3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
3A8DA 2ZKSA 5FBIA 4EFMA 5IRCD 4SGBE 2GMTB 4BLSA 5K8TA 1Y8TA 3LA6A 1ZLRA 2WWIA 3RXHA 2PUQH 3I92A 2REXB 1ZCAA 2FOGA 1NG9A 4Z8XA 2A30A 4HB3A 3DUXH 5TVKA 2SGQE 9ESTA 1T8MA 2BTCE 2ANBA 3L2OB 1T4UH 4GSYA 4QFMA 1ZM7A 1NIPA 2C2HA 3K53A 1QA0A 4LBZA 1AD8H 1E69A 1QR3E 2BVXH 4X8VH 2Y80A 1XJQA 2QMHA 5DI3B 2ZANA 3P70B 1BZXE 1B7XB 4RZ2A 4X2XA 4ACAA 4US2R 1OP0A 4C0QC 2DCUA 4TWYA 2C78A 1YR7A 2ZSFA 3BFKA 3RSLA 3EASA 1BITA 1GBHA 2YVUA 2CCJA 4NWKA 1YKTA 3C7KA 1O2PA 1CGHA 2NU4E 1YF4A 5D3MA 4OK3A 4OHYA 2GDEH 4AG2A 4WH6A 1QL7A 5EXMA 1COWA 4FINA 3CS7A 4UFEH 4R8TB 2VJ1A 5CK5A 1ELCA 3OIVA 3KKMA 3QF4A 2XCNA 1QHSA 2V6NA 1O2RA 2XEXA 4IVPA 3PIRA 1E4YA 1AI8H 1VTKA 4ZMAH 2B7BA 3RSOA 2J1LA 1OS8A 5L3QB 5BN5A 5P21A 4OGYA 1Z0DA 2BEJA 5FR2A 5C5NA 4BAOB 3SHAH 1HIAA 1GI6A 4RD2A 2VF8A 2F6RA 1NJFA 1V2UT 1AB9C 4LV5B 1S0QA 2WPHS 4HLUC 3I62A 1BO6A 3OTJE 3RC5A 4TLCA 1OP2A 4X6PA 3ITIA 1TONA 5A5GA 2JGNA 3SGBE 1Z0FA 3S69A 2WVJA 3RXVA 2XC4A 1OFHA 5ESBA 1O3YA 2XZOA 2J5XA 4KYUA 3CX8A 2D1JA 1TF7A 4VGCC 1EFRA 1G5PA 3ZVDA 2ZDNA 2TPIZ 3AK5A 4CEHA 1D9XA 1C2DA 2ATXA 1EOJA 1MBMA 4Y10E 4OI2A 1T3SA 3DOEA 1MO5A 1FUJA 4ABJA 4Q5IA 4OYHA 3VGCC 1UK4A 3Q76A 1CIPA 3QN7A 1PJPA 1OXTA 5AJWA 1XD2B 4URVR 3E0NB 1YE8A 2FU5C 1HV8A 4D4JA 1ANEA 4Q1CA 4AB8A 4LJ5A 1ARBA 1ZMLA 4B3XA 4Q9JA 5G4BA 4N0DA 4OK5A 1K5GA 1O3JA 3ZVCA 3O8RA 4B2CA 4KHZA 5KNBA 3UUZA 3EA7A 1MD7A 6LPRA 1OIVA 1FY4A 5HTKA 4NL4H 3WYFA 1PQ5A 2VH6A 1QHIA 1L1GA 4H1VA 3RXPA 4PHHA 2P16A 2IF2A 2YNBA 4G0NA 4GDFA 4CRAA 4MRRA 2XNSA 2EYUA 2RAPA 1UTMA 3KFXA 4H6TA 2FYQA 2HJVA 2FDAA 3IEVA 1WV7H 1OXVA 4JJZA 2QBYB 2Z9LA 2HPQH 3BIFA 1H8HA 4K8YA 2WPDA 5JI2E 3AKYA 1E79A 1QBOA 4UNQA 2ZC9H 1A1VA 3VB6A 2ZDKA 1TRYA 3REFA 3MFYA 4DLZA 1Y3WA 1LFDB 2J9RA 1XUIA 4I1SA 2F43B 2A9KA 1UCYK 5E7JA 4D8NA 2EI7A 4HLCA 1Z0IA 1ZSJA 3GEIA 3W3AA 2J34A 2GRJA 5A0AE 1V2MT 4KV9A 1DXPA 2A1DB 3SYJA 2ZEJA 4NCIA 4G01B 4C9BA 3BG8A 3H1TA 1O36A 1R0XA 4NCNA 4BLRA 3LBHA 2ZQ5A 2WWFA 2RGAA 5G3YA 2CVFA 3D65E 3UWIA 5HCIA 1ZD8A 1O3MA 2H18A 1QHHA 3AVZA 3A8BA 4PC3A 1R8QA 3KKNA 5KPJA 2GVFA 1PUJA 1OPXA 1A2KC 4D80A 2RGCA 1EZUC 4GFDA 2ANKH 4OQLA 3TNTA 3SJAA 1TUEA 3FWYA 1F5RA 3CBQA 4YC7A 2DWQA 1W4RA 1XPUA 1DICA 2W7UA 2EFGA 3RXKA 2OBQA 2BOHB 2YOLA 2QI9C 2VHCA 4I81A 4DUGD 1N0WA 1ZPBA 2VHQA 4NE2A 2FX6A 3AAVA 1OH6A 1FIWA 3SHFA 3A1UA 2QTHA 1W5TA 1FN6A 1C5ZB 3UR6A 2Q6GA 1O3EA 1N6KA 3ZZTA 1LDTT 3VX4A 1RJXB 2REBA 4H1UA 4QGGA 1KI3A 2BM1A 2WKRA 4A36A 3NC1C 2ANWA 2ZRGA 1G8PA 1N6RA 2ZI6A 1SI5H 4YMSA 1JBKA 5GCHG 3GCHC 1ANKA 2QA9E 3QTVH 5DPAA 1S84A 5FBVB 2H1UA 1UMAH 2FIRH 1UDXA 2CE7A 3QJYA 2P65A 1W0ZU 2QP3A 3AW0A 221PA 4NSVA 5JHGB 4G5GA 3C4JA 1C2EA 5K8UA 4FUFA 1KAOA 1GMDF 1P61B 1KMHA 1TNJA 3LD9A 1MZAA 4JL5A 3A80A 4DIIH 1VGCC 3RXTA 1DAKA 1BJUA 1WTGH 3CWQA 4I1OA 3HU2A 1PPGE 2ZIAA 1NVVR 3MH5A 1T5IA 5DJ7A 4LUCA 1G30B 5H70A 3W34A 5EQTA 1LKBA 4ZIRB 1HJAC 4Q7LA 3UG7A 1E2KA 1W7GH 2QXGA 5CLLA 3GLFE 1YLCA 4PSKA 2QAGC 1YHNA 1GHBG 4OM9A 4FXPA 1MABB 4WIAA 1AB9B 2XNDD 1ANCA 3ATMA 3D8BA 5FUXA 3VKGA 5TCCA 5C1UA 2Q9BA 2WJJA 1GBCA 3BBPA 2WPLS 1II0A 2ZU1A 2CK3A 2TRMA 4IS5A 2AWOA 5LBIA 3PUWA 3BTKE 2ZTYA 1TX4B 4ITRC 4RZUA 5FI1B 2EU8A 1JAHA 4E05H 5M04A 5HKKA 1HTWA 1TOMH 5JB8S 2NO1A 4AYXA 4JZEH 4CIDA 3FOZA 1E2NA 1YPEH 2HF8A 3QXXA 3PLPA 1A61H 3A7WA 1CA8B 1EAWA 4M1SA 4ISNA 4K3JA 3CNLA 1OFIA 4DDWA 1U9IA 3THOA 3QUSA 2FXRA 1P2QA 2PTCE 3VHLB 3GYMA 3E2IA 1F6BA 1NN1A 2JDIA 2OINA 2GCTC 1FIZA 1FZQA 2ZR9A 3ZZ9A 2RGXA 2GCPA 3IPYA 1O37A 3VXFH 4INHA 4SGAE 2FF7A 5HM9A 3RXUA 3QXCA 4IC5A 1H8ED 4ZKDA 2JJ2A 3GLHA 1C5MD 2OCAA 3GQBA 4R98A 2V3HH 2G4TA 2QN6A 1DLKB 1XWIA 3M7UA 3D3QA 4GHQA 4CRWB 3A84A 1QY6A 3L0IB 5FUVA 1DUAA 2R3UA 3AF4A 3K0FA 4NCKA 4JMYA 1THPB 2CF9H 4YXWD 2OUAA 4AURA 1PJRA 4C4PA 1KK1A 2XYAA 1AZ8A 4M2LA 1HBTH 1L1NA 2HT1A 2ZE6A 1J15A 2CK3D 5B6OA 4ISLA 2VH5R 1GVZA 4RN6A 2OC8A 2WMNB 3GP8A 1EK0A 3THXB 3RXSA 3P1JA 2CJWB 3I4LA 3S1AA 2IL1A 2ALVA 3DT0H 1GI5A 421PA 1HUQA 1Z6JH 4GAWA 5G41A 4HYYA 4BWYA 5TXGA 4TMWA 3RUOA 4DIHH 1FAXA 3ZZBA 4FUGA 4D4LA 2GILA 1QTFA 2HJGA 1P57B 1T0HB 4MGIR 1SGFA 3OEED 1QBNA 2ZUCA 3EZ6A 2VWLA 4F93B 3GCOA 4M0LA 1GHXH 4UJ5A 4A0RA 2GJAA 1PQ7A 3LH5A 3A89A 8ESTE 1CKEA 4TYQA 1NROH 3E70C 3LX5A 1G17A 1N5LA 3FKQA 5H8WA 2ANMH 1ZTJA 1BRUP 2I6QA 1OV4A 4AGJA 4Z51A 4J0QA 4INKA 4LZZA 2QAAA 2ZJOA 3SBKA 1LVGA 4I7YH 4AKGA 4DLTA 2A5JA 3LH3A 1ZVQA 3E0PB 2F9UA 4AGKA 1XRJA 3ZVNA 4LCBA 2G5NA 4GPTA 2BDYA 1MKWK 2VSXA 1GJ9B 1Y3YA 3QKRA 4AKIA 4NYMQ 3SI7A 2ZRMA 4WW0A 4I31A 4EPTA 4PC2A 1MTNC 3ZV9A 2FN4A 2I3BA 4IW3B 2ERXA 4DXAA 5I46H 2FOCA 2Z43A 3DKVA 4GP7A 1A5TA 2V7QA 4A6LA 3VMFA 4BZPA 4TYDA 1E98A 4D4KA 4YT7H 2NMVA 2F9BH 2ZRKA 1Q1QA 3PO1B 2RGNC 2YHSA 3W5JA 1C5YB 2W6ID 3K0AB 2AXNA 2EFCB 3FFGA 1MBQA 3R9WA 1YLDA 1ZGIA 1CT4E 4YO9A 1S83A 4HDCA 4C0SA 3ZV8A 3E1SA 5SZIA 1JJ7A 1O2KA 1H9IE 1OF1A 2BKEA 2QY9A 2BBTA 1EFHA 1DPFA 1OHHA 3U3OA 4ISIH 4GCHG 3M61U 3HPRA 3SHWA 3U60B 1D2EA 2AFHE 5GJVC 1P60A 1UAAA 2A5FA 2ZYUX 1GL7A 3NHBA 4QGFA 2A2QH 1RRGA 4O3MA 1XTQA 1HURA 1IQKA 1FNMA 4INLA 1MTNB 4JLKA 4B3DA 4DSUA 2ZECA 1MO6A 2AN9A 2Q0HA 2AMPA 1T8UA 4D9RA 2QNRA 1C1PA 3VR6A 5KNDA 4E09A 1CJMA 1W2KH 3LOXA 4R7ZA 2AGIX 2W6IA 2O8WA 5FUWA 3ZVLA 2CGAA 1MQ6A 2EEKA 2ZRIA 1EFUA 2WJIA 4G3XA 4NYJQ 3EW9A 3CF0A 3ZIAD 4HAZA 1FNIA 5KSYA 2IS2A 1AZZA 2JLSA 3KUDA 3S0NA 4Y0ZE 4GRAA 2AGEX 3IIMA 1UVPA 3SQHE 2YJTD 2C5LA 3I8XA 2QYIA 2FFHA 5DP3A 3VR2A 2WKQA 3SZNA 3VQTA 3MH4A 5HPYB 4RZ3A 4ABIA 1TGNA 4OJQA 1E38B 2WWWA 1CR0A 1ID5H 3PQCA 1U6QA 5JBCS 5J4YA 5FXLA 4I1VA 3KQNA 1W36B 3RXLA 5FPTA 3FZZA 1XKAC 3JVVA 2QV1A 2ZRCA 4X8SH 1D3TB 1AGRA 4ESHA 4OS4A 1KI6A 3EA9A 1SVOA 5HZKA 5TARA 1S4QA 2BDTA 3WP1B 2PWXA 5LB4A 3PV5A 1Q1EA 4AB9A 3SYLA 1Q2WA 3URCA 2SGPE 2F1IA 1BB0B 3PEWA 3W9YA 3EZ9A 1VCPA 3W6NA 1QJ1B 1GJ4H 4UJ3A 4LZ4B 2HLDA 4DLUA 2C98A 1BT7A 5CDFA 5EP1A 2PEZA 5J4QA 4B6FA 2JIZD 2W0SA 4IFBA 4ZCLA 1BQYA 1ZAKA 2HLDD 3OFND 3WXMA 4QNRA 4PAOA 1N5JA 3SU3A 4XVQA 1BA8B 2R6AA 3V13A 3SHCH 5CHAB 4Y8YA 4ZV4A 2B8OH 1YZKA 4TQUS 2F1RA 1Z6AA 3LC5A 3BH0A 2F7SA 4OQXA 4GBMA 2J7PD 3KL6A 3GLIA 1A5HA 2ZU4A 2Z9IA 1PYTD 3TLOA 5EJEA 2ASEA 1EWRA 3SORA 4C0HA 5JWOA 1N5KA 1U2RA 2J3EA 3TJOA 2ZVQX 4J1YA 3UNSA 1W0KA 3ZZ6A 3RXDA 5FOSA 2XOKA 5CB8A 1Y59T 4DT1B 1WAYB 2VVCA 1E0AA 5DN6A 1GJ8B 2CHVA 8LPRA 4HAYA 4ZAEA 4AC9A 3UATA 1PQ8A 3QI2A 4IFEA 1EB2A 2HXYA 2ZPRA 3JVUA 1RRFA 1XD9A 4NFFA 1MT0A 3SV7A 2CXVA 2FPMA 4I33A 1X8LA 3B1WA 2ZCHP 4UEHH 4BEJA 1EB1H 3NTUA 4RKOB 3BEIB 4RSPA 5HE8A 1T8NA 3E6PH 1AFQB 1S9DA 3BE4A 3AVUA 1F2TB 3MMGA 2A7HA 2P3SA 4U2WA 1FP6A 1O3CA 2A4GA 3NWUA 3VR5A 1SHZA 2VIIA 4CEJB 3BTTE 5DISB 3CX7A 1PPCE 3FGNA 3SQWA 1Q12A 2PL3A 1YZUA 3MWKA 2WINI 4A4DA 3GLIB 1L1JA 4WXVA 3QLPH 4LV6A 3E8LA 4H6SB 1T91A 4RZXA 1K2I1 2YC4C 1EJNA 4A0FA 1FZZA 1CR4A 3LVRE 3A6PC 4QM7A 5KTYA 1ZTLA 2JAQA 4C2TA 2OESA 1P2VA 2FWRA 1VPLA 1AGPA 3OYPA 4PHGA 3IHLA 4MYCA 2B8WA 2B0FA 3O8BA 4NWLA 1E9AA 3CRW1 4FW9A 2NU3E 2KWIA 3TK6A 1Z8RA 1E2JA 1DE0A 5FPKA 1Z7KA 1OYTH 1QHYA 4LRWA 5K8LA 4JYTA 2G5VA 1G3MA 1ESMA 2BKUA 1NRJB 1QHRB 2AL7A 2Y5FA 1YPMH 5FFMA 1QG4A 1T4GA 4LYFA 3A7VA 1DX5M 1X1RA 4CHAC 3V4FA 3CIOA 1SR5C 1FNNA 1K1NA 3IO5A 1NP6A 1TQ4A 1S5SA 2PCJA 3FKSA 2GZ9A 1ZRKA 2VBCA 2AS9A 4KI0A 3FYHA 1NT1A 5EG4A 3FFAA 4Q7MB 1DBSA 2A2ZA 4LJ7A 4DIEA 4WF8A 1KDRA 1IONA 2RG3A 2FS8A 3FHOA 4D2IA 4B1TA 5JJKA 2IXEA 2PW8H 1SXJC 3HK6B 4U30A 1W12U 1DWDH 3RVBA 4V02A 2BLQA 2VL7A 1X6VA 3G0HA 3SJIA 1Z8FA 4RD6A 1Z1JA 4UQOA 1TGTA 3IEUA 4QNMA 1LCYA 4TMZA 1GHAF 4AFZA 4MTBA 1F7ZA 2QSYA 4DCTA 3FP7E 4JZIA 1G41A 2LNCA 4DHEA 4DLXA 3RS5A 3U6BA 3N2IA 1PPBH 4B32A 1TU3A 3MSXA 2ZE7A 2ZIQH 3M3TA 3EQ0H 2OFOA 2FOLA 1KXBA 3LU9B 1IOZA 2O0HA 2JA1A 2ZI9A 2FOEA 3SV8A 2TIOA 7ESTE 3AVWA 4NIYA 3UQVA 1OYYA 5L3RA 3HYTA 2HNTE 2NZJA 2XWAA 3CRMA 3UIRA 2OCVB 5DIFA 1XKBC 5DG6A 2NG1A 3EWSA 3ZS8A 2KBFA 4RJLA 1LF5A 3CNOA 1F2UA 2CE2X 2VA8A 1K21H 1E35B 1M7HA 2XC0A 2ZPSA 2ZYTX 2CXXA 2ZJZA 1FOEB 1JB1A 1OSSA 2H1LA 1C5XB 1G21E 3A86A 2G83A 3LO5A 1O5FH 1E99A 3EAQA 3BTQE 1JRSA 1TPSA 1OIWA 1NKTA 3TPIZ 1PLLA 5HKKD 1VCOA 3GCNA 2ZF0H 4A1TA 4XFQA 4F4IA 2KJQA 4XWKA 3P8FA 3KN2A 5DGXA 2VB0A 1SOTA 1P6XA 3PEYA 4C0BA 4TT3A 3ZVRA 1DT2A 1JMOH 2V55B 4HLQB 2O8TA 4LBYA 3UIEA 4B3FX 2W7SA 1P9UA 3MH7A 4Y0YE 3Q5EA 2F1HA 1FP7A 1XF9A 2FX4A 1TNDA 4E5UA 5J4LA 1IQJA 4TY7A 2WYGA 1AKEA 2HCBA 2PBRA 2UUJB 4JKYA 4HZIA 1E1QA 2OBMA 1WF3A 2H2ZA 3MH6A 5C18A 3AV0B 1OH8A 1BRCE 4P33A 3B13B 3TKLA 4BEBA 2G52A 4GL2A 2FOAA 3KJIA 1EAIA 4LOYH 1MUEB 1AS3A 1E79D 2WPDD 2O8EB 4LC1A 4FMCF 5JS7A 2GMTC 2PHBA 1ELBA 3L82B 5D3QA 2H7VA 5GADl 2J38A 1O5EH 1TWXB 4HAVA 3IPXA 3GJ4A 3SE0A 3E90B 3RU4E 4FU9A 1W0JA 3CF6R 1MH1A 3DMDA 2GK7A 2D8WA 3BTEE 2AD5A 2RMKA 2BX3A 1DITH 5FOUA 1EAXA 1Z2AA 1NESE 1US8A 2BQWB 1BOQA 3ASZA 5LPRA 1BYIA 2ZU0C 1TIOA 1IN7A 2EWVA 2FZ4A 2ZSEA 4DB2A 1KO8A 5HGGA 3H09A 3HKJB 4XWAA 2D7CA 5DO9A 1DY8A 3T27A 1P06A 1AUTC 2BY8X 3PG5A 3NXSA 3VXEH 2JEOA 2ZI4A 4ZKEA 3G82C 2VTKA 4Q4AB 1G2LA 1H4WA 5EQSA 4XTCS 1BMLA 1J90A 4TYWA 1LB1B 3KQKA 2VINA 3IILA 5HR5A 3QKSA 1GHVH 3MNCA 4TY6A 2GBLA 4FD2A 2IBMA 1QRXA 4C0LA 4ASHA 2WV4A 3LGTA 2Q3HA 4XE4A 3TJZA 1TPAE 1GMHF 1GI1A 2YYZA 3RXGA 2GXSA 1W7AA 5EUQB 1FXYA 4NSYA 2CJWA 1WBBA 1RTFB 3RRZA 2OC0A 1WRBA 4QHYA 1EXMA 2I4IA 4OHWA 1FX0B 3SU8A 3WY9A 3V7TA 4QGAA 1MOZA 3A8AA 1C2MA 5CDFE 9LPRA 3A7TA 1AIXH 3VB7A 5C4MA 1GBBA 3J81k 1GJ6A 4I8KA 1ESTA 3T1VA 1LY1A 1Z8JB 2OQ5A 1E2MA 2IJOB 1EX3A 3WNBA 4U00A 4BLPA 1XCGB 4O0MA 1OKXA 3B2EA 1NN0A 1WTHD 2QROA 3DKPA 2D4HA 1EG7A 4DCUA 1NBMA 4O3UA 1Z5ZA 1EUFA 1ORFA 1YCPM 1ZPCA 1MKWH 1KJZA 4TTRA 2XBYA 4AIIA 1QB6A 3C27B 1RYFA 2ZR7A 5EP2A 1OWEA 4NYJR 4AYVB 1B23P 1HH4A 2V4ZA 3PEVA 1XXFA 1O31A 4KXFB 4B2BA 1VKJA 4Y7BA 4DUGA 1OKKD 2ZR0A 1H65A 2BV3A 1C4U2 2Z9KA 1ZPZA 1QL9A 3PVSA 4BPBA 1UTLM 1NIJA 4N3NA 4EQ6A 5B30A 3KB2A 2LPRA 2OAP1 3GY5A 4MPVA 2HV8A 1UCYH 1ZM3A 3PENA 1RZ3A 4JYVH 3BB1A 3T2NA 1SVMA 2PJRA 3K0AA 5AVDA 1M2OB 1NTPA 4M1MA 2YOHA 3KJGA 1E2LA 1C1QA 3THYB 5FL3A 2CHAC 1ZIOA 4DEXA 1ZNYA 3BIUH 1VR1H 3RU4T 1DO2A 1AK2A 3GJXC 1P75A 4OKSA 2OFXA 3OEHA 3UWJH 2ZROA 4MITA 4NA8A 5GDSH 3IKJA 1ETRH 3GYLB 4FUHA 3ZVMA 4W5HA 4UXHA 1TRMA 1RIFA 1GGDC 1GJDB 3FMIA 1ANDA 1KJWA 1Q0UA 1HJAB 1YPGH 3PO1C 4NMMA 4V0ME 3QTOH 1VJ9U 1JALA 3RXFA 2GCOB 3K70B 2XNDA 3P4XA 5FAHA 1ABJH 4L9WA 3AF2A 3D7MA 5AFYH 5CE1A 1CF4A 1GCTC 4X2VA 3DOFA 1G3RA 1SQAA 4PPQA 1UHBA 2AKAB 5F8TA 4JT2A 4BNRA 2VHTA 1WYKA 1YZGA 1K1JA 3VHXA 4JLMA 3GJ8A 1DANH 4BAMB 4MNWA 4Q1DA 4Z8YA 3SC3A 4H42U 5AUOB 5C4GB 2BDHA 1QRAA 2H9HA 2PX3A 2UVQA 3IG6B 4M9XA 5L8VA 1N8OB 2IYUA 1XTKA 3W8RA 4OS7A 3LC3A 3QBVA 4RY2A 2GF9A 4ABYA 4V0LA 2ASUB 3D23A 1VYVA 4AKEA 4P32A 1C5LH 3A37A 1L2EA 5JWRA 2NWNA 4ZHMU 4RCYA 1Y63A 1GBIA 4Z54A 5J4VA 3M5OA 1DUEA 2ZFPH 2VWMA 4JT4A 4Q80A 1NF3A 3QF7A 3FANA 1N1LA 1SVKA 1V2PT 1UPTA 4HZUB 2FPKA 3B5JA 1ZIPA 2JH5D 3PWBA 7LPRA 2D74A 4D26A 1UKVY 4B3BA 5FBEA 3MFJA 2PMDA 1IJFA 2DE8A 1JNYA 5EPNA 2B7CA 2A7CA 3CR8A 1I4TD 1MU6B 4L4UA 3NCLA 3NG1A 2OBLA 1XDBA 2HUPA 1V2TT 1FLEE 1KYIA 4KVGA 4DLWA 3A88A 4A0HA 2ORIA 4LK2A 5L3SA 2QGNA 2HALA 1C1RA 1P9RA 2AXPA 4JLOA 4HDQB 3REGA 3TQFA 4L9SA 1NZQH 2FGJA 3TJNA 4FN5A 3RDPA 5A8YA 1KZGB 5A09A 3MO6A 3W95A 5A0FA 1T31A 3CPHA 5HZHA 3THWA 1PLJA 2OCYC 1XTJA 4A8JC 1UBFA 2PZEA 3TAUA 2FA9A 2X1VA 3NDPA 1V2NT 2ZVPX 2PEYA 1P2JA 1GRQA 1RYHA 3SI3H 2XAUA 3TVJB 1KNQA 2PT7A 2H5EA 3TE6A 2ZGCA 2ZDLA 4LJ6A 1SGYE 4AFSA 4BFTA 4EPVA 2VGCB 4KAXA 1VYUA 2R2WU 1EFCA 4Q9HA 2GZ8A 5E4FA 3B9PA 5DYGA 1WDTA 2DUCA 1Q20A 3EC1A 4Q7XA 4I99A 2XXLA 1HAXB 2XBVA 3B78A 2TGPZ 2AKYA 2WWYA 1EZQA 4D25A 3BH6A 5UKDA 3U44A 4DW2U 1DY9A 4KTUA 2BY5X 1K6MA 4TLAA 5JPMH 2BDAA 4URZR 1HXFH 1MZDA 4P4SA 3DHWC 3SYNA 4IKEA 4Q01A 5JMTA 1G3DA 2WUCA 1W10U 4BXWA 3BFXA 3BB4A 3NPSA 1XEXA 2FZLA 3MMPA 3LONA 1BTZA 3MYWA 1KAGA 1A0LA 2CF8H 4IDQA 2O8UA 3PLBA 1E2IA 3LXRA 3PM3A 2A45B 1OB2A 4RSGA 3OIYA 1E9FA 4LHXA 2F9NA 1OH5A 1EFTA 2WSSD 5GPIB 3TGIE 2QQ0A 4PQFA 5KUTA 3TSZA 2FO9A 2ZHFH 2NU1E 1BTWA 1J8YF 2KSQA 3DMNA 5BRRE 1ZYOA 1Q31A 2R0KA 5CMXH 5DNYB 3PUVA 3RS0A 1T9HA 1A4RA 3B1YA 5HCNA 5FTMA 1B0EA 4EQ6B 2P94A 1KK2A 2ZRLA 4VGCB 4PC6A 4GVUA 1GHZA 4LJYA 4X6OA 2GBLC 4F4JA 2VP5A 4D0GA 1QNJA 2O8DA 2GZAA 2A5YB 2V1XA 3UXMA 1NBMD 2ZJAA 4KKDA 4KELA 2Z9GA 1AZTA 4CYMA 1ESNA 2PGQB 3SNCA 1THRH 3B9QA 4G5RA 1UTPA 1S3GA 4D76A 5LPNA 1D6WA 1LNZA 4WVPE 3RNLA 1YU9A 1GL6A 2ZSAA 5H1YA 2K1QA 3U69H 1O2SA 1G9IE 3F9FA 1FV9A 1FFHA 5EGMA 4OS5A 1HPGA 3DM5A 2H16A 2IYTA 4S2EA 3RU4D 4NCJA 1GBMA 3GJ5A 4PR0A 3KQBA 4BLOA 1HYQA 2E87A 1RKBA 1IAUA 2GCHF 1UVTH 4ARZB 4WBSA 3T62A 3AB3A 1MV5A 3U4QB 3CENA 3EC2A 3ZYDA 5ABWA 2WSMA 4AI6A 1W4BA 1MH0A 1U0JA 4YMUA 2AEIH 5JWHA 3K6ZA 3BTDE 3CRRA 1CS4C 4Q18A 2C8YB 5JRJA 4JVSB 3KCGH 5FBQB 2B92A 1P12E 4X6NA 5KU1A 2KAIA 3TIUA 1G6OA 1QRWA 4BAQB 4P4UA 1E9EA 2BMDA 5CK4A 4DT1A 3M6AA 3V9PA 3L0OA 1LPZB 4IOJA 4JLBA 4JSYA 1E9SA 3R9IA 2G51A 3K6YA 5G3ZA 2X77A 2CNWA 1Z0AA 1O3PB 2IYRA 3OAAA 2ZU2A 4XOIA 1X8KA 1R8SA 2GAAA 1D6RA 1G4AE 5FOTA 2BLOA 4TZ6A 4Z1MD 1W4CA 2HYDA 1FMGA 1IHUA 1QF9A 4QBFA 4FMBB 4YTAA 5DSZA 2BYAX 1R0WA 2XTZA 1Z6EA 1GAJA 4A6XA 1MRNA 3SV6A 2AIQA 1Z0KA 2QQEA 2BCJQ 1II8B 4ABHA 2VHJA 3S1AB 2VP4A 3GFTA 3VB4A 4DGJA 1E94E 1GCDA 3FFBA 3RANA 2ULLA 3GCTF 3LPRA 5EXLA 2N42A 2QXHA 1XD8A 3HP1A 4HB2A 2ZRBA 1BMFD 1C1MA 2O8CA 3F6UH 3AVYA 3THWB 3BN9A 1ZRHA 2B7DH 1HT1E 5K8IA 4DC9A 4E03A 4AG1A 4A1XA 4B47A 4LJAA 4PO8A 1RJ9B 2TGTA 4D81A 4KJZA 2G55A 1XFAA 1GDNA 3GY4A 2SNVA 4TYYA 4YM9A 3UREA 5JDUB 3ZS9A 1V2QT 5T1VA 1GBLA 3SN6A 5HE9A 1P03A 5KDDA 4GNKA 5DP5A 5FTLA 2GEUA 3RS4A 3A1SA 1ZSKA 5GJCA 1H8DH 5FX5A 1E0KA 1G8FA 3IDQA 4D7GA 1PZNA 3EWAA 3H2YA 1G6HA 2XITA 4MYTA 1BJVA 4Y8XA 1W8BH 3PITA 1O5DH 1HQCA 4B3GA 2P93A 2WZQA 4CBNA 2BEKA 2RHMA 4WMDA 3A4MA 4QM6A 1ZMNA 3QKUA 2C9OA 2JASA 4AWXA 4X8OA 2P5TB 3TNSA 5DO4H 4F7WA 2C93B 3KIDU 1T6NA 2QRZA 1DSUA 3MWJA 4G5QA 4K2YA 2D3WA 3HGPA 4AFUA 3SDZA 4MQBA 2OO7A 1O2NA 4XBDA 3TJVA 3O8DA 4CH8B 2GEVA 4PPNA 1QZXA 2WWXA 2YKGA 3F9EA 3LBNA 5TB5A 1NN6A 1UEJA 5L6NH 4URXR 3PEUA 1V5WA 2QG6A 2R8RA 2C96A 5EE0A 1QQUA 3W6PA 2F4LA 3A1VA 3QEOA 2BQ6B 1ZM2A 2YINC 3TH4H 1XXDA 4URYR 4UKDA 2J0UA 2Z83A 3QNUA 3NKKA 1ESAA 3RXOA 1XUGA 1SGIB 4Q9LA 3A4NA 3HATH 5K7RA 5DI9A 1EQ9A 1C2GA 1QJ7B 3PB1E 2WBLC 2Z0MA 2A5DA 4TPIZ 1ZUNB 3W6OA 5JSZA 2VEDA 2L0XA 1D3PB 4LGMA 3SNDA 4K1TA 5J4SA 3VB3A 4JMPA 4AOQA 3P8NA 2W3IA 2C4FH 4TT3D 4BFYA 1HQYE 3UQOA 3BB3A 3RXBA 3T1QA 5JLJA 3GPLA 4XBBA 2HOBA 1GILA 3AM1A 1WP9A 3GD7A 5TCAA 3MNSA 4F49A 1ACBE 1J16A 4V03A 3QX5H 3ATIA 3SU1A 2OK5A 1NMYA 3RLYH 3K1JA 4CEIA 3DZDA 1VCQA 3GLGB 1HB0B 5A4JA 3T26A 1J7KA 5L3VA 4US1R 3SJBA 3QBTA 1UO6A 3BTME 3U7EB 3ZZDA 2QMOA 1VG9B 4KVAA 1P4SA 1HGTH 1QA7A 2DFNA 3B82A 1XMJA 2WJYA 2QP4A 3UNQA 4Q7KA 4XWOA 3MLEA 1DAHA 1D8TA 3MUFA 5JS8A 1SGQE 2FI4E 4J2YB 1U8YA 5JFGA 1UTKA 2W3KA 2XW9A 1BIFA 2THFB 1ZINA 2WPIS 3LVQE 1EJMA 4IOLA 1F0UA 3EA0A 1KLJH 3A82A 1OWIA 1U0LA 2DY1A 4Q4HA 2HNTF 2OE2A 2YWHA 2UUFB 2YC2C 4MKFA 4IN2A 4N0EA 5KDLA 2G3YA 3WHKA 5LPFA 3PMHB 2PKSB 2R65A 2XXAA 1QBKC 4D6PA 1NVUQ 3D31A 1CJTC 5A8ZA 4JL8A 1O3BA 3U2QA 2PX0A 2FV8A 2Y82A 1DS6A 2WJGA 1YYY1 2IK8A 1T0JB 4BLTA 4FIDA 8GCHF 1ELAA 1O87A 5E3HA 3R9XA 2OUKA 4M9ZA 1XUHA 1GG6C 1SXJD 3K09C 4PO9A 3GFOA 3GICB 2I1VB 1LPKB 3ATKA 2ZREA 5F2EA 2QP9X 1JEDA 1C5TA 3TH5A 1MU8B 2HDNB 4GCHF 1GG6B 5A2MH 2C9YA 3KZ1E 1IQMA 1EPTA 5C67A 3PUYA 2Q21A 3K0SA 1SZPA 1YBWA 4FMDF 1LO6A 2OXCA 2GV6A 3K9NA 3MWIU 1VIYA 1FW6A 2ZRDA 2I6SA 1WQ1R 2ZYWX 3A7XA 3I77A 3PYHA 1W0KD 3ZYEA 3SJ8A 1C1NA 4P31A 2F9VA 1E2HA 3I61A 3RRYA 1XU4A 1Z06A 3C5HA 2FEMA 3M37A 4LI0A 2FPLA 4NGAH 3RXEA 4FCTA 1JIRA 1GBFA 1X3SA 2OBNA 3TRFA 3TR5A 3KFVA 5A0CA 4I4LA 2ZTXA 1ZU5A 2IA5A 4BAHB 4Y71A 2IX3A 2NU0E 2G0TA 3ELAH 1P3CA 1GUAA 2B9LA 1K1MA 3VAAA 4MH0R 2BVSH 3TK5A 3NIBA 4OS1A 3CX6A 5FPHA 3ADCA 1QRZA 3FVQA 2BMFA 5LD2C 3S9AA 2GJKA 3UKDA 1VECA 1XVOA 3CM0A 2ZHDA 4W9MC 3A4LA 3PMAB 4CEHB 3WYGA 5JEDA 5BWMA 1PYTC 4JYUH 2GCHG 4DSOA 1TQ2A 3D62A 3HDTA 2WYJA 3GJ3A 1O3LA 1Z07A 4D9QA 3SU6A 2JDID 1O2WA 1WXQA 1Z29A 2P8OB 1COWD 1XPRA 3TSWA 4ISOA 4DLRA 1GWAA 2FODA 3PMJA 5DP9A 1DE7H 4UONA 1BTPA 1C2JA 1P02A 5DH9A 1HAIH 4JYCA 1MAXA 2TGDA 5DK1A 1L4DA 2GVZC 1TNIA 1NKSA 2B6HA 1C5PA 3AKDA 2BX4A 2P3UB 3K0EA 3QXSA 2WHXA 4G1UC 3BTWE 2IW3A 2YWGA 3DFJA 4KITB 5EE9A 4TMXA 1YPJH 1K1PA 3UFAA 3I3SR 2G1KA 4EJSC 5EOKA 3RLFA 3CONA 1TB6H 1VITF 3ICEA 3EA8A 2PLFA 4LPKA 4CRCA 1GITA 4MA4A 2HEIA 2O8MA 4UFFH 1ELGA 2B8TA 3P92A 1AGJA 3OEEA 5EZ6B 2N46A 3BGWA 1GKYA 4ZHLU 4MDFA 1DTSA 3PUZA 1IY1A 1R5OA 4OS6A 2NIPA 2P5SA 1YZNA 1TNKA 1NJGA 1JQLB 4MPWA 1MTUA 1G20E 4ZIRA 1O2QA 1XXHE 4RD0A 3QPUA 3QQ5A 4K69A 4QHTA 3EPHA 2ZRNA 2WOJA 4PHTA 1YPHC 4BTIB 2IYXA 1K5DA 4BE7B 3IBYA 2IHYA 4QC2A 1OOKB 2AD1A 1AQUA 1ZBDA 3WY8A 4YDHB 4KGAA 1DPOA 1F60A 4UDWH 4JS0A 1TNGA 4B34A 1OT3A 3QY0A 1D4PB 4JYBA 1JPJA 2OD3B 3X1DA 1NN3A 1KSHA 3P8GA 1FY3A 1RRPA 3CH4B 2VP9A 5HMAA 2FH5B 721PA 2VNTA 2RA3A 2ZI5A 4WOPA 1A0JA 3DFLA 1IN6A 5PTPA 3A8TA 4ESVA 4I32A 2BBSA 4JVLA 4L5BA 1PV4A 2WOOA 2J7PA 3SU4A 3T15A 4B2AA 1WBDA 3KQHA 1K1IA 1VG0B 1TTTA 4A2PA 3T35A 6Q21A 4Q7YA 1LHCH 1Z22A 4D82A 2OFWA 2G4UA 2VWOA 1P2IA 1WCV1 1ETUA 4CGZA 2WJVA 2KBEA 1AFEH 1IQHA 3ZDQA 4DVGA 2GCTB 1CT0E 3UNRA 4Q1BA 4TSFA 2NU2E 3BV9B 3U5ZB 4HZHA 3URDA 4H4FA 3QG5A 1OFTA 4LOAA 1YZLA 2R3YA 3U3RA 3I5XA 1UCYE 1TPZA 2Z4SA 4F38A 3BXZA 1AVXA 1BHXF 2A4OA 4IXNA 1SLVB 3PROA 2SHKA 2ZPQA 4NDZA 1N25A 2EYQA 2ZFFH 1DG1G 2F3RA 4QKQA 2ZG0H 2XSZD 4GUXA 2XBXA 1H8IH 4L15A 1V2OT 4UNRA 3NEYA 2QMEA 3AW1A 2B5TB 1MD8A 1M8PA 4D4MA 2JLRA 4R0IA 5C46F 2JJ1D 2CNWD 2A5AA 1OE0A 2OILA 1TABE 2IOTA 3LIWA 4R2HA 4B43A 2QN5T 1VDZA 5BN4A 4YONB 3KTAA 4AZ2B 2H8KA 521PA 2BDIA 1UJ2A 3A81A 2ZDVH 1TYNA 3NXPA 5FOWA 4HTCH 2BOKA 3GLFA 3GLGE 1UDWA 1O3IA 2UWOA 2BZAA 2QTFA 2VQSA 2XZLA 3DA9B 4TYPA 2RHDA 1D2MA 3ODFA 1Z6XA 1NLYA 3EX7C 1SOZA 4C7OB 1XD2A 1C1OA 4FMDB 5FH9A 4P4SB 1IAQA 8KME2 2J0SA 1HYLA 2V54A 3C15C 4M1YA 3VGCB 4Y6DA 2PKAA 1P3EA 4D0LB 1C2KA 3DHKH 1V2RT 3T5FH 4LJ9A 4X8TH 3MHWU 1G5RA 1FI8A 1QHGA 1OW3B 1WQSA 5DLQC 3LGIA 2ZEBA 4LSGA 2V3CC 4LDJA 4JLAA 1MKYA 1P3JA 1NY5A 4YESB 4HFPB 3LKWA 2XRCA 5AK0A 4O2RA 2BJVA 1QURH 5J5CA 3E3TA 3PV2A 2W26A 1EP6A 4JLJA 2O8DB 2QENA 1YRBA 3L8YA 3SJOA 4ZDWA 1DOJA 4BOHA 3Q9LA 1EZXC 2P3TB 1PPEE 2XXAB 5GVRA 1C4V2 1RJ9A 1LQEA 3AVXA 3KQEA 1DAMA 3TR0A 1G3QA 1O2TA 3LXXA 3MOCA 1BMMH 1W11U 2ZGHA 2MSDB 1E1RA 1FQKA 1SC8U 3UMFA 3VB5A 1G3UA 2JCSA 1CQQA 3IITA 5BPEA 1N6IA 4OGXA 1OFUX 2F1JA 3QF4B 2JLYA 2GXAA 1E9CA 3HK3B 2QE7A 4TL6A 1ZRBA 1VG1A 4P3YA 2RA0A 4GSOA 1D6JA 3ZZUA 3QGNB 5FPYA 3ZZAA 4NZYA 1UBEA 2ESTE 4CRDA 2I1QA 2ZJ2A 2AK3A 1O3DA 2RGDA 2QGRA 4X1RU 1AHTH 1CE5A 4KSCA 5EPYA 1VG8A 2DFLA 1LQDB 3OY5U 1G7RA 3D49H 1EJAA 2ERYA 4CW7A 1CGJE 1FY1A 2P8OC 5GJ4B 1AZSC 3A8CA 3QENA 2VIWA 5EXSA 3VU9A 3LQQA 2QZ4A 4Z1MA 4I8LA 2ZTZA 5E2OA 1JECA 3LBIA 4ABFA 3MJHA 1F5NA 4OHZA 3ZIAA 3T1TA 3OEHD 2AHOA 3Q3XA 2BLVA 3M7TA 2FSFA 1C5SA 3K09A 3FTQA 4OQFA 2Y81A 3AEZA 3Q3YA 3LQRA 1Z08A 2EVWX 3KL4A 5TY0A 4D7FA 5TDHA 4GZLA 1HNEE 1K8RA 2MSEB 1UTNA 2FOFA 3RAPR 1NFYA 2ORWA 3ECCA 4XIGS 1OX1A 2CLDX 2J46A 2AH4X 2V35A 1GKUB 2CN0H 3GDUA 5DP8A 2R44A 3K0CA 5GJBA 3SJKA 1AA9A 1N0VC 4OQMA 2C03A 3T61A 2IC5A 1W44A 1C1WH 1HY3A 3X1YA 1U0HC 2IXGA 4PZYA 4UXJA 3A7YA 4JIMA 1KO5A 4G5SA 3I5YA 2NO9A 3TGKE 1GCTB 4AD8A 5BXQC 1C5NH 2JLZA 3EIEA 1P2OA 3UTUH 1P2KA 2BXUH 3AVVA 4RD3A 5HYOA 1IJEA 3QIAA 4UNSA 4PTLA 4RKJB 2GZDA 4EPXA 4M9FA 4FMCB 4O2LA 1BCUH 3BWDD 1DOAA 1KDPA 2ECKA 1HAHH 3QEJA 3KX2A 3RMNH 1Q44A 3PTNA 1T3HA 3GEHA 2A78A 3I1FA 1HIAB 1G16A 3NKVA 5EZ5A 4BFZA 1IQGA 5G40A 2ODPA 5GNDA 2NPFA 4LHZA 1PPHE 1L2TA 1UTJA 5C1YA 3M7QA 2H6MA 1HAGE 3PFIA 1Q3XA 2WSSA 4WH8A 4LZ1H 4AORA 4PO1A 3KKPA 2ZJ5A 2C04A 4BTTB 5GJWC 4YMWA 2JLWA 5KNCA 4UE7H 3U7HB 8GCHG 3ADBA 4E22A 3BF6H 1NU7B 4LHWA 2RGEA 1ARCA 3P8OA 3FKSD 1DDJA 4HGCA 3SJ9A 2GT7A 2EA3A 4NIXA 2NPIA 6CHAB 1XMVA 4Y0VA 4FUEA 1ZNWA 4LC0A 3RS7A 5KOYA 1TGCA 3WP0A 4DOQA 2QSZA 3EE0B 4LX0A 4ON9A 2CMKA 3PLKA 2Q3MA 3TJUA 3BG4B 4CT4B 2PH1A 1WSSH 2ZU6A 3H0KA 1JI0A 3AVPA 5DP7A 2WICA 5F8ZA 3KQUA 2Q1JA 2ZRAA 1YZQA 3E5HA 4L16A 1L4UA 1O2YA 4LJ8A 3LGWA 2HGTH 3AUXA 2R2AA 1LVYA 5BW8A 4WAUA 3LLMA 4ZKRU 1A3BH 4CBOA 3KQCA 1HA3A 4GOJA 1FY8E 1FQ3A 2BZ6H 4NYIR 4HATA 1KXAA 1GL9B 4TQAA 4NG9H 3ESTA 3ZQJA 2OXSA 2ZA5A 2O52A 1S6HA 3U3KA 3AAUA 3THYA 2H17A 3R3GB 2R9PA 1ZJKA 4PSVA 2ILNA 2VSFA 2TBSA 1MTVA 1HT2E 2QL6A 3Q00A 2ZGJA 3TSOA 4TYNA 2PZGA 3A1WA 3LJOA 4HAXA 3L0SA 2QT0A 1E9DA 1QHNA 4CT5A 621PA 1SVPA 5E7IA 4UXIA 2IUSA 1A82A 2WKPA 1ZU4A 2M5TA 4IMQA 3GFPA 4RD1A 2FWWA 3A87A 3TW8B 1S3SA 1R10A 1VCNA 1WMSA 1CO7E 1BMAA 3U6KA 1II9A 1WUNH 3AH8A 1MR3F 2YZ2A 4QG7A 3RDZA 2PV9B 2C77A 4ZCIA 2P0EA 2UWPA 3SJCA 2QGZA 4EJSB 4OQNA 3GY3A 3UPEA 4FUBA 2ZRHA 821PA 2XJ9A 1TQ7B 2GNOA 3UOPA 1EGAA 6GCHF 3ZJYA 1V2VT 1J8AA 5A0BA 1RTLA 1SKYB 1ZM9A 2IEZA 1LPGB 2G00A 2PR3A 1JR3D 5C1BA 1S9HA 3BFVA 4WMEA 1RIWB 4TSFD 3QPVA 3N7OA 4Y0AA 4MKGA 1G7SA 1OWDA 4RFVA 3LX8A 2IS1A 3KXKA 3TMKA 1Z71A 1Z6YA 2ZS8A 1TOCB 4CF7A 2V3OH 1XM1A 2Q6TA 1G3BA 2FOBA 1A7SA 1EFRD 2P6RA 1VJAU 1CBWB 2ZXUA 1IXZA 1O2ZA 4QXAA 4Q1EA 1HDTH 4YOGA 2SFAA 1YVDA 3R7WB 2G0NA 1BMFA 4AYWA 1VZQH 2VYFA 3L0PA 1O2MA 1XP8A 1RFNA 2FTLE 3U9AH 3L6PA 1GDDA 1JR3E 4ESTE 3ZYCA 3EAJA 1C2IA 1D2NA 2FSHA 5LDDC 2FTMA 2RB4A 1G3IA 2PKAB 1TNLA 3HKIB 1KDTA 4C2UA 1TALA 1C5RA 3WBJA 3RRMA 1T32A 2Z3CA 2QF3A 4YOIA 1TFXA 4KLZA 4E07A 5E7MA 3FHCB 5H4IB 2ZDAH 2ZUBA 2V6IA 3SV9A 2P95A 1UTOA 4KTSA 2ZRFA 1K22H 4HB4A 4V0NA 1AE8H 1WCZA 5J4HA 4JCNA 1PQAA 1O2HA 7GCHF 5JBAS 3G5UA 3IHWA 4ABBA 2FG5A 3V4RA 4IVRA 1Y5BT 4ZI2A 2BC9A 1IQPA 1TL7C 5EP4A 4JVMA 1AS0A 3HR8A 3CS0A 1KYNA 2O8EA 4JLNA 2Y6TA 4DIDA 1U8ZA 4NYMR 1US8B 3GCHB 2J59A 2J0VA 4ARZA 3AGPA 4DCNA 3T12A 1RPZA 5J4KA 4CRGA 1I4DD 3HJNA 2C8XB 2ZJBA 3CR7A 1N6OA 1GJ5H 3I29A 3LT3A 5LD2B 4BFXA 2VHUA 5JEEA 3PCRB 4PQRA 3TAHA 2B21A 1XPOA 2ONJA 5FHTA 1RE0A 2YWEA 1XEWY 2ZJYA 5AJXA 3SNHA 1ZHMA 2AX4A 2HPPH 5FTJA 4B76A 2VRWA 4MQAA 1A46H 1SHKA 2ZSDA 1CHGA 3NBXX 1O38A 1C9TA 1CRQA 4MDSA 5C20A 3EA5A 4THNH 3LJJA 3RWMB 5FI0B 4EJSA 3M5NA 5L3QA 1MCTA 1CBUA 3LGUA 4YMTA 3FMFA 1MO3A 5H68A 1OWJA 1O5CB 1FONA 2H5CA 1YKSA 4MRPA 1FX0A 1YC0A 3RHFA 1V43A 2F43A 1NPMA 3GY2A 1SKYE 4B35A 2ODNA 2RDLA 2C3SA 1GJCB 1Y3XA 2MMGA 2AMQA 1TPOA 4DRZA 1IY0A 1Z8GA 1S85A 1UM8A 2FX3A 1UVUH 4MGKR 2ZGBH 1Q1BA 1ZUIA 1C2LA 5FCRA 1ZMJA 6CHAC 2XBWA 4ISHH 2W00A 1O2VA 2FGKA 1E34B 2KAIB 1JPNA 4P0TA 1UBCA 3QK1A 1XTSA 1GRRA 3T1OA 1V3XA 2HWLB 1CGIE 1R7RA 1ZHRA 3TUIC 3NBZC 1E9RA 1UBGA 1QB9A 2WV5A 1DLEA 1RTKA 3S9BA 1O35A 4PPFA 1O2IA 3HWSA 2P2LA 2IS6A 4U32A 4YLUA 1KLTA 1MMJN 3IGFA 1FJSA 1ELVA 3K9LA 3GDVA 1NMZA 1NL3A 1M1YE 4CRFA 1O39A 1ZC4A 1BOFA 1N3BA 1G2MA 4ZDKA 3UPUA 2CVHA 4EFLA 4QJ3A 2VH0A 2JLQA 3I72A 3F9HA 4LYHA 1W14U 3GJ7A 5KSOA 4X0WU 2QM8A 2Z6VA 3BORA 1GM5A 4DURA 4Q48A 4PC7A 4NIWA 2X19A 1I4LD 3ND8A 1EATA 2FYRA 3A85A 3I8SA 4Q4HB 1O3AA 1GP2A 3ZH9B 1O33A 4W5WA 2R2MB 3JZ2B 4ABDA 1UEIA 3CKLA 2IYSA 2GJSA 4X6MA 5FBLB 4Q00A 2ZHEH 4Q7JB 1QGFA 1TPPA 4RKEA 2ANYA 2D2FA 3NDBB 1QVRA 5L2ZH 1KXCA 2J94A 4TL9A 4JJKA 1IN5A 2HRVA 1BDAA 3CH5A 4B3CA 3AGQA 3ODDA 3OIUA 3RMOH 1SVSA 4NA7A 4WXRA 4Y79A 3K0CC 1KXDA 4HUQA 4MGZR 2GD4B 3QKTA 4AG5A 4DSNA 1T5LA 2ZP0H 1UF9A 3IIKA 4ABAA 3ZZ3A 4XDEA 4YZUA 2R6FA 2BDCA 2KI5A 2V8OA 2NQ2C 1NVWQ 4C3ZA 3B85A 2A2XH 1VCWA 1HV7A 2TMKA 2AERH 1ODFA 1RIWC 3Q3KA 4Y7AA 1IY2A 4X1QU 4K1SA 1JRTA 2ONKA 3AVOA 1ELFA 1QJ6B 3BERA 1TNHA 4ZKNU 3OF5A 2UWLA 4BTUB 4B48A 3RM2H 1E0SA 3AP1A 4AYYB 1RW4A 1E1QD 3TUZC 1SQ5A 2P6NA 2V7QD 3H86A 4LY6A 3BIVH 4O03A 1RGQA 4Q19A 4C0AC 4EPYA 1C1YA 4A2QA 3DDCA 4FVDA 4DJZB 3K9XB 2ZRJA 1QIXB 1SBWA 1AKYA 4POAA 5BN3A 2GCOA 4ERNA 1W46A 4XD7D 1XVMA 1C2FA 4EPWA 2XOKD 5C1XA 2HYIC 2ORVA 3Q77A 1OSNA 3MWLA 4X8UH 1KY3A 5F6MA 1N2CE 4K60A 4NU0A 4RFSA 1HE8B 1XUFA 2WTUA 4QBGB 1YR8A 4UNNA 1P2UA 4MPXA 4IDNA 3EIQA 1OWKA 5G53C 4A92A 2J9NA 1OJLA 4URWR 2BY9X 4TWZA 2EFDB 5IDVA 1UVSH 3ZD7A 2YNAA 2HF9A 3MU1A 4AN7A 1P2SA 2V0BA 4XH9B 1J2JA 2QEQA 4MGYR 2XGJA 2Q9AA 4B6EA 1GBEA 1A5GH 4MNXA 4DLYA 4YDSA 1N8OC 3QPWA 1SPJA 1P9NA 1OLOA 2F9OA 3L43A 2YOGA 3VEQB 1EP5A 4GP6A 1Z6TA 1E2EA 4E7NA 1XZPA 2PGBB 1TA2A 1YPKH 4Q1FA 2JIZA 4M1TA 5TJXA 1IM2A 4GI7A 1NBME 3WNDA 2IUUA 4NA9H 2VIQA 4EFNA 3QZRA 4CZ2A 1YZTA 1EPTC 1FY5A 4CHAB 3C16C 4QHSA 2ZSBA 1LHGH 1XNJA 4DCVA 3M5MA 3CWZA 1SGTA 2GJ8A 1MKXH 3X1XA 1QHHB 2XJ4A 4BLQA 1OPHB 3T28A 4QL3A 3GCGA 1GGDB 3P27A 3LV8A 2OCPA 2J45A 5FL7A 3CLVA 2FDCA 1ETSH 1KTSB 5F3WB 1CXZA 2GHIA 2Y7XA 5IK2D 3AP3A 5B2ZA 4B74A 1NSFA 3SU0A 1O3OA 2ZCKP 3WRYC 1F2SE 2OC1A 3Q7PA 5AR1A 1P5ZB 4A7IB 5ETXA 3SQEE 1AY6H 3QOFA 3RABA 3PV0A 5SGAE 5CYPA 1BS1A 4YOJA 4Q9KA 4TMVA 2F83A 1C5UA 1SKQA 3CO5A 1JQJC 1L8QA 1M74A 2VIVA 5CB6A 3ATWA 3B1VA 2BMJA 2E1RA 3HU3A 1JBUH 2O0JA 2FNAA 3SJZA 2FFAA 2Z6BD 2BMEA 2Y7ZA 3NHAA 4V0MA 4LBWA 3KNXA 4YLGA 5FCKA 1FMLA 1LS1A 4K5ZA 1DAFA 2QTVB 1O32A 1O3KA 5DI3A 1M9UA 1KNXA 1W13U 1ZZZA 3H5CB 1C5VA 4FCVA 4GOXA 1CR2A 2Z3EA 1FUKA 3KTAB 3AF3A 1KDOA 3U98H 1TX6A 3QXJA 2YOFA 2X2EA 3FVFB 1HAVA 2NO6A 1IBRA 3U1IB 4AY2A 4MUBA 5EE3A 1UHBB 2BWJA 1A2BA 2UKDA 4BFVA 3CRVA 2A5IA 3M5LA 1KK3A 4FVBA 3M36A 2PTNA 4KYIB 1Y3VA 3VFEA 3RXCA 2GV7A 2R6GA 2XTNA 2EQBA 2WWHA 2QXIA 2W2VA 2J2UA 2GA8A 2WWGA 2SGEE 5CM9C 3CP7A 3S9CA 2QPOA 4OS2A 2HLCA 1GTVA 3GEEA 1TMUH 5KYKA 4XBCA 1J8MF 5B6LA 1BRBE 3R7WA 1BBRH 2UUYA 2GKVE 2ZFRH 2GVDC 1INCA 2PSXA 4E7RG 1G8HA 1GI8B 4ABEA 1KSJA 5E2PA 1ZC3A 1FPMA 2ZU5A 1G4UR 1PFXC 4OJKA 1R4AA 4XSHA 3W94A 2W2TA 2R62A 2SNWA 5FTNA 5JCZA 3CZPA 3KJEA 1DWBH 3C41J 4LBVA 3MO3A 2ZTSA 2W6JA 5KSZA 1C1VH 3SS8A 4ZI3A 2Q9CA 3LW8A 1E4VA 1ZHPA 3ADKA 2G81E 4UFGH 3V3MA 4ZCMA 2OC7A 3K70D 3U61B 1BMNH 1IQLA 1Z2CA 1YCPK 2BHGA 4BZQA 3OE7D 2EFHB 1VITH 1C5WB 1LKAA 3RXJA 5JZVA 4NZLA 2O8FB 1E37B 1NN5A 2V1UA 1CTQA 2A7QA 2ZCLP 4DSTA 4HEJA 2BD5A 1H9LB 1CJVC 2WPKS 3ZZCA 2GF0A 2ODYB 2OLKA 1CHOG 2QF0A 2GK6A 3RRNA 3ICQB 1G9XA 4JBYA 3BJIC 1E2FA 2OT3B 1UKZA 2WPJS 1ELOA 1UJ1A 3OSYA 4I1UA 1D9ZA 1TX7A 1F2TA 2PUXB 2OTVA 1AIPA 3IBGA 2ZAMA 1XZQA 1SGDE 2QAGA 4R2IA 4EPRA 1XBTA 1DS2E 1NFWA 1H8HD 2IT1A 4IDHA 2G1JA 1ZD1A 1Q1ZA 5E0JA 4F4OC 4CRBA 2ZQ2A 2QC2A 1A3EH 5EODA 2GT8A 4NKRA 4B2PA 4UFDH 2FE4A 1SXJA 2VP2A 4KFUA 5IDKA 4IRUB 3GY7A 4M1WA 4YLQH 3VR3A 1TX8A 2ZO3H 2ZNKH 3WBKA 2QM7A 1SGWA 2C9CA 3IWMA 4AFQA 1SLUB 3LGYA 5GXPA 6ESTA 1CRPA 5CLQA 1SVLA 3VKHA 2CCGA 1BTYA 1G8YA 3QSYA 1DWEH 4A8JA 2QORA 1W2GA 1J14A 3OFNA 3ZD6A 5HM2A 1Z3IX 1P11E 3IQXA 1S0UA 1JR3A 3SU5A 1E32A 2BD9A 5E95A 1KO7A 4PAMA 5FUYA 4DY7B 2QXJA 2EFEB 3T5DA 1C5OH 4I8JA 1KMHB 2F55A 4IW4E 4IXMA 1XTIA 4JZFH 3SGQE 1AS2A 5BQ5A 5SZHB 1L4ZA 1AN0A 3TGJE 1U8AA 1L0ZA 4X1PU 4WXIA 1NRNH 4PX9A 5KDOA 4LV8B 4DDUA 1IXSB 1KIMA 2ODEA 1KI1A 4FWIB 1CSOE 1DADA 4K8BA 2PJZA 2ZFSA 1N6XA 2FLRH 1KSFX 1AKSB 4WWYA 5J40A 2FI3E 2BLWA 4A0GA 2IYVA 1U94A 3GLGA 1SB1H 1TADA 2YV5A 4XVUA 1C1SA 2Z9JA 1O0DH 3ETLA 3JZ1B 4PAQA 4KFSA 1DVAH 4B71A 2H9TH 3A83A 5JRZA 4B75A 1GJAB 1A7JA 5IHPA 2DHRA 4DKXA 2FMJA 4BFUA 1XUKA 2CV3A 1DARA 1BRAA 2EC9H 2JETC 3QZQA 2DB3A 3F1SB 3ZGXA 1KDQA 2P3FH 3TITA 1OYQA 2ZQ1A 4TLEA 1AWFH 2VLIA 2V9PA 3AP2A 1TF5A 2F9LA 2EI6A 1QBVH 1RXPA 2D26C 1SG8B 2HXSA 4WZAE 2WMOB 2F3TA 1KY2A 1THSH 1X1SA 1TAGA 4NPHA 3AQ4A 5KSPA 2ZFQH 2AFIE 1SXJE 1ZNXA 2ZS9A 2QY0B 1KJYA 2PLRA 2Y5GA 2O8BB 5FX6A 4X1SU 4JZDH 1XMIA 3E91A 4F92B 1GI7B 3GLFB 3IO3A 1LHFH 1JXPA 2CHGA 2ODBA 1S82A 4FU8A 4BFWA 4JKIA 1IN4A 1NSTA 1FTSA 2AGGX 3EPLA 3NUMA 1O30A 1IXRC 3VR1A 1JXMA 3VKWA 3PJRA 1AN1E 4QBIA 1LHDH 3GDSA 4KLNA 1GFIA 4HDOB 1UK2A 1K28D 1K1LA 1ZNZA 5TMPA 5E0HA 4JBXA 4Q9IA 2REOA 4ABGA 3UMRA 3VX3A 4ACBA 1KDQB 1LF0A 1TA6A 3KHVA 1N6PA 2OAQ1 1ZM4A 1WXRA 4OL0A 4MYHA 3TK9A 5TV2A 4KBFA 3UK6A 4PZZA 3KQLA 4BRUA 3A1TA 3NVAA 3KJHA 3M1IA 2PLXA 4WZBE 1KO1A 1BYUA 1E36B 1ZSLA 1GSIA 2LWIA 1GJ7B 3MWYW 1V2KT 5AF9H 3EZ2A 3B9FH 4GHTA 5T6FA 1TBQH 5EP3A 2X8AA 3P6ZB 7KMEH 1ABIH 3N5CA 3QUMP 3LGVA 4Z6AH 3UR9A 1E1RD 1F48A 2RGBA 3MD0A 4KU4A 2GKSA 4CR9A 1NC6A 5JCPA 3A7ZA 1U90A 2O8LA 1BTUA 4RD4A 3RLWH 1AQ7A 5AFZH 2JJ2D 4IDPA 5K0HA 2BD8A 3HU1A 4S35A 2O8CB 1QFKH 1WBGB 4TTPA 4YQFA 4FXGH 4V0KA 1KI9A 1GI0A 2BHRA 4JSTA 1E9BA 3B8HA 1V2WT 2XX3A 1TAWA 3ND9A 4DZZA 4CVNA 4IGDA 2XTMA 4U02A 1TUIA 3VTKA 5FOXA 2FSGA 3P20A 2FMXA 2GAOA 3QVUA 1KSGA 1GZSA 5FPSA 1TLDA 1O3HA 1MCVA 4KTCA 3W3ZB 1DAEA 4CR5A 5DKMA 4CEIB 2QRNA 1PUIA 2IS4A 4A8JB 1C5QA 2IHBA 2QPAA 1XCPA 1WOFA 3TVTA 1CHOF 1XXHA 2CDNA 4WJG2 1H8EA 2FLBH 1VCMA 4K46A 3QKSB 4PZLA 1IN8A 3KDSE 3SR0A 4KCGA 1N6YA 1OH7A 3QKRB 4O97A 1S0RA 4PXAA 1D9IA 2WAYA 3ZZ0A 3AF0A 3EZFA 4OHXA 4B2IA 4IJMA 4LHYA 1D3DB 2QUZA 5CITA 1GG2A 3PTBA 1KI2A 2ZHQH 1U81A 1K9OE 1SQOA 4RCZA 1SGFG 1EASA 4TZ0A 5EXTA 3W8NA 2J41A 3X2SA 4TN1A 1AWHB 5IK2A 4M22A 3WRXC 1HCGA 1SHHB 2WPMS 3EG5A 4WVFA 3E16B 1A2CH 2CJIA 4JLVA 1PPZA 3FMPB 4CEJA 1C1UH 3Q3JB 3Q85A 2GTBA 1TF2A 4YT6H 2XCFA 4R71A 3CF2A 3NZIA 3F9GA 2W6JD 4IEIA 1F92A 4QJ5A 1Q21A 2OV2A 3QDZB 1KHTA 3SI4H 3B6EA 4M53A 3UG6A 3VU9B 3BAFA 1T8TA 1G3CA 5DGJA 1IHSH 1VMAA 5AJZA 5L2YH 3O8CA 1Z83A 2ZI2H 1VYTA 1W1WA 4A5TS 1BTXA 2FZZA 1FUUA 3ZVAA 4Q47A 4MRSA 5EUMA 1JEEA 2ZI3A 4NYIQ 3M0EA 1YR9A 2H5DA 3KKQA 1QDEA 3CUEF 4NHOA 1V2JT 2LKDA 1SULA 1HFDA 2FEQH 4BXSA 4K8OA 2R6CA 2IXFA 4QBHA 1F3OA 1P2NA 5JB9S 1XEWX 3A36A 3NH9A 1F0SA 4X2YA 3RYTC 3C8UA 1YPHE 4NBSA 1AFQC 3K70C 4U01A 1HJ9A 4JK6A 4X8MA 1LW7A 1XX6A 3RC8A 2H92A 5SZKB 5CYOA 3KGPA 1UVOA 3R8FA 2G8TA 1DFPA 2ALPA 3ZZ5A 4LYAA 2R9VA 4XJXA 4ZKSU 3FP6E 1E0FD 1XEXB 2ODQA 1NFUA 2GETA 4HSEA 2Q6FA 3LFUA 3U3MA 2QMUA 2G88A 1W4AA 2A3RA 4Y8ZA 2VU8E 4D0NA 1DSTA 4JLDA 4AKHA 1WU1A 2FM2A 1BKDR 4M1OA 1N5IA 4B2LA 1O5AB 3BEFB 3SBDA 2XZPA 3HPTB 1W48A 3RXAA 2BMGB 4RKFA 5C3NA 2SGFE 3OIWA 3MU5A 2SGDE 2ANCA 5CIWA 4LPSA 4II7A 4DG4A 4DVAU 3S7HB 1ZTKA 1J17T 5D3MB 3GISB 5EXXA 1BUIA 3OTPA 1BH2A 3RXMA 1CULC 1EZSC 1W5SA 4NCYA 1KI4A 4DDTA 1EPTB 3UWOA 1V2ST 2PFEA 4Q2KA 5KO2A 3RXIA 2K5UA 4A15A 3RS2A 3I78A 1XJCA 2OSBA 3GLIE 2CHQA 4GLYA 1T3LA 2FEOA 3X1WA 2XB2A 1P10A 3RXRA 1DELA 3R20A 2LCFA 3CB4A 2OG2A 1S1CA 1PPFE 5DP6A 1J99A 5EE5B 4MLFB 3A58B 3MI4A 1SLXB 3DL0A 1GNRA 3K2UA 5AHGH 2ZDMA 2C8WB 1WB9A 4URUR 1BIOA 5JBQA 5FTKA 4H9GA 4OI0A 3ADDA 1Q3HA 2UZ3A 2Y5HA 2IWRA 4Z0KA 3VR4A 1EXFA 3GJ0A 1ESBA 3E1XB 1QB1A 3C14C 1EX7A 3ZLJA 2QAGB 4UD9H 3STIA 1ZJDA 4PROA 3AUYA 2Z94A 1F0RA 2F3CE 3TW4A 2ZYVX 2GTPA 2RKOA 4PPGA 6GCHG 4DDVA 4W5JA 1D3QB 1W49A 1AKSA 1QL8A 2PCLA 5GWZA 2STBE 4K1EA 1NMXA 4LK4A 1G7CA 5ELXA 2ZS7A 4DEYA 1ONBA 2ZGXH 3AF1A 4NCHA 2BBWA 2BY6X 2NTYC 1DXWA 4KBGA 3LLUA 1P09A 3CPEA 1SGEE 2C90B 1X7AC 1RC8A 1P9WA 5B58C 1SVIA 1KMQA 2OCBA 3AVTA 1HUTH 1IQEA 4PANA 1ZUHA 1O3FA 2AR7A 1P2MA 1CP2A 1TBRH 4Q03A 3PWCA 4KFTA 1OKKA 3P4YA 3LRPA 1C1TA 2VGCC 4TLBA 5ESTE 4HLUA 3MCAA 2DYKA 5JJLA 2PZFA 2IJD1 2HT6A 4GMXA 1P8VC 2VP6A 3ZVBA 1V6DA 4KO8A 4PSAA 5FBWB 1EX6A 3KUCA 4ZO4A 1E2QA 2QCYA 3SOSA 2BQ7B 1AQYA 1YQTA 4A2WA 1EAUA 2PKSC 1P01A 3VNVA 3BTHE 5EE1A 2IPHA 2QPTA 2WJHA 4A82A 1TEXA 5HXFA 1J70A 4MRNA 1HAPH 3FZDA 1KK0A 1M6NA 1G19A 1NRPH 3MU4A 1QG2A 4X8LA 3TIFA 4AK9A 4RFSB 1PLKA 3S7KB 1GL1A 1P2TA 4M1KA 1ZW6A 5GVSA 1GVKB 121PA 1C4Y2 1XX9A 2A7JA 1FPHH 1ZGVA 2PT5A 2XSZA 3MNBA 3SEAA 3KQDA 3RMMH 1O2UA 2IYZA 2XWBI 3W90A 2C8ZB 4P4TA 3ENSB 4M7GA 2ZWLH 1DEKA 1LVOA 1Y3UA 2ZPTX 2BD7A 1GMCG 3U1JB 1CJUC 4BAKB 1HRTH 3B23B 2QA5A 2Z4RA 3OX7U 3EGKH 1U98A 1U9IC 3PR1A 4F4CA 3U3JA 2A0QB 3NBYC 1YPLH 2O5VA 1M7BA 3EXAA 4C30A 4KODA 3V00A 1NVVQ 2J0QA 1AMHA 1P73A 4M9SA 4Y76A 4NP6A 1IQNA 1DO0A 1J9CH 2CL7X 1KTVA 3SU2A 3TH3H 1GJBB 2BBOA 1FN8A 1X8JA 5AUNB 1E3MA 4HUTA 1XCMA 2OBOA 2FP7B 2GDDA 1TQ6A 3QWCH 4DBLC 5FBRB 5JI3E 2OLJA 1EWQA 1TBZH 3I32A 2GCNA 2BY7X 2P59A 1L7VC 4Q1AA 1AUJA 2DBYA 1KLIH 3F68H 2ZHWH 1Z0JA 2EI8A 1Z63A 4ZDJA 2XTTB 4M9QA 2CHAB 3CRQA 2FFBA 1RD3B 1K1OA 1W7XH 1OP8A 5EXPA 2HVXA 2AFQB 1R0YA 4HLDA 1SMFE 1B0UA 3EIHA 4OI1A 3CNNA 3WYAA 1KGDA 4M4SA 5CJ2A 3GY8A 5FR1A 4V0OA 1WQVH 4FWTA 4ZKOU 1Z28A 4WZ6A 5CM8B 3UMSA 2BIFA 1GBJA 1Z6GA 1L4YA 1LS6A 3DVLA 5IT5A 1G18A 3U7FB 1O2JA 1FDPA 1R0ZA 2ZITA 1O2GH 4ZUHA 1N6LA 1HE1C 2W0MA 4IVQA 3RP2A 1G36A 2MMCA 3GMTA 4KP0A 4O25A 1UFQA 3K9HA 1FTNA 1OB5A 1GBAA 1NRSH 2IYQA 1OWHA 3LAWA 2GJ9A 1TMKA 3QO6A 4EKDA 3GY6A 1A5IA 2DWOA 1G1MA 4FU7A 1G64A 3AVQA 3F5FA 3TBKA 4A1VA 5JSZB 2RH5A 4M8NE 1NNEA 4ASUA 4LYJA 1G32B 4CDGA 3FHTA 2JJ8A 3TK1A 2BB4A 1R6BX 4Q4AA 4NONA 4ZH8A 4WXPA 3PUXA 2XNIA 2BVNA 1G291 4US0R 3ZVEA 3WHLA 2J95A 4BZXA 2CL6X 1HLTH 1RS0A 4C7OA 1NU9A 4ZDIA 1GBDA 4IDOA 2D06A 5LH8A 4B33A 2FOMB 3TNFA 2FPZA 3BK7A 3U8OH 1HXEH 3OY6U 2AIPA 1TMTH 1GL0E 1SFQB 4BASA 1MO4A 4Q4JB 1P72A 2Q3FA 1BTHH 4GZMA 2X2FA 1E6CA 5DYIA 4TTQA 3OE7A 3QG1A 1GI4A 3STJA 2GXQA 3THXA 2OLGA 3SFVA 2W83A 2BJWA 5F9HA 1GHYH 3H7OA 5EW1H 3IIJA 4XD7A 1CT2E 4Q02A 1CVWH 2DWPA 3R0FA 1R5NA 3BEUA 1A1RA 3H84A 3FPAA 1C9KA 2A31A 5A8XA 1G5TA 1UTQA 4X1NU 2IN2A 1SVWA 3ZZ4A 3CPJB 1GHAG 3UANA 3IQWA 3SZEA 3QE0A 2ZFTA 2BM2A 3D6TB 4QGHA 3LNCA 4QRHA 1H9HE 3T06B 2A4QA 2O9QA 3RC4A 4LWZA 1NLZA 5JBTA 1LV7A 5EU8A 1CLUA 1FQJA 5KPDA 4HZUA 1IOEA 3L8ZA 1XEFA 4TLDA 1OYWA 4AX9H 4NZQA 5SZJA 4LHVA 1GHWH 2KB0A 5AWFC 1QQ4A 3H7TA 4HB0A 3C5CA 2R0LA 4C0KA 2PSYA 1TQ0B 2VWNA 1F2UB 3HGNA 1OXXK 4IC6A 1TEVA 3U7GA 1HAVB 3RMLH 1JR6A 4IHQA 3P17H 3T34A 1H1BA 4JL6A 1ELTA 2D2DA 3LW7A 4BRWA 1NY22 3MAAC 4WA7A 3P32A 1JOUB 4PFSA 2ZETA 3FB4A 1MABA 2ZZUH 4X8HA 2KE5A 1DWCH 3O47A 3I73A 4DCSA 4KSBA 3NC0C 1EKBB 2NGRA 3HR7A 1AM4D 2GWHA 3K8YA 3WMGA 1UKYA 2OEPA 2WM9B 3LWNA 1VIAA 1I2DA 3V0XA 5GCHF 1SQTA 1GBKA 1NRRH 1GHBF 1JAIA 1ZD9A 3ZVFA 2GZ7A 3WNCA 3F8TA 1YP9A 1B5GH 2BXTH 4G5OA 4QJ4A 1F5LA 3HYRA 4TQ9A 1W0JD 1O2LA 2OP9A 2J4IA 1UK3A 1YM0A 2IF0A 3G01A 2QAJA 2IYWA 3B8JA 3X1ZA 3PV4A 3FDIA 2CBZA 2BVRH 2A5GA 4IN1A 1NI3A 1GDUA 2GZHA 3N2EA 1KO4A 3KF2A 4DJTA 3NH6A 1A0HB 3IUYA 3DM9B 4U7DA 1AU8A 1DVRA 3T29A 1ELEE 1BBRE 2OHFA 3TU7H 4TMKA 1W36D 3FAOA 1NLFA 1MTWA 1QHXA 2FI5E 3LDXH 5JECA 1N6NA 3SN8A 4MYUA 3DZ8A 3FP8E 3ZZ7A 4KFRA 4XSGA 1GMHG 5AUPB 1ZYUA 1KY9A 3GLHB 3SNBA 3B7GA 3V12A 4ZXXH 1Q22A 2ODWA 2JLUA 3UOUA 4HUQB 4GMDA 1GWNA 1GI9B 2G6BA 4R9UC 1E2GA 2ZM5A 3AASA 1S96A 4LJ4A 2D7DA 1S8FA 1TQDA 1T8LA 4Q4LA 3SW2B 1OHHD 3M4YA 1RRCA 4WY3A 1GRNA 2C95A 4JLPA 1LVMA 2DR3A 5B57C 5CHAC 1IQIA 5T6GA 5J47A 1TU4A 2JLXA 3SQXA 2E9SA 3PXGA 8OHMA 1JXOA 3ZVGA 4CREA 2ZE5A 5I25A 5EW2H 3T25A 4Y11E 1W47A 1Q57A 4DT7B 3TQCA 1W3CA 3B60A 3GCTG 3H4MA 5CJPA 3LH1A 2W5EA 1T7CA 1O3GA 1R5BA 2J92A 1AVGH 2GX4A 2FSIA 4E06H 4DCDA 4QOSA 2GP9B 1GNQA 5CIQA 2QIQA 5FOVA 1IQFA 1YJ5A 3F0TA 2IEYA 4IBLH 3ZZ8A 5T6DA 2H9EH 4X2WA 1KZ7B 4MDEA 5E0GA 1EESA 2OQUA 2Q6DA 2EW1A 1GDQA 4ZXYH 1KKMA 4PHFA 5L30H 2DFKB 2VPPA 1NO9H 2GXUA 4ASUD 2Z7FE 3RM0H 3OHMA 1GMDG 1NM6A 5KHOC 1ELDE 3FE2A 2QBYA 1XJ0A 2W2XA 2G9NA 1YR6A 2P67A 2VIPA 2CCKA 3SNEA 1P04A 1RFLA 1LTQA 3KXIA 1T8OA 3CW2A 4BUJA 4A6PA 4MKHA 1SGCA 1A4WH 3DO6A 2BDBA 2WUBA 3SUDA 3M3SA 1HJ8A 1CBWC 2BD3A 1WA5A 2ZE8A 4HAWA 1VHTA 1T4VH 2A5KA 5LGOA 3BOSA 2AMDA 4FI3C 1HAZB 3U4QA 1LTOA 3JZAA 4OI4A 3EPJA 4B44A 3B1XA 5AJVB 5EQQA 3OESA 3TVDA 4GOKA 3EARA 3SUGA 4PC1A 2Z5FA 4N1AA 3BSQA 4XSKU 1MRSA 3SUFA 1BHXB 2NO0A 4MVNA 2PMKA 3AKEA 2ZU3A 2EWWA 1LVBA 5F03A 1W2HA 2YNMA 2O8FA 4TL7A 1GOTA 1SGNE 1GNPA 1HAOH 1E0JA 5AJYA 2AWNA 2IUTA 3KB1A 4JZKA 4TMTA 2YWFA 3NEJA 1O3NA 5DN6D 2V6JA 5GIBA 1CR1A 3SBEA 4EUNA 3BRWD 1Y3AA 2GDJA 1Y5AT 1P9SA 2NOAA 4I8GA 4XOJA 3ATLA 3U8RH 1O2XA 1SHYA 4ZROA 3TLXA 2ZJ8A 1B0FA 1XTRA 4HI0E 1ZP6A 1SGPE 2G77B 4JK5A 2GGVB 2WAXA 1S2MA 5L3SB 1GPZA 1W36C 3QGJA 3ZQ6A 1VGCB 1LMWB 2OM2A 1KI8A 3KKOA 4UNPA 1UADA 2FOHA 5JJIA 1CA0C 1W0YH 2JATA 2WIAA 2IWHA 5LPEA 3MTYA 1C9PA 1QVAA 3W5IA 3KEEA 2QE7D 5DHAA 3DEFA 1SFIA 2IYYA 2ATVA 1E2DA 1P7CA 4W7SA 2VSOA 2CLCX 2H57A 2RGGA 1WE2A 1G3EA 2J7KA 2JJ1A 1C4OA 3QXHA 4HAUA 3N70A 2SGAA 2P6UA 4EAQA 4IOMA 1NY6A 2BOVA 5IF9A 3GJ6A 4TWWA 1OXSC 5T3HA 2C8VA 2UZIR 5C2ZA 5FL7D 2QU8A 1IHTH 3P95A 1ANBA 4GPGA 1S81A 3SGAE 1E96A 2FESH 1Z1IA 3RS3A 2FFQA 2VF7A 4NIVA 4AYTA 4O9VA 4RVCA 3VFDA 3DPUA 3SUEA 4DLSA 5C2JB 1G8GA 2VVUA 1OXUA 4YXWA 5B64A 4EDHA 2FS9A 5JBBS 4MNYA 2F9PA 1XMSA 3U44B 4CH2B 1YRAA 5E8EH 2STAE 2VIOA 1Z47A 3GLHE 2BDGA 2JH0D 3UY9A 3ONWA 4IOKA 3VNUA 3BG4C 1QCPA 3MU8A 4DB4A 4ZPXA 2JH6D 3SV2H 4JZ1A 2ZRPA 4IEEA 4QT8C 2WV9A 2ZI7A 3MRSA 5IYTA 1M7GA 3VPKA 2NZ8A 3K65B 3K9GA 1ZMXA 1R2QA 1JJVA 5F98A 1GIAA 3Q72A 3OU0A 2BM0A 1XXHB 1KSNA 1ETTH 1DM4B 3Q5DA 1FMJA 2J0UB 4MRVA 3TGPA 1EOLA 3ASYA 1SGRE 5EXNA 3RC3A 4NFEA 4OBEA 3K0FB 1Y5UT 2R6DA 2NO7A 5ANRB 2N1BA 4K81B 1AO5A 1X86B 5JHHB 4C0JA 3OAAD 3SO3A 1F0TA 3L3TA 1KI7A 1TE0A 4NH0A 3BC1A 2FJUA 1GBTA 4BANB 3TH2H 1FAKH 3MJRA 1XB2A 5AUQA 3RWOA 2JKHA 3MO9A 4I8HA 3JZMA 3M3VA 4Q66C 1Z8IB 3Q8XB 1NG1A 3BTFE 3SFZA 1AVWA 1MKXK 3MU0A 4HI3A 1TGSZ 3T5GA 1DG3A 4MG3A 1ZJ6A 3OZXA 1CU1A 4FUJA 2Z3DA 1BBRK 2JLVA 1HAYB 2OXRA 1KTTB 2ZAOA 1I2MA 4EIWA 3C1KA 3FMOB 1KI6B 1NVXQ 4BFSA 2HCJB 2AK2A 3WMEA 1D5CA 2CLSA 4A1FA 2BCGY 4Q4JA 1DAIA 1N6HA 2UUKB 2TGAA 3DD2H 3P26A 2RGNA 2AYWA 4F91B 3BH7A 2C99A 1DAGA 2RCNA 4PQYA 2DE9A 1ZCBA 4FUDA 1AE5A 2CEAA 1VITG 3B1ZA 3RC6A 4NTZA 4OHVA 4XVRA 2BD2A 3Q7QA 2VVVA 1NFXA 1HEIA 2BD4A 3PMBB 4A9AA 3L33A 1N0UA 2ZUDA 1G37A 1KXEA 3MGCA 1AJEA 2O8BA 1ZR0A 4JBWA 1JWTA 5DHFA 1M34E 4OK6A 2OZEA 3LDAA 3F3YA 3U8TH 4TL8A 5DP4A 4L8GA 2D2EA 3NWJA 3BD9A 4BQSA 1S1MA 3LY5A 3NBFA 1MQ5A 1XUJA 4JVNA 4MKIA 1KXFA 4O3TA 2RCEA 4RI0A 1O5GH 4BGDA 1SL3A 1GVNB 3HPQA 3SNAA 2A32A 1P0SH 1O5BB 3WMFA 1VHLA 1SXJB 4MUAA 1GI2A 2QT1A 1LHEH 5DE3A 1FPCH 4BECA 4DWJA 2F91A 2DPXA 4IMZA 1KOFA 5BYJA 4WMFA 3UWKA 3MNXA 1G7TA 3TUJC 4ILEA 5BYKA 2CL0X 2GEDA 3NK8A 1FL9A 2F9MA 4TPYA 4DLVA 3EZ7A 1CA0B 2Y8EA 5LB2A 3MG9A 1O2OA 1XMNB 2HNTC 3RXQA 2O0KA 1S6FA 1YGCH 7GCHG 2DFTA 1JIMA 3GOVB 1SLWB 2VO1A 2D62A 5F8XA 4MNVA 1GI3A 3M35A 1RVDA 1NRQH 1TRNA 1P05A 3BS4A 3SYKA 4AG6A 4Q21A 1O34A 5C5OA 4FCWA 1E2PA 4M21A 1GMCF 2GESA 1U99A 4FUIA 1MAYA 1ZOMA 2VP0A 1CJKC 3SOPA 2XC5A 1MTSA 3EYDA 4B73A 3SZRA 1C2HA 2WIBA 4U5XA 2J87A 2W58A 3QVVA 4GT1A 5JYIA 1SSXA 4XTRA 1OXGA 3R8CA 1Q3TA 1TGBA 1TMBH 4ZHAA 4FUCA 3CZQA 2A4RA 1KIGH 3AKCA 5EQRA 1CEEA 1NS3A 3KXLA 2IYLD 1OIXA 1F5KU 1VCIA 2MSCB 4LXBH 1P62B 2LKCA 1GVLA 2VIDA 3BTGE 1II8A 2JETB 4MPUA 2XB4A 4YMVA 5F9FA 1V2LT 3EDXB 1KKLA 1RRKA 1GKIA 1UKEA 1PVOA 4Q7ZA 2CMYA 3EPKA 1YCPH
chains in the Genus database with same CATH superfamily
3A8DA 1SHLA 3EGCA 2P9HA 5EJ7A 1N2XA 4MQMA 1L5LA 3TBHA 4GGPA 5JOQA 5BQXA 4E4RA 3GDOA 4UUAA 2ZKSA 5FBIA 3PUJA 5CUQA 5FLXA 3IBFA 2P7HA 4EFMA 1CQPA 3BN3A 3NBUA 3TUJC 2EAUA 3OZVA 5GP1A 3WLNA 5IRCD 2GD0A 4SGBE 2GMTB 1NT2A 4OJYA 4BLSA 5K8TA 1Y8TA 3UK2A 3LA6A 2HLHA 1ZLRA 2X23A 4M9CA 2WWIA 2EZ9A 3V48A 2G82A 3RXHA 1O96B 1VXOA 5AVJA 1I6MA 1EXWA 2QUKA 3D3WB 3HZHA 4JLSA 4YJHB 5KNBD 2PGNA 3UPDA 2PUQH 1GSOA 3EF3A 4CDRA 3I92A 1N78A 2REXB 3AILA 1CUHA 2EG5A 3C6QA 2FWNA 3W8EA 3ZCVA 5AHRA 5HFJA 2YW9A 3KBBA 4OIFA 1ZCAA 5EMKA 4ZVLA 5HIKA 4CFYA 4G07A 2FOGA 1ZD5A 1NG9A 2XBLA 2UV8A 5CVDA 4Z8XA 1Y5IA 3RAFC 4KOEC 3NTQA 1D2CA 1FYFA 1SA0B 2A30A 2AH5A 2XWSA 3VG8A 2EHDA 4HB3A 3TF5A 4DR6B 2JGJA 4ZEWA 3DUXH 5TVKA 2SGQE 3B1FA 3VC3A 4BNLA 9ESTA 1T8MA 2BTCE 2DKOA 3IALA 4LZPA 4PVDA 2DOKA 2ANBA 2VNJA 1T4UH 3L2OB 1T25A 2O2EA 3DBLB 4GSYA 4MKXA 4QFMA 1ZM7A 4RHCA 3SXUA 3CVWA 1NIPA 2C2HA 2GPNA 3K53A 5LQSA 3D6UA 4ER3A 2I8CA 1QA0A 4LBZA 1AD8H 2H1WA 2Z30A 5A9TA 1E69A 3TB4A 3PTAA 1QR3E 3VJRA 3TSCA 3SP1A 2BVXH 4X8VH 3IAEA 4EITA 2Y80A 1XJQA 1B74A 1R66A 2Q6VA 2QMHA 5C5CA 5LIPA 5M5BA 2JAHA 5DI3B 2ZANA 3P70B 1E2BA 1SO8A 1BZXE 1DCFA 3L0BA 1B7XB 2F3UA 4QPPA 4PQEA 4RZ2A 2GPTA 4X2XA 4ACAA 1DIRA 2GRAA 4US2R 1OP0A 4C0QC 2FN7A 4CQMD 2DCUA 4TWYA 2J5UA 2ZT8A 2JGKA 2C78A 3NNNA 1M2GA 1YR7A 5IJ9A 3MIIA 2ZSFA 3VJKA 3BFKA 3RSLA 1Y8ZA 4W9NA 4WX2B 4ZKDA 4BX2A 3EASA 1BITA 5JQWA 1ZR4A 3TQSA 5C8YF 4ZPJA 3HV0A 2XQFA 1H69A 1GBHA 3MTBA 1IPFA 2YVUA 2CCJA 3MNFA 3VPBA 4NWKA 3PFFA 3WIDA 4BMSA 1YKTA 1HT0A 2G4CA 3C7KA 1RC0A 1YQQA 1VRCA 3FSGA 1RJGA 3UJ8A 1O2PA 1Q92A 1Y1LA 1CGHA 4B9EA 5CVJA 3UWMA 2NU4E 1B6SA 1YF4A 1HO3A 1DWPA 4OK3A 2I8AA 3E58A 2GDEH 2ZTLA 4QYIB 3NTVA 5D3MA 1ISSA 1W30A 4AG2A 3GFFA 3L3BA 3O26A 2NUAA 3EZGA 2LVBA 4WH6A 1QL7A 5EXMA 2K7ZA 2PYIA 5J2TF 3ZHTA 3V1UA 5IJZA 5KCZA 1SU4A 2AMYA 3DUFB 1COWA 4UHBA 4FINA 4BGIA 3CS7A 3WLOA 2HHAA 2VYCA 4UFEH 2J0EA 3ONFA 1RAAA 2WTBA 2YMMA 3DTVA 5IVDA 4EHHA 2OZLB 4PGFA 1VIVA 1HETA 2ZCUA 5KYUB 3I52A 2CMHA 4WACA 1E3JA 4R8TB 4I6GA 4JJ7A 2VJ1A 1V6AA 1ZEMA 2AYYA 3M89A 4G8BA 5CK5A 4TXHA 1ELCA 5TS3A 5DNUA 3OIVA 1IBKB 1HXHA 3KKMA 1TUBB 2HCFA 3QF4A 4OXQA 3R7LA 5F12A 5IC4A 1FMFA 1H85A 4A5SA 1LV8A 2XCNA 3F5QA 4WD3A 3EFHA 1RACA 2OKGA 3DCJA