4EITA 5DCYA 3ZWWA 5A3JA 3BMOB 2HO5A 3TZKA 1EEHA 3DOCA 4Q3DA 4XWYA 2DFVA 1I3LA 2QYTA 3RUCA 1HSOA 4D46A 4CV2A 3AUTA 3JV7A 3GGPA 4CODB 4J7XA 3DZFA 2X6TA 1JWAB 1E7WA 2VWQA 2AHRA 4I9HA 1AN9A 1NFRA 1HDYA 1AHHA 2JD1A 4KQXA 4X54A 5KTKA 3KXDA 3QQPA 3ZWNA 2AQHA 3A28A 4CLRB 3RBZA 3K92A 4CMIB 2ZTVA 3GGOA 3H3FA 1LXCA 2AXQA 3OMLA 1C14A 4BKRA 3NJ8A 4M54A 2HDHA 3WBBA 3NKLA 1D3AA 1QYDA 3EDMA 3PHHA 3ASUA 3PJEA 1BVRA 1PZFA 2J5KA 3RUHA 2P2SA 1AGNA 1MX3A 3TSCA 1ARZA 3NTRA 4BO7A 1P1FA 3NUGA 2DVMA 2A94A 4FC6A 5JY1A 1A7AA 1ZMOA 2IZ1A 1CQIA 3L4SO 3ZZNA 4BQPA 2ZJ0A 3CXRA 3DBLA 4XGNA 2YJZA 1LJ8A 1Y9EA 3PYLA 1DO8A 1QKIA 2A9FA 3FR7A 4J0EA 4B79A 4CUZA 4Z0HO 2VZ0A 3O8QA 1PR3A 2EF1A 3Q6IA 1DIHA 4LVUA 3ZV5A 2NU7A 2GZ1A 3FBGA 5BR7A 3CZMA 1O89A 2P9CA 1UR5A 2E82A 3DHYA 3I23A 4MJLA 2P4HX 4UEJA 1JVSA 3LSYA 3PEFA 1UP4A 4NNJA 3D3WB 1NR7A 4XD2A 1RKXA 3PVZA 2VHVA 5DBGA 4J2HA 5F5LA 4XJSA 3SLGA 1KEUA 5BNTA 4RL6A 1P1IA 3AOGA 4B7CA 3GY0A 3D5QA 1PJ2A 1GL3A 3IJRA 4PLYA 4Q9NA 4HV4A 5JDCA 4TRRA 5H83A 4AJEA 5KJ1A 4OQYA 2C5AA 5TIIA 3EAGA 4BB5A 1BWSA 1C0KA 3FSRA 3GH3A 4XDYA 3EMKA 2R2GA 4RLHA 2J3IA 4HFMA 3O26A 1KEPA 4XEHA 1ENOA 4L9RA 3C1AA 4U0KA 4ROSA 1IOLA 5JMPA 4NBWA 3TZCA 3TJRA 1U4OA 3DZJA 3ONEA 1BXGA 9LDTA 2P4QA 4CMEC 4ZQGA 4WLNA 4QFDA 4GX5A 4FQ8A 1WDMA 1JKJA 3MOIA 3LT1A 1BDBA 4D0RA 5A06A 3LZ6A 1EVYA 1SPXA 2EKPA 2B4QA 1PGNA 4A03A 2IDZA 3KYCA 5A9TA 4IIUA 3EW7A 4Y6SA 3RD5A 2EHDA 3JSAA 3GVPA 5AVOA 1PJTA 3ENKA 1HLDA 4PG6A 1HKUA 4YT4A 4CMKA 4IMPA 3V8BA 2AMFA 2XPCA 1K6IA 3ROPA 8LDHA 2G17A 4XR9A 2YQ4A 4A5OA 1ZNQO 1NXQA 3K2BA 4DREA 1P0CA 1SNYA 3E9NA 4BNFA 3MEQA 4CMEA 4M87A 3HSKA 3DZHA 4CMCA 3IP3A 2SCUA 1LDYA 1YOVB 3K2EA 4JJIA 4YDRA 5KJCA 3R1IA 4RF5A 2JCVA 3OIDA 1O8CA 3AFNA 4BKPA 4YT2A 1TEHA 1N5DA 6LDHA 4N18A 2ZTLA 2Q1UA 4KMSA 2EV9A 1OC2A 4RF2A 5IN4A 2HCTA 2B69A 2JAPA 4CQLB 4H3VA 2JKVA 4JGBA 1U7HA 5A3VA 3ZV3A 1VSUA 3FWNA 3JYPA 4YBZA 3WGQA 2VNSA 1H2HA 3FD8A 2GCGA 3H7AA 3BMNB 2HAEA 4BKOA 5L51A 5IG2A 5JCXA 3ASVA 4Z3DA 3OF2A 4DBVO 3VC7A 3HQ4O 5TT0A 2AG5A 4P4NA 1YQDA 1B3RA 1OZAA 2CFCA 3AM4A 2RAFA 4LVCA 1FXSA 5JAZA 1T1SA 5KVQA 3ONDA 4A2CA 5A9SA 3W4IA 2V6MA 2PR2A 4TVBA 4FDAA 5LDHA 1YL7A 3FNEA 3GDOA 4KDEA 2Q4BA 4RVHA 5KWEA 2A92A 4GLOA 4NIMA 1EE9A 2CD9A 1EQ2A 2HU2A 1E3WA 3PPIA 3DTTA 1DRVA 1DJQA 1E6WA 1I3MA 3LLVA 4IDDA 2W8ZA 2AG8A 4Q3EA 4A0SA 1BTOA 2PZMA 1EFLA 2GNAA 5L45A 3JQDA 3GRPA 4YRBA 2O3RA 3UW3A 1HXHA 1X0VA 1MA0A 2NUAA 1F12A 4GAEA 4HFRA 1H0KA 2QRKA 1OOEA 1BGVA 3PHGA 5CAEA 1D8AA 1CYDA 5EL0A 5IFLA 2GF2A 1SZJG 1DFGA 1WZIA 2Q2WA 3AY6A 1J0XO 1AHIA 3HN7A 3D0OA 1PQPA 1UJMA 4KP7A 1LUAA 3B1KA 4GGOA 4YA6A 3U4CA 4URFA 1ORRA 4RVSA 7ADHA 5JO9A 3E9MA 4UEKA 4DPLA 5ENVA 1I32A 4XRRA 3V2HA 5DP2A 1EVIA 5FI3A 3JQAB 3U4IA 1I30A 3CEAA 4P22A 3JQ7B 3GN1A 4J1SA 1I10A 2AEJA 1W73A 2QRJA 3RC1A 1DIRA 1EQUA 4BNHA 2EP5A 1L7DA 2Z1NA 4J90A 1UXHA 4ND5A 3CZRA 1PS9A 4RLSA 3ZV6A 2QG4A 1B7GO 3VH1A 3LVFO 2I3GA 4E5PA 2BMAA 2P91A 5C7OO 5F1KA 3OECA 1QR6A 2I3AA 1FK8A 3KVOA 4R3WA 4WASA 4CM5A 3QW2A 2VWGA 1YXMA 2P5UA 4I5GA 4RQTA 2C7VA 3WWZA 1EVJA 3C24A 3G3EA 1IZ0A 3ZN2A 2EW8A 4GPD1 4TRMA 3UGKA 3HADA 3VVCA 4P8RA 1HE4A 3U5TA 4OSPA 1F0YA 2Q4EA 5JY6A 4GQAA 3ZWYA 1VSVA 2BI8A 5J23A 3DQPA 1Y81A 1Z45A 1ZH8A 1KBZA 3F46A 1MXFA 1LSUA 4YQYA 1FDSA 4KUEA 3V1UA 3HG7A 1VL0A 1H6AA 2Y1CA 3E9QA 4YAIA 3NDRA 4NG5A 2DTDA 5KKAA 4RDHA 5A5FA 2D3TA 3FPCA 4XQEA 1H2BA 1GV1A 1GZ4A 1ZEJA 2BD0A 3MJCA 1PJ4A 1Z75A 4U8GA 4OOFA 3C1TA 3PI7A 4LMPA 2DPHA 3VAZA 3LT0A 2HMUA 2FPPA 5TJ9A 4BO8A 3GMSA 1V6AA 1E3SA 3GGGA 3H5AA 2IZZA 4NBTA 4G2NA 4Y6RA 1X1EA 2BLLA 5LCXA 3FNFA 4P4LA 1GR0A 3TZ6A 4BNXA 2W90A 2C2XA 3PGJA 1GQ2A 4NQZA 5EINA 1CQJA 3OJOA 1GZ3A 4U6QA 4EJ0A 5ILOA 5CDGA 4QECA 2YV2A 2PKQO 2Z1MA 3RC7A 4DVJA 2HJRA 2ZYGA 4IXWA 3H4VA 3DBHA 4KTTE 1GUFA 3GUCA 5F5NA 1AE1A 4EJ6A 1Y6JA 2VRBA 2RHRA 3W8DA 1JKFA 3JD4A 3WGTA 2JD2A 4AJJA 3DMTC 2IODA 3B1FA 2GN9A 1ULUA 3UICA 3UAGA 3ZDFA 1EZ4A 1LRJA 1E1MA 2Y1DA 1KVUA 4CM8B 1VJ0A 3AUSA 1K6JA 1UDBA 3ZHZA 1ONPA 3BTUA 3C3XA 3I9NA 4J7CA 4W99A 4E6PA 3PJGA 1YDEA 2IYPA 2YZ7A 3IL2A 5BNIA 1X15A 4JP3A 2VOEA 3NYWA 2I6TA 3WWYA 1FDVA 3IUPA 2Y0DA 2Q50A 3BMOA 4LK3A 2PGJA 1YE3A 2Q1TA 2OUIA 3RFTA 4WCFA 3FRJA 4B4WA 3ONFA 4UUMA 4CM7A 2GYYA 2VZ8A 1GUZA 1DDOA 4KTVE 7MDHA 3KHUA 2EKLA 1NBOA 2I65A 1Z7BA 2H1SA 2JAHA 4TMFA 4JIGA 3MWEB 1KEVA 3EVTA 1XEAA 4WE3A 3VZPA 1GTMA 3ANMA 1ENYA 3NT2A 4CMIA 3EGOA 5K6AC 4JJFA 1GADO 4Z0TA 2R00A 1SAYA 3L4BA 5I9LA 3ABIA 1GCUA 3G1TA 1VPDA 4MP8A 4E0BA 4ZQEA 3KRTA 1PL6A 3ZWBA 1U7TA 4M1QA 1E3EA 1SCUA 2C5EA 2WDZA 2YV1A 1HE5A 1P74A 4FFMA 4EZBA 3P7MA 1PR9A 1CJCA 4UVGA 1ZJZA 4I9NA 3L9XA 4L0QA 2PZLA 2IEBA 3OJFA 3QIVA 3VZSA 3TF5A 3V5NA 4TVOA 5ITVA 1E6UA 1HSZA 4Z6KA 3FCOA 3SVTA 1J49A 3QVXA 2C59A 3MJEA 3JD3A 2I5PO 4AICA 2RH4A 3NGXA 1DXYA 2NVBA 1R0KA 3KYDA 1UDCA 4L4SA 4MDHA 3GF4A 4KWIA 4W9NC 3RASA 3GPDG 4RJTA 1A9ZA 4JBIA 3DBRA 4BNYA 3GR6A 3MZ0A 5FF9A 3VOSA 1B8VA 3WGOA 1BG6A 3MJTA 3GZNA 3IUSA 3QWBA 5A1TA 3DZGA 3MTGA 3ON5A 4HNHA 2VT2A 3GNTA 3AUAA 3N58A 4B4OA 2IE0A 5EERA 4QEDA 4ZJUA 4DUPA 1LLDA 4OIMA 5IZ4A 5JYDA 1Z6ZA 2DT5A 2Y93A 1PSDA 1I5RA 2WE7A 1BXGB 3WGZA 1ADCA 4ZRMA 5DBFA 5DF1A 3ZWMA 3IIEA 3I9OA 4XYBA 2J3HA 1LI4A 4RVGA 4F46A 1UP7A 4P4GA 5KKCA 4XRGA 2NWQA 3TZQA 4IZHA 3U3XA 4TKMA 2P5YA 1XWFA 4NBVA 2ZQZA 1PJBA 2CMDA 5EESA 4GGPA 1WPQA 1UXJA 1MXHA 2A4KA 4R54A 1LRLA 2O2SA 4ND1A 3T7EA 5BSFA 1G0NA 1IHYA 1XR3A 3BMCB 3RIHA 1ISJA 3FTPA 5C7IO 3DMYA 3NV9A 1H6BA 4WECA 3RUEA 3DFUA 5DP1A 4NR0A 3UXYA 4N54A 3TL2A 1BHSA 1GQQA 2AEFA 5JO0A 1E1LA 4CM3A 4ALMA 3PYMA 4DYDA 1O0SA 4IGEA 3UCXA 3DR3A 2JFGA 5TNXA 4GH5A 2RH8A 4RF3A 4DWVA 1X13A 3QWHA 2O3JA 1NPTO 1EK6A 1U5CA 1BXKA 4WNCA 3WJAA 4BV8A 5JMWA 4M89A 1U3WA 2GZ3A 3BTSA 1SB8A 2VYND 4CMBA 4W9NA 2O3QA 2O7SA 3OA2A 4BB6A 1ZK2A 1GPJA 3KV3O 4WUVA 3UVEA 2D4AA 4QQRA 5T67A 4U5QA 1TI7A 3S2GA 4XCVA 4DPKA 4TKLA 1RWBA 3L77A 2Y1GA 3EK2A 1ZSYA 4Q3NA 1HRDA 3HZZA 4IDCA 4BKQA 3DBVO 1P31A 4AJ4A 1EUZA 1ZVMA 1BSVA 1DIAA 3ZU3A 3A9WA 4W6ZA 5JC8A 4AJLA 1KC3A 4FW8A 4XQ9A 6ADHA 5KVCA 4TZTA 1XQ1A 2V6FA 1H9BA 1RM5A 2VUTA 3NX4A 3DAFA 3JD1A 4LN1A 2UAGA 3Q2KA 4BHTA 4TROA 1J5PA 4QO8A 4WEQA 1DAPA 5CDSA 4NZ9A 1MFPA 2EJVA 2NVWA 3OM9A 1C1XA 1K3TA 3HUDA 2DBZA 2FOIA 5COQA 1YBMA 1DFIA 4JXKA 4C7JA 4PFJA 1WP4A 1ZKMA 4ALJA 4BNGA 3M1AA 3JD0A 3PTZA 1ZZEA 2R6JA 3DBLB 3DMTA 1U2DA 4OH1A 5BSHA 1NQ5A 4CMGA 1ZO8A 2FR0A 4BO0A 4WGGA 2CNBA 4UUNA 4YPOA 4IZIA 3LF1A 3FI9A 4LW8A 2JCYA 1KIFA 3MCVA 5B4TA 4EJMA 3B6ZA 2Y1OA 3P2YA 5TLSA 3DTYA 1LQUA 2I99A 3ZNOA 2UUOA 3KLMX 2HK8A 3A06A 4CMJA 1QYCA 5CEEA 3OJ0A 1ZK1A 1LDBA 4NHEA 1U3VA 5EIOA 4YVFA 1JW9B 1PJCA 4PLTA 2NNLD 4O1MA 3H9UA 4NJMB 3OIFA 2OP1A 4GVLA 4ZU3A 1VI2A 3QJ5A 3PWKA 3FWZA 5C5IA 2H5LA 5B4VA 1Q7CA 2QIOA 2DLDA 3S8MA 3LYLA 4FS3A 4R9SA 3N74A 4DA9A 4NMHA 1LDNA 4Y6PA 3JYQA 4R1UA 4YTEA 3EZLA 3Q9NA 4MIEA 1XQ6A 4MO2A 2X0JA 2NM0A 3GK3A 3ZWAA 3JQEA 4MKRA 4QX6A 4R5HA 1ZBQA 4R1TA 5IF3A 1T2FA 3D5TA 3GAFA 1PEDA 4BVAA 3F5SA 2J6IA 4PRLA 3TDKA 2CVZA 1DC3A 4I1IA 4HBGA 5H82A 3ZW9A 5I7FA 4J43A 1Y9AA 3V1YA 3O8QB 4Z9YA 1PWZA 1E7SA 2UUPA 3PFFA 4H15A 4IIVA 1MC4A 1YO6A 2CSUA 4UVIA 2NTNA 1QLJA 1WW8A 3CE6A 4Y67A 4CJXA 2VYVD 1C3VA 3P2OA 4B7XA 3T7CA 5T64A 4LMRA 1VL8A 1NVGA 1ULSA 3D3WA 3L07A 1UXIA 4CR6A 3O4RA 2D59A 4IJVA 3ZGYA 1YS4A 4IDBA 1LLQA 2C29D 1Q7GA 2RBEA 5EJ2A 4RORA 3GT0A 3WTCA 5L4NA 1GFSA 1NPDA 1O95A 3H6KA 1ONOA 1ZMTA 1YGYA 1LDGA 1ZSNA 3F4BA 3M2PA 2DQ4A 3BHIA 5TJHA 2WE8A 1CF2O 1I33A 4W7IA 2ZQYA 2AE2A 3WMWA 3BMNA 3H9JA 4XQCA 3W8EA 3ZWVA 3ADPA 3PZBA 3UFXA 4BNJA 1I2CA 2G5CA 4L4RA 3MJSA 4OXNA 4R16A 4RVUA 3K8ZA 4OXKA 2GSDA 5JXWA 4MINA 2DTXA 4Q3AA 2GN8A 1YKFA 1E5QA 2EG9A 5JBIA 2H9IA 1IY8A 1F17A 5JDCC 1BW9B 1YJ8A 1DPGA 1YBVA 3DHEA 4B3HA 1T2EA 4BGEA 1PGJA 2F1KA 3GDFA 3NEPX 2PTGA 4YRDA 3RFVA 3UCFA 4DLBA 2HK7A 3PIDA 2Y05A 4NJMA 4YXFA 1H9AA 1TT7A 1XSEA 4O59O 5TF4A 4DQXA 1HDOA 2X9VA 5T8KA 2OGUA 2VN8A 3ROMA 3TZHA 4PGFA 3IDSA 5GMOA 3WIDA 1R37A 1SO8A 4N5MA 4J91A 3STHA 1L7EA 1SB9A 2C7GA 4U7WA 2HK9A 1YOVA 2XXJA 3DAPA 3FF4A 3CTMA 1MUUA 3D3EA 3D4PA 3Q9UA 2C07A 1T2AA 3AI2A 3KSZO 2PGLA 1EBUA 2LDBA 3GQVA 4EEZA 2DFDA 1ENPA 4WCFB 3WJ7A 1EDOA 4WPGA 4ALLA 3WFJA 4DTIA 2E37A 2OBNA 3H65A 2FZWA 2D8AA 1NQTA 2WYUA 3Q1LA 4FFLA 2BKAA 3VTZA 5U9CA 5DCUA 1DEHA 4JBHA 4D7AA 1P1KA 1TA4A 5DBIA 2HSDA 3A4VA 1GDHA 4R1SA 5CDTA 4YQZA 4E4YA 3SJUA 3QY9A 4K1LA 3G49A 3IC5A 4N5LA 2OORA 4O0LA 4DXHA 3VPFA 4K28A 4FC7A 1F06A 1OBFO 3ICPA 4TZKA 4DC0A 1V3VA 3AW9A 1WAMA 1DRUA 1HWYA 3WMXA 1GY8A 1SEPA 1SEVA 2EJWA 2Z95A 3C7AA 4YR9A 2QZZA 1PZGA 4IJKA 3JQCA 4MKXA 4XJTA 2GPTA 2VQ3A 4KOAA 3I9KA 5KJ6A 1DHTA 5JCJD 3OIGA 4FSHA 4IPTA 3IKTA 4N5NA 1PJSA 3W1VA 1NFQA 1NASA 1NHGA 4GI2A 5GY7A 3QVWA 5DT9A 1DAOA 1Y5RA 3F47A 4W7HA 2ZATA 4Y98A 1K0UA 3JYLA 4BO5A 4GMGA 4PIVA 2DBVO 4IJUA 1K6XA 4JNKA 2ILTA 3FTNA 4YJDA 2QW8A 4XQGA 3U4HA 4XZ3A 4YJHA 1XYGA 1PU2A 2C54A 3ETDA 3JQAD 5G2OA 1NQOA 2VWHA 1I8TA 5AXBA 2NLOA 4YACA 4CUJA 3JQGA 3JYNA 4FJ2A 2JJYA 1KY4A 5G0VA 5IZCA 4HXYA 2D5CA 4MP3A 3VH4A 1CEQA 3WOHA 3HB5X 1N9GB 1QMGA 2G0TA 3DDNA 1CETA 1PJLA 2Z5LA 4B4UA 3U4DA 3P19A 4YRAA 4R01A 2A35A 2O50A 1TT5A 1G1AA 1LRKA 4OAQA 3RUIA 2Q99A 4FGWA 3UOGA 4WCFC 2DBQA 3MTJA 3NTOA 2VYNA 3PHLA 1M66A 2ET6A 2PH5A 5TQVA 4IQ8A 3PDJA 1PQUA 2DUUA 3CMCO 1Z73A 2VHYA 3UN1A 1B8PA 4MKZA 5L7TA 5KVVA 5L9AA 4ZQBA 4FFPA 4PZEA 2BI7A 2YHIA 5L95A 1A72A 4PVCA 1ADBA 4CLHA 2NU6A 3F3SA 3EYWA 2FRDA 4HUJA 2JFHA 1SC6A 2J3JA 4WJZA 2AQIA 1LDEA 1IPEA 2X23A 3VZRA 3L6EA 3GLQA 3LT2A 3NGLA 4O6VA 1KOLA 1MLDA 3H5RA 4XKJA 3PDUA 5KCZA 2IXBA 3PRJA 2UVDA 2VHWA 2X0IA 4PLGA 4OOEA 4TRJA 4ZQHA 4BNUA 5A04A 3UH1A 2B35A 1Y5MA 4FPXA 1H6DA 2FZEA 4HY3A 4WLUA 4NU5A 3NT5A 4D3SA 1PZHA 2E48A 2Y99A 1Q2XA 3I4FA 1RM0A 1A27A 4YAKA 4IDFA 4WKGA 1PL7A 2EGGA 2D1YA 4GX2A 1E3JA 3GOHA 3ANLA 2AQ8A 4BGUA 2ZYAA 4MVJD 3GC6A 5U4QA 4CUKA 4RZHA 2Q46A 4F6LA 4IXTA 4BO2A 2X4GA 4UULA 2BFPA 3GPIA 2RIRA 3O03A 3I1JA 3Q11A 1ENZA 2P68A 3QA9A 2Q2VA 1QRRA 4L8VA 5HTOA 4NFSA 1M75A 1RPNA 4YT8A 1HDZA 2X9NA 3NDIA 2VHXA 3NRCA 5ES3A 5CEJA 5T8KC 4OGWA 4BO4A 4FGSA 1PJ3A 1EBFA 1LQTA 4FBGA 4YB8A 1WMAA 4OKIA 4KUHA 3AM5A 3VH2A 1XELA 5AXCA 4MIYA 3I4CA 5I7VA 1KVRA 2BHLA 1ZSVA 1TVEA 4FJ0A 4IS2A 2HQ1A 3CPSA 2WYVA 2YFQA 2UDPA 3E6AA 5EQDA 3GVIA 2NTJA 4BNIA 3WGYA 4LGVA 5TS3A 4HKTA 3WR5A 1GPDG 3IAHA 4YJGA 5EMHA 5DOZA 1O9BA 1VKOA 3CIFA 3GMDA 5K0ZA 1K89A 4ITUA 2OBYA 2Y1FA 3PZRA 5A4DA 4A26A 1R4NA 3K5PA 1U3TA 1KERA 5T57A 4KUGA 5FWNA 2HMSA 1ADFA 1RM4A 1W4ZA 2FHSA 2GGSA 2I76A 3E5MA 3Q2IA 4S1VA 4CLXA 4JP2A 2GN4A 2UYYA 1I01A 4ZA2A 1PS0A 1Z82A 4CM9D 3ITKA 5JW6A 3AU8A 1TB4A 1A5ZA 3WYBA 2OP0A 2X0NA 5ADHA 5TRTA 3DBRB 3X2FA 5HA5A 3PQDA 3RI3A 4J49A 1F14A 2QYSA 1P1JA 4WEOA 4Y9DA 3CINA 2CF6A 2IRWA 1E1NA 1JLLA 3KYBA 2X5JO 3KUXA 4JX8A 5BNFA 4CR8A 4E5NA 4ESOA 2B37A 4EYEA 1DOHA 2WD8A 5EPOA 3KM0A 4Z9XA 1JVBA 3EHEA 3M6IA 4LSWA 4AJKA 4WLVA 3R6DA 3VPXA 5THQA 2I66A 3ST7A 3O9ZA 1NPYA 3Q3CA 1ZUD1 3IKVA 2QQ5A 2AW5A 4HNGA 4MVJM 3A14A 1H6CA 5IDWA 3BIOA 4BV9A 2I9PA 4R51A 2PD6A 3HB4X 4QSMA 3B70A 3LQFA 5KVSA 4PG7A 3TPCA 4DIFA 4ZVVA 1C1XB 1KC1A 3AM3A 3E8XA 1B15A 3LLSA 4KDFA 3RROA 4E5YA 2PZKA 1ADGA 4JJGA 4R1NA 4PZCA 4LCEA 1YDWA 4FR5A 3RUAA 3RQSA 4RZIA 4BO3A 4YAGA 5HM8A 3TFOA 1ZK0A 3AY7A 1NHWA 2HRZA 1VKNA 1Q0QA 2J5QA 5EQFA 1K2WA 5ICMA 3BXXA 1FMCA 4E2YA 3UF0A 3OHSX 1P44A 1EVZA 4EUFA 1UDAA 2B4TO 3DXFA 5C3MA 4NDNE 3PJFA 4XA8A 4ZQFA 2VZ9A 4PG5A 5IDYA 4AJNA 1ZJYA 4D44A 3DO5A 1HTBA 2JHGA 3SC4A 2WSBA 4BOYA 1UP6A 1V9LA 2X86A 1I24A 3G79A 1U1IA 1EE2A 2EWMA 5L3ZA 1E7QA 2CUKA 2LDXA 4BGIA 1T2DA 2E49A 1JWBB 1VL6A 4RVDA 1GYQA 1EDZA 4UVEA 4YAJA 4CMAA 5IXSA 2NV6A 1QYVA 2AE1A 5BT9A 5JLAA 2VWPA 4UUPA 1LSJA 3EY4A 1R4NB 3VPGA 2HLPA 4YJFB 2BFMA 3I3OA 1EK5A 5AYVA 4ZD6A 3HJAA 5CEFA 5IXYA 3LC2O 2OOSA 1YL6A 3LF2A 4ND4A 1FDWA 3I9LA 1G0OA 1QP8A 3RBXA 4S3MA 1NWCA 3TOZA 4PLFA 1BW9A 2Q45A 3N7UA 3O38A 1NTOA 2XXBA 4FOOA 5F1OA 3JYOA 3WGHA 1PGQA 1TXGA 3EZYA 3TWOA 4UVDA 2B83A 1P33A 3ANNA 3U62A 2J3KA 4GX0A 4AJPA 1HYHA 2D0IA 1A4UA 1E0DA 3ULKA 1MC5A 5CG1A 1P77A 2GD1O 2X7HA 5COAA 4E33A 1PWXA 3K6JA 4PRKA 4ILKA 5JS6A 5I8WA 4XYMA 1T26A 4EEXA 4M55A 5JAMA 1DIBA 5A05A 1U8FO 3I52A 4U6SA 4E30A 3ZV4A 3RCBA 3JCZA 4R41A 3VKVA 2Q49A 4I5DA 3BHJA 4J16A 4J7UA 3L6OO 4NFHA 1KVQA 4OMUA 4CR7A 3SLKA 2P9GA 3I6IA 2AA3A 2NU8A 5F3RA 1N7GA 4RPJA 3JTMA 4FOSA 3JD2A 1GD1O 2DTEA 3ENNA 4BMSA 2VHZA 5L4LA 1LDMA 2FR8A 4F3YA 4B8WA 4ZHSA 3U09A 2NACA 2GASA 3F5QA 2EP7A 1NR1A 4Q3CA 3ZWCA 1A7KA 4R5MA 1LLUA 2O4CA 2Q1WA 4RF4A 3QHAA 4PZDA 2PY6A 1IUKA 2HKIA 2X5OA 3GHYA 1FJHA 4IGFA 5ENDA 4NU6A 5I7EA 3RJ5A 1YB4A 2OO5A 4Y8VA 1F8FA 4QT0A 5C7LO 2DBRA 3PIIA 1KETA 4KWHA 4QO7A 5CDYA 1X14A 1B2LA 4FJ1A 4CQLA 4DQVA 4MIOA 3V2GA 4GKVA 4YYZA 1P45A 1J4AA 3GEDA 2B4RO 4CM9A 3F4LA 4INAA 1A71A 4BQRA 3HDQA 1YJQA 2E4AA 4IJWA 1KVSA 5IZCC 4YWJA 4FD3A 1JQBA 1NQAO 1BMDA 4JCOA 1B3BA 1QYWA 4RPHA 3VPHA 4AJIA 3AY3A 4PVDA 3JQ8A 1CIVA 3OQ6A 3EC7A 1E3IA 2C2YA 3MJ4A 3WQSB 1CRWG 5KOIA 1WDKA 1IB6A 1XDWA 3R3JA 1QG6A 3KYCB 3RUDA 1B8UA 5JCJA 2OFPA 1I36A 2Y1EA 3H8VA 4BGVA 5DZSA 2UV8A 1T25A 2ZCVA 5KNLA 4QTZA 4KQWA 3VVBA 3DZKA 2PK3A 3RJ9A 1T4DA 5FEUA 1B26A 4B3JA 3LU1A 4IM7A 2G76A 3ZCXA 2FSVA 3V1TC 1E7MA 4GX1A 3QWIA 3PWSA 5ICSA 3WS7A 5DNAA 3WNQA 4IINA 4RCVA 4ID9A 4MPDA 1ZFNA 5ER6A 2G82A 2ZK7A 2JL1A 4H16A 1NVTA 1NX6A 3V2UA 5I9NA 4L74A 2QX7A 3HDJA 4GVXA 1ZCJA 5THKA 4CLEA 1U28A 3DC2A 4DPMA 1M6WA 4L4XA 3HDYA 3TNLA 2JHFA 2V6GA 1U9JA 2ZTUA 3AUUA 3IJPA 4R3NA 4WK6A 1N2SA 1H5QA 1OAAA 4K6FA 3QLJA 3E18A 3W4KA 5IJZA 1V8BA 1BRMA 4QXMA 4A73A 4ALIA 5FYDA 5K6AA 3WGIA 2D2IA 1XA0A 1R16A 5HS6A 5TT1A 4WLOA 2EEZA 3FPLA 4BL5A 3G17A 4CL3A 1Y1PA 2PD3A 4AVYA 1E7RA 3OBBA 1SMKA 4CLOB 3EUWA 3OP4A 4IDEA 1LSSA 5CP8A 3I83A 1C1DB 1SBYA 1IYZA 1QSGA 2GERA 3RBVA 4MVJG 4RO0A 3K30A 3P5SA 3JQFC 2PGDA 3IOYA 4CM4B 8ADHA 1R4MB 2V6BA 4K6CA 2WD7B 3DEYX 1KVTA 4FIZA 1KYQA 2X58A 5CPBA 3ZHXA 3W6UA 5A9SB 3AK4A 3HDHA 1OMOA 4D43A 1ISMA 1PX0A 4EW6A 2G1UA 3RKRA 4YEDA 5JYEA 5B37A 4BNMA 1YL5A 1PJQA 1U3UA 4CMHA 1DC4A 4IUYA 4LRTB 5A03A 3JQ9A 4XIJA 5U1PA 1HDXA 1LLCA 1WLYA 4M86A 1BVUA 5ER9A 3BYZA 1GQYA 3L6DA 1EFKA 2EGHA 1VM6A 3OFSA 3U49A 1I0ZA 3LC7O 2YDYA 3S2IA 5I7SA 1MB4A 3CMMA 1U8XX 3QWFA 2OXIA 4OSOA 1NFFA 2YDXA 1K5HA 5JC1A 4BO1A 5LDGA 3UKOA 2FY8A 3ZU5A 1NAHA 4GBJA 5G0SA 3SBOA 4ZGWA 2NADA 3Q0EA 5BSGA 2VT3A 4NJOA 1F8GA 1HE3A 4J1NA 1UH5A 4WNIA 4B8ZA 1NWHA 1NM5A 2NU9A 3GNSA 4IMRA 4XYEA 5G0TA 4ONEA 3W6ZA 3ZHBA 4J6FA 2WJPA 1PTJA 3VDRA 5HS4A 1RYDA 2HUNA 2P9EA 1HL3A 3QRWA 4OO3A 3GEMA 3HNPA 2Y67A 1KY5A 2O23A 4J1QA 1UZLA 4EI2A 4D3DA 2QRLA 3JQBA 1XU9A 2WWRA 5G4KB 3LK7A 2NQTA 4WCDA 4J4HA 1JAYA 1TT5B 1M67A 1YQXA 4CLDA 5AXAA 2OL4A 3ETEA 3G1UA 4BNZA 1MGOA 5GZ1A 1MP0A 5MDHA 4I08A 2GUGA 2VYVA 1DFHA 3OEWA 1EUDA 3WXBA 1NYTA 2DPGA 4BMNA 2YUTA 5DOVA 4Z0PA 1D1SA 4XYLA 4CQMA 3C85A 2FMUA 4DGSA 4E5KA 4RPLA 4BS9A 5B4UA 4FFNA 2TMDA 3WSVA 4CM4A 2O7QA 2WD7A 3BHMA 3MOGA 1SOVA 4OJNA 5L7WA 2YY7A 1GV0A 5F21A 3ZNNA 2CVOA 3WQQA 5AQ1A 2AQKA 1LEHA 4WOKA 1J6UA 3NT4A 4PLPA 1MFZA 3FNHA 3KO8A 1XHLA 2O3SA 5JFOA 4MVJE 5TX7A 2FSSA 2XF8A 2J5RA 3R3SA 3TFQA 2Q2QA 3D4NA 3QVTA 3VDQA 4XB2A 1Y8QA 3KEQA 4J3FA 4PLVA 4GMFA 1I3NA 1HEUA 2DAPA 3QE3A 2O4UX 3CKYA 4CV3A 3HFSA 4IQ0A 2BGMA 4DC1A 5COBA 1D7OA 3NJ4A 3GRKA 3VPSA 3RVDA 1YONA 5JE8A 3GFBA 2HMWA 1N9GA 2RCYA 1R15A 3QVOA 2HMVA 1UZMA 3H9QA 5T5QA 1GU7A 4W82A 5CPFA 1E6EA 3H5NA 2GO1A 2Y0CA 4BO9A 3PP8A 3BMCA 1IHXA 3VZQA 3KB6A 2W4QA 2H63A 2YYYA 2EKQA 3WICA 1A9YA 2GRAA 4HADA 5TSDA 2YHUA 1WDLA 2CF5A 1DC5A 1DLIA 1LNQA 5K9ZA 5CG2A 1U5AA 1JA9A 1CWUA 4ND3A 3PFWO 4BNTA 3DZIA 3WSWA 5MGBA 5DCWA 3H9EO 5FFFA 2W2KA 2BFOA 2BGKA 5CFZA 4ZN6A 4GWGA 5T6BA 4W4TA 1ISGA 3INRA 3M2TA 4LISA 4E32A 4MVJA 2FPGA 4PLCA 4J4BA 4XIYA 4TWRA 1ISFA 3AJRA 2VNAA 4E3ZA 4P38A 1H93A 3DAGA 4D3FA 4OHUA 1I2BA 1DSSG 3QSGA 3T4EA 5L53A 4L75A 1KS9A 4WOJA 2ZB3A 1WMBA 2Q1SA 4CV1A 4FCCA 4GSLA 1P1RA 2JD0A 3RWBA 2CDBA 4Z3KA 2XAAA 2YQ5A 3ADOA 2PV7A 4JN6B 5DULA 4E2XA 3D1LA 5G0WA 3GFGA 1H94A 1W8DA 1XGKA 2B5VA 4IBOA 3SXPA 3TQHA 3RU9A 3RSHA 2X8LA 3ZNPA 4TRNA 2C20A 1ID1A 4L73A 2OHXA 1Q0LA 5EN4A 1HE2A 3WDSA 1S7CA 1Z7EA 1HF3A 2BRUA 2FPIA 2IZ0A 4GWKA 4YT5A 4DIOA 4DLAA 3I9JA 3OQ1A 3JQBC 1C0IA 1B16A 3SX2A 4NPCA 4G5HA 1ZXLA 2BELA 1ZIDA 1HT0A 2VUSA 4CL8A 2ZCUA 1OC4A 4FN4A 3BA1A 4ND2A 2VCYA 1M76A 2IYOA 4CPDA 3WYEA 1PIWA 1Y8QB 1B0AA 1Y8RB 3GEGA 4N7RA 2NQ8A 3WBFA 2PFGA 2BFAA 4YJFA 1L1FA 5B12A 3KZVA 2PKQP 1QXSA 5AOVA 3ZWXA 1O6ZA 3SEFA 1DC6A 2EIHA 1T4BA 3FR8A 3ITDA 2OMEA 1WXDA 3L0DA 1YH3A 5TC4A 1ML3A 1YVEI 3AI1A 4BNKA 1QV6A 1UXKA 1YB5A 4M49A 3NDJA 3NTQA 1LX6A 2X0RA 4LCJA 1IL0A 4DL9A 4PN3A 4DMMA 3F1KA 1UUFA 4I9UA 2X22A 4BNWA 4RDIA 3ZWOA 4PLHA 4BNLA 5KIAA 4IDAA 1YB1A 4PG8A 3DB2A 4AG3A 3W4JA 3ZNQA 4Z9FA 4J9VA 3LDHA 3WG9A 1O94A 3PQFA 5G4LA 3WTBA 1FDUA 1YQGA 2O3UA 2DKNA 1R6DA 1IPFA 3S2EA 3WLEA 4D45A 4YCAA 3INGA 2PA3A 1HYGA 1A4IA 3C8MA 1AUPA 4GKBA 3GUYA 1C0PA 3ZHYA 5ITWA 1LC0A 4NK5A 1GAEO 4ALKA 5HBRA 1GCOA 2FWMX 3UHAA 3HHPA 4MVJI 1JTVA 3WLFA 1V0JA 2VRCD 1M6HA 1X7GA 4DYVA 2GN6A 4CLRA 3CUKA 4CM1A 1QORA 2O2YA 3JQFA 3DHNA 2H6EA 3F9IA 3SC6A 4B4VA 4J0FA 2CZCA 1ONNA 1YBAA 3GAZA 3L4BC 4NH4A 4PLWA 4XR4A 3GNQA 2R00C 3S2FA 4H7PA 1HZJA 1T24A 3PHJA 3BMQA 4AJHA 1ZEMA 2NSDA 3OEYA 1XIVA 1HLPA 3ZWPA 2HJSA 1I2ZA 3PHIA 1OI7A 3ORFA 4R9RA 4TQGA 4NK4A 5IAAA 2PWZA 3CSDA 4YAEA 2DC1A 1R66A 1GUYA 1N7HA 4O63O 3DOJA 3H9GA 3F1LA 3KSDO 2PZJA 1X1TA 4NBUA 4D79A 3DFZA 1V35A 2WM3A 1T2CA 2QHXA 1R0SA 3CH6A 4J9UE 2ZB7A 4DRYA 1ISIA 3ZW8A 2WMDA 4C4OA 5JSFA 1LC3A 1HDCA 3BMQB 2IXAA 3WQRA 4EDFA 1BXZA 1HDRA 1B14A 4Q3BA 3X2EA 3T4XA 2Q3EA 3QVSA 1PGOA 1DHRA 3PJDA 4RGBA 4BNNA 1GZ6A 3U9LA 4AJOA 5HWSA 2ZJ1A 4LRSB 3S55A 1ZK3A 5G0UA 4M8SA 5KJEA 3VTFA 3ZH2A 1GEGA 3E1KA 4MOWA 3AOEC 1UAGA 1XKQA 4DQUA 2GDZA 2O3TA 2BH9A 3GN2A 3IQDB 3COSA 1HDGO 2CY0A 2YFHA 3EVNA 4G65A 1E5LA 2Y66A 4AJ1A 5H81A 1PZEA 2B5WA 3BTVA 3JQAA 3TOXA 3GVXA 3NAQA 5C37A 1ZW1A 4YJHB 4JQCA 1N1EA 2WYWA 2VTDA 3PGXA 4BIIA 2GLXA 4DIBA 3C7CB 1T1RA 2BGLA 1Z74A 3DBHB 3DOOA 4HP8A 1EMDA 5KJFA 4XGIA 4F45A 4I5EA 3GVHA 4WLFA 5A02A 3QV1A 4DMLA 3KOUA 3KBOA 4OM8A 4EBFA 4QUKA 4R4JA 1UZNA 3TRIA 2OZPA 4RV9A 4LSMA 1E3WB 1MG0A 2WTBA 2Y68A 4D41A 1W6UA 1HETA 3M1LA 3OH8A 4CM8A 2X9GA 4EUHA 2YV3A 3A1NA 4AFNA 3ROKA 2V65A 3GVCA 3OSUA 3L9WA 4K26A 2PNFA 3ZI0A 1GYRA 4NFYA 3KTDA 3KETA 2DM6A 2FP4A 1LBEA 2Y0EA 4HWKA 3W8FA 4J1TA 5HRUA 3JQ8B 1X7DA 3F6YA 3S1LA 1R4MA 4E2ZA 4E21A 5B1YA 2CDAA 2EERA 1DRWA
chains in the Genus database with same CATH superfamily
3M6LA 1UOQA 4EK9A 3K2IA 5F1PA 1M7HA 5AHOA 1MX5A 1E7YA 2JRLA 4OL9A 3WDMA 4LFBB 3NATA 2P9ZA 3QU7A 1M54A 4E70A 4AKHA 1UWLA 1YCDA 3C8UA 3USES 1WQ1R 2WICA 4FFRA 2H0AA 2YXLA 1R8SA 3K5WA 1E69A 3RWMB 2D74A 2QMEA 4X00A 1N33B 3ND6A 4AS2A 3QPUA 1P9LA 3RUPA 1RHQA 9LDBA 5JH7B 4QBFA 1GG9A 2O8CB 4NI5A 1FTNA 5LC1A 3SIPA 1UBUS 2SKCA 4D0GA 4URXR 2ORYA 2PCLA 3EODA 4IOKA 2PSEA 3T9EA 3UTDA 2GT1A 2PL5A 4QA9A 3UPUA 4ARCA 2LKDA 2YMPA 2Q9BA 2VRNA 4G23A 3LM8A 4KLCA 5ALIA 3TL3A 2PEZA 3A7DA 5JECA 1WCIB 1T9GR 3CUYA 4A27A 1OFGA 5FWXB 3FTQA 3TSAA 4JQYA 3FTFA 4MUBA 2WUDA 2XJ9A 3UWSA 2EW2A 4N6OA 1Y4DE 1W0CA 4B6FA 1UBTS 1R6UA 2D7JA 4KZPA 4A6EA 4RSMA 2HRDA 5JMOA 2JGMA 1XZEA 1F3LA 3H1TA 2OFFA 5AP9A 1MKYA 1YBHA 2Y2UA 4HMQA 3GG2A 3I3SR 1CY6A 4HZIA 4OUKX 1CK4A 5GJWC 3UG6A 1NI4B 1R12A 5I9MA 2AZ4A 4US1R 2ZI3A 4F5EA 2J6CA 5DU2A 2J33A 3E48A 3PYXA 1P9OA 3WIEA 3PNSA 4C43A 3UZUA 3A11A 3ZGNA 1HEYA 2NTVA 2ZYDA 2QUHA 3H2IA 3KZMA 4HDKB 2C0PA 4EUSA 2RHCA 1TQDA 4YAUA 1S1MA 2CC2A 2HTEA 4FNOA 2PKWA 3FTCA 5DH9A 3LK6A 2FGJA 4GLJA 1XAGA 2OHFA 5IH7A 2YC4C 4UCQA 4Z4GA 1L5YA 4UBMA 1EXVA 3ICCA 5I7RA 1MG5A 5AVVA 3SSAA 4C7KA 1MIOB 2ZRBA 3PWZA 4B3MB 3IKMB 1AXEA 3GFFA 3JQ6A 3OICA 4PAGA 4R2IA 3AR8A 5FWYA 5JNVA 2ZBPA 4I8XA 4BX8A 3L1KA 1Q0HA 4B8YA 3SZMA 3UMGA 4NCJA 3KYDB 4N03A 3LC1O 4HMOA 4XFDA 3TVYA 4J3NA 3AU9A 4HHEA 1VB5A 1YD7A 1IXKA 1Y7LA 4OHKA 4MLPA 4CVNA 1G2OA 3E5RA 3ZKWA 4RTMA 2RG1A 3AWDA 1SJ9A 5K45A 4LOJA 3G0CA 1QHYA 4WLEA 5JMTA 2PUTA 1YWGO 3DZBA 2Q8PA 5DM4A 1CERA 1V3UA 2WRZA 3N70A 4ALNA 1HYEA 2BFWA 3GZ4A 5DX1A 4DLVA 4POOA 4Q18A 1U7PA 1Q1NA 1NI5A 3TB4A 2CYCA 5JDIC 4M6WA 3LT4A 1QIEA 3MJFA 1RYEA 4P54A 5JHHB 3EGDB 1W46A 2X8JA 3BB4A 4MVJF 4D0SA 1NP3A 1QVAA 2B1RA 3HSYA 2C92A 1DDIA 3F5FA 3VJRA 3R8FA 4NE2A 2QMYA 5REQA 1QO7A 1T4GA 2F64A 2W2OA 1BDMA 3BCSA 4UUOA 3MIIA 4H08A 1VHJA 4KRXA 3WY9A 3DAYA 3UYLA 2WIGA 4EGJA 1EAMA 1JE0A 4QJ4A 3D3NA 3HE3A 5EUMA 2ECPA 4F3KA 1E92A 3FCSB 2H4YA 5DLYA 2OXFA 1EUQA 5SY4A 2NVOA 3LOPA 4ZRNA 4W9MC 3PS9A 5GJBA 1J06A 3K9WA 1XQ9A 4IKEA 2I6GA 3WISA 2B8TA 1NQWA 3TMAA 3C5CA 1YR8A 4AM8A 4ZFNA 3IPYA 1L7AA 5CU7A 3BZUA 2WEKA 4CV0A 1SCIA 3TLAA 1QKJA 4HMPA 4YALA 1ZI8A 2JAWA 4IY1A 5JNUA 3EF0A 3HFGA 3KUDA 1KZHA 3VVCA 4CNBA 5JOQA 1Z37A 3OA0A 3AKDA 2W6JA 2PKRA 2N75A 1TZKA 4ZOLF 1TYZA 2I34A 2AS0A 2ZIZA 3HA2A 4KQ2A 2VPTA 3BRCA 3HDTA 3SJ7A 3ZY2A 2VK1A 1X7HA 1AH2A 2OLJA 1P1HA 3B2QA 1WNTA 3KOXA 4AYTA 2F4NA 1INLA 1E77A 2XADA 2XMZA 2PT5A 2ZAIA 4L4ZA 5K8LA 1OH7A 4FYYA 1LBHA 3TNJA 3SF8A 4DWWA 1Z34A 3HNRA 2PL1A 3PUYA 4EG6A 3V4ZA 2A3NA 4DDVA 5A5GA 2GVNA 1R0LA 3HKDB 1KJJA 3BFJA 4CM6A 2CVFA 2G5PA 3ETGA 1NYQA 1NJGA 1QO0A 3I2HA 4X65B 4DBLE 3CF4G 2O06A 1QYRA 2XKBA 4QOGA 3EX7C 1EUCA 3AXTA 2BFFB 1VLLA 1NMYA 3ER6A 1IZ9A 4M83A 4XUDA 7AT1A 4ZOAA 2X2EA 4E12A 1CDOA 1VJTA 3AETB 4GR9A 4ML3A 4DNFA 3DP9A 1MIHA 1ODKA 5LOVA 2QSZA 2IPOA 4QGSA 1OFVA 3FBTA 4QICA 3TSZA 1LW6E 3GG9A 4N5IX 2E6UX 1F2UB 1R5BA 1VGRA 1Y8RA 2IQIA 2F3TA 2OY0A 1XXHE 2TMGA 4UDNA 4AL4A 3LBIA 2YW9A 1GEEA 1OXMA 4R8MA 4IIJF 3CRNA 1Z8DA 3IILA 1U4SA 4N0QA 1PT9A 3D54D 1AO0A 3O2NA 3QU2A 4CIAA 1NVUQ 3QU5A 4V0KA 3BWYA 2VRCA 3RAJA 2J30A 2P3LA 1ZIYA 4Z2AA 3HKDA 3I5MA 4C01A 2B8WA 3LXUX 4PCVA 3AONB 4FLMA 3LBHA 1J8VA 4R83A 1I9GA 3GJYA 1XJ0A 3DKIA 2N46A 4XDZA 4AP9A 4D42A 5A5VA 4FLFA 2PUHA 3PFKA 4NESA 4Q39A 2B20A 1SBCA 1RI3A 5L40A 1ZM9A 4R2LA 2GHIA 4J1QA 4C20A 4GFDA 2OHJA 3OKAA 2GZ2A 2H0RA 1EP3B 4WADA 1VBMA 3CR7A 4WV3A 3EC1A 3TUZC 3T9CA 3WX0A 3GUZA 3Q3GE 5AWFC 3IAEA 1KMNA 1YR2A 4AYXA 3VO8A 3PIRA 4NE7A 3D4OA 1JKIA 1G9TA 3GFPA 3INTA 4AY4A 2JIPA 2FUG1 2HDNB 2W6ID 3OJEA 1V37A 4G41A 4F21A 5BN3B 3GHHA 1JLHA 1CLEA 1RWQA 4LF8B 4EITA 1ACJA 3EZ2A 3ZWWA 1ULAA 4QDUA 1C4OA 4BCCA 3EQZA 2BONA 3HVRA 3DOCA 3K09A 4Q3DA 1N25A 4ZYVA 4AKIA 4FS8A 2DFVA 1I3LA 3I5UA 3PQ5A 3RUCA 3UIEA 3F5DA 1SUDA 3GGPA 4BMCA 1EX7A 3GJSA 2PXAA 5K99A 4EA8A 2VWQA 3D8RA 4EGAA 3B1YA 3IVXA 4GR4A 2AHRA 1AUXA 1OX6A 3P9PA 3ZHCA 5HE9A 4QQ8A 3E3OA 2W9XA 1HDYA 2JD1A 4X54A 2YXNA 4ZYTA 3QQPA 3VR6H 3ZWNA 5TPWB 1KI6B 3EPPA 5F7XA 5TY0A 2PIDA 3D7NA 1JL3A 4E7PA 1QPZA 1EWVA 1XDGA 2LBPA 1T4MA 1Z62A 2M1XA 3DMNA 2I4RA 3NFRA 4OHRA 1HRKA 1C14A 1WKVA 4OQXA 1MABB 4PWZA 5TQ0A 2LV8A 4G9EA 4M54A 3WBBA 3B60A 5KU7A 3NKLA 1QYDA 3PHHA 3ND9A 2H06A 1T5TA 1LNSA 3ASUA 5FKJA 4DOMA 5JROA 1PZFA 4M22A 3OZTA 1A3CA 4BBPA 1VHLA 5FPKA 2O20A 1Q6ZA 1P1FA 3NTRA 3DBOB 4HX9A 1W48A 3HWSA 3NUGA 3PR2B 1WXXA 1Y48E 4G4JA 4TTRA 4CTOA 3WWEA 2DVMA 1L3CA 4FC6A 4PSCA 1G55A 1E2BA 3BK7A 3ZZNA 1HORA 2DULA 3R74A 4BQPA 5K0EA 2ZJ0A 2J45A 5JI3E 2JLAA 2PT9A 2IU0A 1W36B 1LJ8A 5FI0B 1DO8A 4BE7B 4QU8A 1Y9ZA 1UMDB 121PA 1IN5A 3TLXA 3O8QA 3PUIA 3F2IA 1C3OB 4TMWA 4HRXA 2XTAA 3GRFA 3TB6A 5HIAA 1PR3A 2ODNA 1DIHA 2NU7A 3HVIA 1E2DA 3FBGA 3RK4A 1YU9A 3L7LA 1I4TD 1O89A 5IYZB 1UR5A 2E82A 1ZCZA 3DHYA 3ZLBA 1G41A 1JKJB 1LWNA 3PGLA 4G0XA 4CTJA 1Z39A 2HHCA 4HRVA 4X3CA 3CVXA 3ZU6A 3LSYA 3H5OA 5DHPA 1AS2A 2VF5X 4BB9A 4XD2A 1U9YA 1I6KA 4NNJA 2HC9A 4RMJA 1P73A 4I4IA 4WZAE 4J2HA 3SLGA 3V8EA 3WRVA 5BNTA 1F9AA 5DK6A 3LOQA 3N8HA 1JI0A 3HCRA 1OGIA 3D5QA 4X1IB 5CNKA 1KDZA 4Q9NA 5GWXA 1UJBA 4OK5A 2I8AA 4JUBA 5JDCA 2GHRA 2C5AA 3RANA 4EB3A 5LQDA 5K3CA 1YQWA 2BTQA 3GH3A 2PA0A 4PZAA 2BBOA 3BWDD 1FIUA 2I1QA 4HFMA 2D0DA 2PM8A 3G89A 4L22A 4CGYA 2YZNA 4KC0A 3LDUA 2FPWA 2F8LA 4L9RA 1AKTA 3EUFA 3FNIA 5LR6A 1IOLA 3P94A 2QPTA 3VDNB 4Z7NB 4G4SO 3RTGA 3TRKA 1IXRC 1QJ4A 2R97A 2ZBUA 3OLZA 4PX2A 2HPVA 1Z25A 1PR0A 4RU1A 4MRSA 5AJUA 4ZQGA 1ILWA 4RQAA 3BZBA 1WDMA 1JKJA 3MOIA 3IALA 3LT1A 5EPUA 3K1ZA 3ZIUA 5LQAA 1WHTA 5JCZA 2OFXA 1TZ2A 2F3RA 5KX5F 2CDNA 3LZ6A 1S8AA 4LA4A 1WDWB 2J4CA 1L5SA 5FLXA 3KYCA 3QKTA 4Y6SA 1M34A 3DZDA 3RD5A 4ZVMA 1J2RA 3D59A 4D9GA 2BFEA 3FXAA 4EA6A 1DG9A 3GVPA 4YROA 1L8XA 2O7NA 5SY6A 4GPIB 4XJVA 4G0YA 1VE3A 4EVSA 1ZD9A 3FSGD 2HZ7A 3AF2A 3WI7A 1ODSA 3ZGLA 4AZ0B 3ILVA 2XTZA 4PG6A 3SIXA 4C88A 4CMKA 3PUXA 3V55A 3C5WP 3V8BA 4HNVA 4EB6A 5EP4A 3ROPA 2IOQA 4C0KA 5I45A 4J0KA 4Q47A 4MYCA 4XR9A 1GDDA 3SS7X 1JEYA 3FVQA 5JBNA 2V4MA 2JFPA 4PNHA 4CMEA 2HJWA 1GFZA 3HSKA 1C29B 3EQ2A 3OJXA 1SQ0A 4K6HA 4U7GA 1LDYA 1D9XA 2HEIA 3BKXA 4JKOA 2WJZB 2YV5A 4JJIA 2XT0A 2W6NA 5IMSA 3JATA 5KINB 5KJCA 4QM7A 4RF5A 3E7FA 2JCVA 3OIDA 2G4VA 2FW1A 2P9QA 1GKIA 1SXJB 4N3BA 3GYGA 5JALA 3ESYA 2D6FA 6LDHA 2OZLA 2BKXA 2ORWA 2N1MA 2Q1UA 5C81A 3SK0A 2ZSKA 3AZOA 1TC2A 3KQOA 5IN4A 5SZHB 5JPDA 2JKVA 4I3FA 3I4LA 3ZV3A 1VL2A 2BM0A 1VSUA 3FWNA 4CFZA 4ENUA 1U5BB 1OW3B 4DT1A 3CLRC 4PBSA 3WGQA 4ZDKA 4AULA 3UMFA 2VNSA 3KLOA 3AEQB 2GCGA 3TLGA 2OAEA 5D3KA 1XYYA 4A91A 2JFVA 3BMNB 3N2EA 1Y7IA 1QP4A 5JCXA 3VRHA 1AKMA 3GD7A 3ANYB 4NC9A 3DXYA 1ESDA 2QTBA 2PUCA 4TTAA 3BSFA 2XUDA 1MGPA 1FP1D 4JQSA 4OFXA 3OF2A 1J9GA 4V3BA 2IWRA 4I3HA 3W6PA 1FRQA 1BHJA 1ODJA 4U02A 5TT0A 3FCAA 2QI9F 4IIGA 2A0WA 1KKMA 3OOWA 4XH9B 3LCMA 1RXVA 1T1SA 5JXJA 1QF6A 1TRKA 3ACDA 5A9SA 2WVJA 3IUMA 2GM3A 4LJLA 3H1FA 4GZ3A 4TVBA 3FOAA 3DDOA 4FDAA 2BEVB 3VHQA 2QTCA 2WYIA 1K63A 2Q4BA 3B8EA 3GDOA 4RVHA 1TE2A 3DOUA 4GLOA 4U7DA 4H2DA 4J0IA 3TBKA 3OESA 2CD9A 4Z1MD 2WT8A 2FEOA 2WHPA 5ALSA 2HU2A 5ALMA 1DDGA 1E3WA 1Y1QA 4F4DA 4KE6A 2ZAOA 1R8QA 3PPIA 1I3MA 3RRZA 1AS0A 4OY3A 3N1UA 5BW4A 4PO9A 1GKYA 1FQJA 3EVAA 4A0SA 2JCGA 1BTOA 1W2GA 2GZAA 2AKAB 3GRPA 5ALTA 4YRBA 2O3RA 3I9V6 4CTKA 3CA8A 2K6GA 3V97A 3KQHA 2IX9A 1X0VA 5LQJA 2QVLA 5F1YA 1P6XA 4GAEA 2ONJA 1PNTA 3RTAA 4HFRA 1H0KA 3U3JA 3UT6A 2YQZA 3LIPA 3PHGA 3SIRA 4TKUB 1P2FA 2P5SA 3FGNA 4HDQB 3UKDA 1SKBA 2GF2A 1HM5A 3KKOA 1UKVY 2XMDA 4DARA 3K70D 4U9HS 2Q2WA 1J0XO 1AHIA 1KQ3A 1L7XA 2A58A 4I55B 3QKIA 3ZDZB 4GYWA 2BKLA 3FWPA 4DR5B 2A5FA 4H3SA 2F17A 5DKFA 3MNFA 4XX1A 3HJTA 1U9CA 4URFA 1SUSA 4B75A 4RVSA 2ZRJA 4Q4AA 5E2IA 2X9LA 4XEUA 1IJFA 4Q1CA 2YHBA 1I32A 1EJBA 3CQ9A 5A7GA 1XNGA 5I7HA 3U4IA 1B1CA 4KLZA 4G4IA 5IVIA 4DIUA 2GN1A 1SCBA 2V7TA 2X5XA 4UMVA 2W6OA 3GN1A 1JQEA 1KF0A 2ZI6A 3DPIA 3C14C 3D2BA 3R3XA 4ZXFA 5MGNA 4F71A 5KHAA 1EQUA 1OXKB 3J81A 4BVGA 2AN4A 1W0JA 3JAWA 1FLAA 1XROA 3CUWA 1IEWA 4ND5A 1PS9A 1XRQA 2QOEA 4RLSA 1X7WB 2OG2A 5C7OO 4TTTS 1WX1A 2XUHA 5AJXA 5FRDA 1EXMA 1FY2A 3FHCB 4JUDX 4YUZA 4IFTA 4Q5IA 1FK8A 3KVOA 1L4FA 3AERA 2W2QA 3QW2A 2P5UA 4ENRA 2EYQA 4ER6A 1DC7A 2XDWA 2VQ6A 1FE8A 2ZGVA 1KAGA 3R5SA 1T1EA 4PAQA 4QU9A 1VBKA 1EVJA 1P29A 2BDEA 2P67A 3A3KA 2DUNA 1Z2CA 4YNBA 1PTKA 1QK3A 1SU4A 1T5LA 2A1IA 2EW8A 2MSLA 3DAOA 4NU0A 3DJYA 1Y4UA 4P8RA 1NQUA 1W34A 4OSPA 1FUKA 1JQJC 3DVRX 2HCJB 4ZAYA 3CH7A 4ASUD 5ABPA 3IAM1 4GQAA 4TQAA 1VSVA 1Y7HA 2BI8A 4FEAA 4HLNA 2IWHA 1RAAA 2GBLA 1Y81A 2B82A 1ZH8A 3A6JA 3AT1A 5DXJA 3BWVA 2NAFA 2ZJAA 5C46F 4YQYA 1FDSA 4KUEA 2CSXA 1H6AA 2Y1CA 1AGYA 4H7DA 1X38A 4JMLA 5F2OA 5LA6B 4YAIA 2AJDA 1SXJC 4FUTA 4R9UC 1B41A 1JQLB 1V6CA 4FT2A 1YS2X 1HV8A 3OZUA 4I2VA 3HSSA 4EO4A 1X74A 3LA8A 1SIOA 1GZ4A 4OGFA 3MJCA 4IJQA 4NZOA 5EZ5A 1L5WA 1X7YB 3M9XA 1NZDA 5FFNA 4OSEA 4RAOA 5ERYA 4Z4EA 4KR6A 2DPHA 4IDOA 2I54A 2PPVA 1YE5A 5TJ9A 1STOA 4GP7A 4PYOA 2ZJ4A 2XX3A 3H5AA 5LBTA 4NBTA 2GPSA 2WAMA 5LCXA 1QQTA 2BLLA 2J0EA 3PNVA 2D1QA 4BUJA 1KQPA 4P4LA 3T7DA 3KQUA 3TZ6A 3W77A 2C2XA 4NQZA 4OH7A 1GZ3A 4EJ0A 2F90A 5CDGA 4KQIA 2PKQO 5BQ3A 2I03A 4DVJA 2HJRA 5F2KA 3DOIA 3GJXC 5F5NA 3LFHA 4YONB 1WBDA 1AE1A 1Y6JA 3EWSA 2RHRA 3MFQA 3B1ZA 3W8DA 3JD4A 3MILA 3GRCA 3WGTA 1OB2A 4Y2JA 4BXOA 2X1VA 2XOEA 2JD2A 2CLKB 3BXOA 3DMTC 4DBLC 1LF0A 1MF7A 1JJIA 4RW0A 3PPYA 1RNLA 5K7SA 1Z2EA 5EMKA 3ZDFA 4A0HA 4JGIA 3ZEIA 4RD6A 3E2PA 2Z04A 4JOCA 4JIMA 3N6RA 1KSHA 2IUUA 4M3NA 3F3MA 4MUAA 1X6VA 4H7JA 2B92A 4MV4A 4U7PB 4W1PA 3FHTA 2O19A 1ONPA 4OHZA 2XCUA 4UTRA 1CUJA 2PGAA 5AK6A 5BUSA 2UZ4A 4JJKA 3O2JA 1ISPA 1BXRA 3CPEA 3NYWA 4JP3A 3PTAA 2CJFA 2JLZA 1QIJA 4GKAA 5HFNA 4JB2A 2PH1A 1TAGA 1TNDA 2G88A 2QSYA 3M4YA 1WP9A 3HZHA 1A95A 4LMBA 2R8YA 3ZBTA 1QX3A 4DC9A 4XW2A 3ZKWB 2FX5A 1RI5A 2YWRA 3P0RA 1JHAA 2ROQA 1N2EA 4YJ3B 1OGJA 4L6IA 5FH9A 1ELOA 5C80A 1JB9A 3ONFA 2DHRA 4P3KA 4UUMA 4CM7A 3FE2A 4OLAA 4OK6A 1BU8A 3MUOA 4JR1A 4NAHA 3KHUA 3RU3A 1NBOA 1SU7A 1X8LA 2H1SA 1Y3FE 4TMFA 4UAVA 5BN4B 3MWEB 2ZREA 1EG2A 1V47A 1Z6PA 2L19A 3EVTA 1N6RA 4LXYA 1JBEA 3CUSA 1N1MA 3ANMA 3NUQA 4KXLA 4NJEB 5EUQB 1ENYA 2HR1A 2H5EA 3NT2A 3G1WA 3EGOA 3HKBB 1EFDN 1OKKA 4L85A 5A4KA 5FBWB 1GADO 1CE8B 1ZAKA 2OXEA 4HR7A 2PUVA 2HSJA 1C9KA 1J99A 1SAYA 2ATVA 1X7ZA 2VS1A 3EB9A 3K1TA 5ALGA 2AR7A 4INOA 4K88A 4QFBA 1AMNA 2YR0A 1GCUA 3U6BA 2QM7A 4MP8A 5KTNA 3V8PA 1G21E 1PL6A 3KRTA 4ZHQA 4OIFA 4GNKA 1U7TA 1UJ5A 4M1QA 3VOAA 3ZJUA 1E3EA 1SCUA 1W85A 1T9ZA 2C5EA 1SKQA 2GAFA 2YV1A 1BCSA 1N5JA 3IIJA 4FFMA 4WESB 4S04A 2ISSD 2C00A 3L9XA 4Q0MA 4O8ZA 1PTJC 2R7AA 4FKBA 4RGYA 3OJFA 3JASA 3QIVA 4N7JA 4LGMA 1EX9A 3TF5A 1MO4A 3V5NA 4TVOA 4UEWA 1E6UA 4F2PA 1GP2A 1UOPA 4Z6KA 3ZWDA 2R6FA 4LBYA 2EFEB 1DAFA 3D8TA 4QBHA 3PEEA 5K0SA 3PE4A 1WB5A 5B64A 4M9RA 1DXYA 2GCOB 2RC6A 3UATA 1GPUA 4C4PA 5IWAB 2XVXA 5DK4A 2FG5A 3QOFA 4MW4A 1XCLA 3IEKA 1UDCA 3GIDA 5KDDA 1JG3A 3KXPA 2QW1A 3GF4A 3HKCA 1PYOA 5AI9A 3PSHA 2JFUA 2G40A 1RCFA 1S3GA 2OFWA 1KJ8A 4PZ0A 5FF9A 1ZY2A 3U3KA 3LL4A 1DS6A 1XTRA 3RM3A 2CHEA 1XTUA 3SM3A 3T9DA 3X1XA 5KTRA 3K20A 1IXYA 1J39A 2BBWA 1L8QA 3B6EA 3DB1A 3HO8A 3L8CA 3EVGA 3PCXA 2BTQB 4KRYA 3L0ZA 4Q7KA 5B1IA 4AO6A 5A1TA 1PD1A 3MTGA 4G0QA 1BMFA 2VT2A 3AX6A 4I8DA 5ALPA 1YKGA 1W0JD 3JQPA 3EBLA 4KR3A 1OWMA 1FFAA 4GOLD 4HS9A 1DQZA 3S8YA 2C9BA 4BE4A 1SY7A 4FYIA 2O8EA 2YY6A 4M60A 3EXEA 3OCZA 1PSDA 1R18A 3ND7A 1XV5A 2ZYUX 3OC0A 5ALNA 2YYSA 3BSWA 5FOQA 3SYNA 5C8ZA 5EKSA 7REQA 1GPH1 4IHJB 3IIEA 3STTA 2WSSD 5K09A 5KYXA 1GU1A 1LI4A 1VOTA 2A3RA 2WV7A 4TKVB 5I5EA 4RZXA 3U3XA 5FTJA 3E22A 5C4MA 3K53A 3ORSA 4TKMA 5IYZF 4YMSA 4Q4JA 1XZNA 4OF4A 1PD0A 1Z4MA 2H1WA 2REQB 2FPIB 5HKKD 1HNNA 1VPVA 2WF8A 3FVRA 5C4GB 2ZANA 4ND1A 3TRJA 7ABPA 4BU0A 5EJ8A 1UPXA 3O83A 1XL1A 2V7VA 5TGTA 4V0SA 5B7PA 1MDBA 1DOAA 4I4CA 5EWJA 1NMSA 1C50A 1Y82A 3NV9A 4C2AA 1GGEA 4WECA 5C5DA 3DFUA 3WKAA 2FZ5A 2D5BA 1L5RA 3TAXA 1T5DX 1Z8HA 3TL2A 2QN7A 4OV6B 1IBLB 3AVQA 3WKBA 1GNPA 1C7ZA 1KGSA 1XC7A 5JCPA 5JO0A 4ALMA 3ZLUA 3HCFA 3UCXA 1CQXA 4WGFA 1ZWKA 3WGLA 2JFGA 4P6VF 3H0KA 4GH5A 2XRZA 2NP7A 1Y4SA 3EZXA 4KYVA 1X13A 1NPTO 1GUAA 3A4YA 1NMEA 4M9CA 3IPLA 3Q15C 3KALA 4K5QA 1ZIOA 1E2FA 3BTSA 4X24A 4CMBA 2EEPA 1JB1A 4M0KA 3AKYA 4U3JA 2R87A 3ZCPA 5JNRA 2BFBA 4JFRA 3LW8A 4HTAA 5T67A 4RD2A 3TE7A 1SHUX 3KAKA 1GPKA 5BW6B 4BWVA 4D9BA 1E94E 4CU5A 2WWYA 1UKZA 2JBAA 4W6QA 2P4UA 4GIBA 4LOAA 4TKLA 2WUWE 2OFOA 3LYHA 5BO5A 2Y1GA 3OWOA 1IQ0A 2ZJ3A 1ZSYA 2C2MA 3K0BA 2GOYA 3ZGXA 2ZQ5A 1JT2A 3BXZA 4BKQA 3BILA 4BMZA 5D85A 1P31A 3EFHA 2QE7D 3QBJA 1HX7A 2YXPX 1ZVMA 3EZ9A 2XNCA 1DIAA 4KNVA 3A9WA 2AUTA 2IP4A 2CJPA 4XQ9A 5JXIA 1GPLA 2VHJA 2GJKA 4QSHA 1Q92A 1V1MA 2HADA 4TZTA 3TEMA 4BYMA 2LZ0A 3NX4A 5CVUA 1AKYA 3Q9SA 1KOGA 2O8NA 2V6IA 4BMXA 4GI7A 1J5PA 3NQ41 2J4FA 4S2EA 3KKKA 2CLEB 3OAAA 2J9FB 1L3BA 4G0OA 3M6FA 3NHJA 6PFKA 1UFOA 3PX7A 1KSJA 4GSYA 3HUDA 2AJTA 2BMJA 2DBZA 2XMSA 2FOIA 3DL4A 4BBZA 4NMXB 1YBMA 1YK1A 1EFVB 1WP4A 2G6TA 4QBKA 3B38A 1RC1A 4TSRA 4UBLA 4C4RA 3IIIA 2RHLA 1ZZEA 3PTZA 2IXEA 5LB4A 4DV3B 1Q1GA 1P39A 1NQ5A 1ZO8A 2FR0A 3GT7A 4UUNA 5EJAA 2ZYRA 4YPOA 2C5FA 3LF1A 3FI9A 2H57A 3WB2A 4E5DA 4MUNA 4MGIR 2YASA 1FYXA 1KIFA 1WPXA 2VSOA 3L8GA 2R7KA 5JZ9A 3B6ZA 1ZL0A 3GGJA 3KD3A 3KWJA 4MUGA 1PFVA 4OA8A 3ZK8A 2I99A 4B2IA 3NBKA 4HNQA 4RZUA 1Z0AA 3D7KA 4M8NE 4CMJA 4O33A 1QYCA 2FETA 1RQGA 2GILA 3L18A 4IVNA 1ZK1A 2CKDA 1IBSA 2QZSA 2QM3A 1JHDA 1HQYE 4K05A 1ZP6A 4YJ2F 2OO5C 4YVFA 3JU3A 3OZIA 3JTEA 4W1RA 2F8TA 4LZLA 1U6JA 2JHPA 3D31A 1BH6A 3OIFA 2OP1A 4GVLA 4NJMB 3QJ5A 2YICA 2CXTA 3I72A 4IHJF 4ZAGA 4EBBA 1KZ4A 5IJ9A 1Q1ZA 2KWIA 4D4GA 1E9EA 1GRCA 1E8NA 1HOXA 1P1BA 1Q7CA 3H8SA 3UQYS 1Z5GA 1OVMA 2QIOA 5DNVA 1SUCA 3LBNA 2C4HA 3S8MA 2A59A 4R9SA 2OGZA 2X1MA 3ZTTA 1SHZA 4NMHA 3R9IA 3RYCA 1RWXA 1RWOA 2YWBA 1GTRA 5KI6A 1JEDA 5GIOE 1QIMA 4KFSA 3CTPA 5CDFA 4FX5A 3JWEA 1JWLA 2CLCX 1ULHA 3HA3A 3AINA 3AIIA 3AVUA 1JLRA 4QX6A 4MKRA 1LX7A 3PRYA 4NP6A 3D8UA 2QNRA 1J97A 1M9NA 2ZM5A 3FX2A 1WUKS 3LPMA 5SY9A 3R76A 3HGMA 3SQOA 5IF3A 2C5LA 2H2AA 4HC4A 1DZIA 1KFKB 3C5VA 1FC0A 3O5AA 3F5SA 4L16A 4XD7D 4BVAA 3NV7A 1OIVA 2R8EA 1PK8A 1J56A 3PXUA 2Y3IA 4I1IA 1XCPA 2P6OA 3ZW9A 4J43A 4DR2B 4I55F 4O5AA 1NXTA 3VMFA 3V1YA 3QMMA 1KBQA 3FMIA 2QUAA 1XTPA 3PFFA 3B5EA 1Z0KA 4H4DA 4MROA 4OGGA 1G5HA 3FDIA 2G0NA 2CNOA 2WJYA 3CE6A 2WUEA 1OLXB 1WW8A 2VDOB 4Y67A 5AIBA 2E7ZA 5DFAA 2NZYA 2QTWB 4FI3F 4CFSA 1XXHB 4O2LA 4HDCA 3T7CA 4GRDA 4LMRA 3QX3A 3MWJA 2ASEA 4FOLA 5FORA 1WCXA 1D0VA 3L07A 3FOZA 2ADMA 4YRKA 3O4RA 3RHFA 3ZGYA 4JEHA 1YS4A 3OEHA 4IDBA 4A82A 1LLQA 1VCIA 2BUBA 1Q7GA 3TZEA 1IB0A 4DMKA 1SVNA 5J2UA 1MA3A 3T3EA 1Q2UA 1XZQA 3COVA 5AVQA 8GPBA 1O95A 3WV4A 3VHXB 1BD3A 1ZSNA 4HH1A 5EIBD 3TIXB 4UC0A 2FPKA 1KKLA 2ZQYA 5DYNA 2AE2A 5JPCA 2HM7A 2VP4A 1Y5NA 1YRAA 3H9JA 3ADPA 3PZBA 5G3ZA 3UFXA 1I2CA 2G5CA 521PA 4MVWA 4O02B 4OXNA 3WJ2A 1IBRA 5FA6A 4Y2TA 5JXWA 3K8ZA 3PFIA 1OX4B 2DTXA 2QSJA 2RGWA 3VGPA 3NMUF 2GN8A 1YKFA 1Z5PA 3A2NA 3CPHA 2BV3A 4X8OA 2O8VA 4Y0NA 4ZVNA 3ZJ5A 5F7OA 5JBIA 4LX8A 3QPBA 4YRLA 4WACA 3EEQA 1R9NA 2GNOA 4Y2VA 1MEJA 1YJ8A 3DCIA 3IVCA 5FPTA 2GFQA 3N8GA 3TGWA 1I7SB 3HZRA 5HQTA 2E87A 2PTGA 1JKMA 1I1OA 3DCJA 1QQ6A 4NJMA 1OLSB 5I48A 4QE3A 1IDOA 4L4UA 1VIVA 2FMXA 4Z3OA 1H9AA 4HH4A 4O59O 3I2KA 5TF4A 3DG9A 1AQYA 1NBME 5CH5A 4PTYA 2OCYC 2DWPA 2JH3A 2X8JB 5KCMA 1Z0UA 4GD3Q 4A0FA 2PMBA 2V54A 5BQXA 1AKVA 3ZV7A 3O95A 1VPEA 1M72A 1G2QA 4M37A 2R47A 4M1MA 3UJ9A 1VKJA 3OZBA 3D2CA 3C8HA 4LFAB 2YC2C 3RYFB 4DG8A 1VGQA 4QVIA 2NUPA 2RGNC 2QT1A 1NRIA 4NU8X 3PR1A 5KAPA 2NUAB 2J3EA 2C5BA 4NDZA 5WRFA 4C4XA 1VZ2A 4MV6A 4NZNA 5AJTA 5BWNA 4D8TA 5DSZA 4MJ7A 3AI2A 3KSZO 1I6WA 3BWXA 1EBUA 4JSTA 4UCWA 1L5LA 5T4BA 4FU0A 3VU0A 3IPCA 1QTIA 3QG1A 3ZBQA 2CLMB 3C15C 2FMHA 4DTIA 4P3XA 3IVGA 1M1YB 4JHLA 3K9NA 4UFOA 2AKYA 4BV2A 1ECBA 1YS9A 2C4VA 2IYZA 1ZXXA 2PS0A 3D7SA 2C2OA 4FFLA 2O2ZA 3U0VA 4F84A 4F7DA 2O57A 4KQHA 4M7RA 1H85A 1DEHA 4JBHA 3VTZA 4HB3A 1E0KA 2I8LA 3QK7A 4R1SA 1GDHA 3AGPA 5LXTA 3OJCA 3U44B 2WC1A 1J2TA 3MS2A 1Z6QA 2PL9A 4HDSA 4K1LA 4KMRA 4KX5A 4PYJA 4M53A 4EEKA 4N7BA 2IZOA 4EYKA 3P0IA 4K28A 1ML4A 3VUEA 1TYAE 5C52B 2SICE 3V1LA 4XDHA 1WAMA 3SQDA 1HWYA 2HSWA 1OH5A 2XNKA 1FFXA 1G7TA 1SEVA 3C87A 1JFTA 3P2MA 4JEMA 2P30A 4HTFB 4TTJA 5GM2A 1PL0A 5E6UA 4C03A 1QHXA 3U40A 2MSEB 3I9KA 2Q3FA 5KJ6A 1DHTA 5JCJD 4MQFA 4FSHA 2AXPA 5DGDA 3IKTA 3IVAA 4N5NA 4JI8B 1FX0A 1KK0A 4ZK6A 4S2UA 1O6GA 2G1AA 2DWOA 3HYRA 2ICAA 3DGEC 3F47A 1VHTA 2WR8A 3FFBA 5K3BA 4EF4A 3SVLA 3Q8WA 4MYDA 5HBGA 3LP5A 2VJPA 4BO5A 3TLMA 1EXNA 3NEJA 1CUZA 1I1NA 3QLTA 3P9XA 4IF6A 4PIVA 2CHFA 4Z49A 1VMAA 2B6HA 3EDRA 4AJNA 1GGJA 1TYDE 2CZGA 3M4JA 4PAOA 3SE7A 1R6XA 1RC8A 3AG5A 4TLMB 2XUGA 4HB2A 1I1QB 1I8TA 2NLOA 3KSMA 1MAAA 1DPFA 3A32A 3DE2X 4Q9AA 3RAFC 2FE1A 1JJAA 1HMYA 1K68A 1TM5E 2JJYA 1N8SA 4L5CA 1TU4A 3QF7A 3IUJA 4GKKB 1Y80A 3F3KA 2A0KA 5E6UB 1M1NA 2AD1A 1A4XA 1H8HD 4OJQA 3S5JA 1P2SA 3FDZA 1PFKA 2QX6A 4P32A 3AESB 4OATA 4XTCS 5AM4A 1E32A 3OZGA 1K1EA 3UENA 2OCLA 1YULA 1TT5A 3OM8A 4OAQA 2Q99A 2PX6A 1XKTA 2DBQA 1UM8A 3FYUB 4IF4A 5C8XA 1OLUB 1M66A 1ZGHA 2J5XA 2PH5A 3DVAA 5TQVA 3S1AA 1U04A 2XUPA 2IOYA 1PQUA 1OTHA 4PGAA 3TI7A 1ONBA 2XXAA 1WMEA 1L3IA 3SVZA 1B8PA 1R74A 2VNKA 4MKZA 3FOWA 3UN1A 5L7TA 4YP0A 5EGSA 4INPA 4FFPA 4JA2A 3Q8KA 5I4CA 2JGLA 4DSOA 1XTIA 1D04A 3A1CA 4PQFA 1Q7RA 1A72A 2I7TA 2VA9A 2JEZA 4CLHA 2OV8A 2NU6A 3FFXA 3Q1KA 4G5SA 4GR5A 4NL4H 4QNMA 3WWCA 5LNK1 2HBRA 3N0WA 3PNPA 4LNUB 4EY8A 2JFHA 2P75A 1UPTA 2J3JA 4WJZA 2GJSA 4C5CA 3GEBA 1Q1AA 4PXYA 1M2FA 2QPAA 4GZLA 1KOLA 1UBRS 4DQLA 4ZYWA 3BGIA 2WMOB 4DSTA 3KQMA 1KI7A 1JHMA 1S01A 3QUTA 2Z2XA 1CXZA 2P11A 4ON9A 4N41A 4NCBA 4QTTB 4EABA 2G72A 3H1PA 4ZVTA 1MNAA 5KTTA 2X0IA 3JALA 5HFAA 4ARSA 4QL3A 4Y1EA 4U2KA 1SPBS 4OHXA 5CA0F 2I2CA 4JLUA 5IHXA 4PGMA 2H8KA 4HWOA 5TDHA 2DR0A 3U7EB 3ZI4A 4AXXA 4FM9A 3U44A 1H6DA 1RSZA 3KOMA 3CVVA 2WUGA 3HI4A 1F2UA 4GG1A 2ETVA 2IDKA 1JHZA 3E15A 2E48A 1BQ3A 3MT7A 3NT5A 4IRMA 4DRXA 2HYDA 2PN1A 4K9MA 4NONA 1UPFA 3H19A 4WKGA 1PL7A 4QC2A 1E3JA 2HF9A 3GOHA 3QQ5A 5FJJA 1YIOA 4ZCIA 2VJMB 4ZI5A 1A8HA 3IEPA 4MVJD 4RK5A 3OX3A 3LTNC 3HUTA 2V98A 1ODFA 3DDUA 3QVUA 1UCFA 4BN5A 1F6BA 4BO2A 4QYIB 2X4GA 2BFPA 3O03A 3N8KA 1JRLA 3I1JA 5DHAA 4XVCA 4JI4B 1ENZA 1YQTA 4JSYA 1USVA 1TLLA 1X7YA 1QPBA 2OHIA 4CF3A 1Y9JA 3U7IA 4B3FX 1RPNA 3HABA 1KI9A 1HDZA 2D8MA 3G23A 2QWXA 1ULZA 4ENQA 5K6RA 2VHXA 1MC1A 3CZPA 1CVLA 4QJ5A 4F2HA 5KNCA 1QHHA 5CFNA 5JAHA 1N6LA 4BO4A 4JBYA 3AW8A 3K7EA 1JHYA 4YMWA 3TXYA 1EBFA 1LQTA 1OZ0A 1WMAA 1N2ZA 1E6KA 1FP4B 2WJWA 2ZITA 5DI9A 5JT1A 4P58A 1Q11A 4EG7A 3VPBA 2UVPB 3C70A 3DCYA 4MIYA 3I4CA 4TN1A 5EVCA 3U7HB 1TVEA 4FJ0A 4UUAA 5LB2A 3GJQA 4XLZA 3CPSA 5GGXA 3TLZA 4A2WA 4BXOB 2A0FA 1SVKA 1X87A 2UDPA 1MX9A 2YFQA 4QQKA 1FFBA 3OY2A 1THGA 4B87A 1Q20A 1PR1A 2NTJA 4TZ0A 5CD1A 4OMFG 3MWGA 2NT3A 2WT9A 4MR7A 4A8PA 4CI0B 1GPDG 1D0SA 4YJGA 3UV6A 2R7LA 3IKJA 5E1DA 2PZEA 4FYWA 2BJWA 2OBYA 5A4DA 1W1IA 3SP1A 2D2XA 4QUHA 4CEHB 1Q0PA 1R4NA 1Y37A 3PF9A 4YJKA 4UBOA 3ORQA 4GBGA 2ZJ8A 1RYYA 5FWNA 1WXWA 4JC5A 2GGSA 3OIYA 1RE1A 1REQB 3F71A 4ZQIA 4AMGA 1LBTA 2GN4A 4YI3A 2UYYA 4UD2A 3THYB 2FG6C 4ZA2A 2VK2A 4G0UA 2F1JA 4CM9D 2FX2A 3WV5A 3EG9A 1TB4A 4K9SA 4S1PA 1RWMA 1XK6A 5E3JA 3VC3A 1UEJA 4LGYA 5ADHA 1MU0A 4P33A 2XUZA 1KZ7B 3UJHA 2G63A 1V5FA 1UC8A 2FUG6 1GAXA 4FHEA 2WB2A 3FJOA 3INYA 3HYLA 4LEIA 3IA2A 4Y9DA 4UHCA 3TTUA 2Q41A 2H1OA 1PZMA 4FNMA 4LDQA 3EOZA 4AZ0A 2IRWA 5CFLA