3OCZA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with the inhibitor adenosine 5-o-thiomonophosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein E
publication title Structural basis of the inhibition of class C acid phosphatases by adenosine 5'-phosphorothioate.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3oczA00
1WZCA 5AVZA 3U13A 1SU4A 3WK8A 2HCFA 1Z4IA 2Q4RA 4GIBA 4E88A 5ALRA 5AIBA 3E58A 3WK5A 2RARA 2ZOSA 3AR5A 1LVHA 3N07A 4I9GA 2I34A 2FUCA 4NWIA 2RAVA 4UATA 2AGVA 3KDPA 1AQ6A 2JGAA 4RESA 2G07A 3QUTA 5AM0A 2C8LA 2QLTA 1L8LA 1X42A 5AM3A 2W4MA 3BA6A 1QQ6A 3N1UA 1U7OA 4DFDA 1QQ5A 4EELA 2JAWA 1TJ5A 4Y2JA 2C4NA 3AR8A 1Y8AA 2YBDA 3L7YA 5AM1A 4C4RA 3AR2A 4FYPA 4BNDA 4OFZA 1S8OA 2HDOA 2YY6A 1ZOLA 4XPZA 3KBBA 3UMBA 3QLEA 3ZUPA 1RKVA 4B6JA 1WR8A 4UARA 4G63A 1ZS9A 1WPGA 2NYVA 4CE6A 3U19A 3B9BA 2FUEA 1O03A 1RMYA 4IFTA 5A3SA 4C4TA 2C88A 2YMQA 3MPOA 1Q91A 2G09A 3KC2A 2NO4A 2FI1A 4DW8A 1N9KA 3HYCA 2IOFK 1TJ3A 5AK3A 3L8EA 1S2OA 3I28A 3QYPA 4O8CA 3ZVLA 3M1YA 4UMVA 3OCYA 1RLOA 5ALJA 3ZTWA 2ZXEA 2JAOA 2HEGA 3A3YA 4ZEXA 2G08A 2YMPA 2R8YA 5AKZA 3A1DA 2JARA 1ZRNA 3SLRA 3W5AA 2AH5A 3QUBA 5ALWA 2YJ5A 4EX7A 5AVXA 2C8KA 1VJ5A 3QNMA 5AKKA 3WGUA 5ALYA 3D6JA 4Y2PA 3MMZA 3FVVA 2R8EA 4QQFA 5ALQA 4MWOA 3E8MA 1K1EA 5ALNA 1RKQA 4L6CA 3AR3A 2Q5EA 3QUCA 5ALUA 1NF2A 1LTQA 1SWVA 2FDRA 2FPRA 1Z4LA 1Z88A 2HX1A 1RKUA 3NASA 2HHLA 4UW9A 3EWIA 5ALPA 1RRCA 3AR4A 4XOUA 2HOQA 1CQZA 1XPJA 4UM5A 3L8FA 1YDFA 1YMQA 4HGNA 3N28A 2G1AA 3N5KA 1U2TA 2ZBDA 1L7MA 3L1VA 1QQ7A 5AI9A 2OM6A 3L5KA 5AESA 2PKEA 2R8XA 3ED5A 3DDHA 3B9RA 2ODAA 4FFDA 2G0AA 1XP5A 5AVYA 5AICA 3B8EA 3NRJA 4OCZA 4YIKA 2RBKA 5AVWA 2YJ6A 4KX3A 4F72A 5AKHA 2FPSA 5ALXA 3F9RA 4L6AA 4BX2A 2G80A 3EF0A 1RC8A 3P96A 3DNPA 5AW6A 3ONNA 2CN1A 3KOOA 4BX0A 3UMCA 1ZD3A 3WKAA 3FPBA 2R8ZA 4EEKA 1T5TA 1L6RA 3NIWA 2WFAA 3FM9A 2O2XA 5ALHA 3SF0A 3OCZA 4UMDA 1VFPA 4HGQA 1ZRMA 1RQLA 4CF3A 5AW9A 4IG4A 3ZWDA 4EENA 2WF9A 2NO5A 5AM4A 3QU4A 2FPXA 2FPUA 3I76A 3M9LA 3VAYA 2B1RA 4BEVA 4YCNA 2BDUA 2ZBEA 4UAVA 5AKLA 4GXTA 4BNDB 3ZW7A 1NNLA 5AW7A 1XVIA 5AW0A 3HLTA 3ZX4A 2FEAA 2EATA 5AVQA 1YV9A 5AKIA 4AS2A 5ALDA 2QYHA 4UAUA 3L0CA 4MUMA 4NABA 2P69A 2RB5A 3WK9A 2WF6A 3SKXA 1RMQA 2B1QA 2O9JA 5ALMA 5AVSA 1IWOA 4H1WA 3IB6A 3ZU6A 2MSNA 1N8NA 5ALSA 4Y3UA 3SD7A 2B8EA 5AKGA 2WHEA 3I6BA 2GO7A 5AI8A 1CR6A 3IJ5A 4Y2XA 1Z5UA 3WKEA 2OYCA 5A3RA 1YNSA 3RFUA 4UU0A 1EK1A 2I33A 1RPZA 2CFTA 1VJRA 2P11A 2I54A 5ALOA 1Q92A 3OCVA 3WKBA 3QXGA 2B0CA 3U26A 3QGMA 4BX3A 4Y2RA 3TLMA 3ZWKA 2YFYA 5AW5A 4NAVA 5ALZA 5AM5A 2WF7A 2P27A 2AUTA 5AHXA 3UMGA 2OBBA 5AKXA 2ZBGA 3WKDA 4BEWA 3N8GA 1L7NA 4J2TA 3ESQA 4HGPA 2EAUA 2AMYA 3I1YA 3MN1A 1U7PA 1RQNA 5IS2A 2IOHA 3FGOA 2GHQA 2BY4A 4C4SA 3ZVNA 2W11A 3L8HA 3S6JA 4UMFA 4CF5A 4Y2YA 4Y2QA 4ZEVA 3U7HB 5AIAA 5IT4A 3OPXA 2HF7A 1U2SA 4NV0A 3OTQA 3AR9A 3ZX5A 3SHQA 4UMEA 5A3QA 5AVRA 4I9FA 2D2VA 3QX7A 4YIHA 1Z4MA 3R4CA 4Y2TA 5AM2A 4EX6A 4BBJA 2HI0A 3L1UA 3NANA 1O08A 5AVUA 5AW8A 4EZEA 5AK4A 4CF4A 3ZI4A 2GMWA 4RETA 3J7TA 1L8OA 5AW1A 5AW3A 1Z5GA 1QH9A 5AKYA 4L57A 1F5SA 5AVTA 2MU1A 3AR6A 1ZD5A 1RDFA 1Z4JA 1Z4QA 3L0YA 2GHTA 3NUQA 1ZJJA 3MC1A 1TE2A 4DCCA 5JJBA 1RLTA 1Z4KA 5AKEA 2C9MA 1NRWA 2B82A 1YJ5A 3WK7A 3NALA 3QUQA 3EF1A 4Y2SA 5AVVA 4YH1A 5FP0A 5AI5A 5ALTA 3W5BA 2B30A 2Q4TA 3AR7A 4XQ0A 5AI6A 2P9JA 3UM9A 1Z4PX 3QU2A 2ZBFA 3KZXA 3W5DA 4F71A 5IT0A 3WGVA 2YJ3A 2PR7A 2IYEA 5ALKA 3WK4A 2YJ4A 2ZG6A 3K1ZA 3QU5A 4UU1A 3PCTA 1T9ZA 4HAIA 3SKYA 4JDPA 4J03A 5ALVA 4HGOA 1Z4NA 2HO4A 2HSZA 3WK6A 3QU7A 3SMVA 1QYIA 3W5CA 1L7OA 3WKCA 4UASA 3DV9A 3PDWA 2IOFA 2I55A 4KNVA 3OCUA 2EARA 5ALFA 2BDEA 5AK6A 1WVIA 5AI4A 3RF6A 3R9KA 3ZVMA 4HYTA 1MH9A 2YMLA 4HGRA 2WM8A 4BYGA 5AW2A 4KYTA 2OA0A 2GFHA 2I6XA 4DWOA 5AKJA 2B8JA 2HF2A 4AP9A 4YGYA 3PGLA 3QU9A 4BKMA 1J8DA 4QJBA 3ZTYA 3CZ4A 4OD0A 2CFSA 1ZD4A 2WF5A 1U02A 5AW4A 4CNQA 4Y2UA 3GYGA 3L8GA 5ALLA 1JUDA 5ALIA 4XE5A 2G06A 2W43A 1KYTA 4ZEWA 2WF8A 2IA5A 4PNHA 3U7FB 5E0OA 3IRUA 5ALEA 1YS9A 4AS3A 1L7PA 2I7DA 3ET4A 1RMTA 5AI0A 5AK5A 3FZQA 3OCXA 2PQ0A 4KN8A 2FPWA 3BWVA 1TJ4A 1SWWA 2YN4A 1Z4OA 4YCLA 3A1CA 4JB3A 3ET5A 4YCMA 1FEZA 2VKQA 3L0BA 3DAOA 2X4DA 4KNWA 3R09A 3FPSA 4FE3A 5ALGA 4UM7A 1RLMA 3PGVA 1ZD2P 5T41A 1PW5A 3E81A 4OHFA 3NAMA 4G9BA 3E84A 1T5SA 1EK2A 2CFRA 4Y2VA 3CNHA 3OCWA 3A1EA 2JAUA 4NFLA 1TA0A 3ESRA 4KX5A 2DQSA 3EPRA 1J97A 3U7EB 2YMMA 3KD3A 3U7GA
chains in the Genus database with same CATH superfamily
3MTBA 4F04A 2AFVA 1OLOA 1DCTA 3M6WA 1RRKA 2HCFA 3PXXA 2AFHB 3NBAA 4P32A 4UVDA 1ZNQO 1GU0A 1CS0A 3B1VA 3OE5A 1M74A 3SN6A 2PEYA 4RVFA 2VSXA 4NWIA 4RFLA 1IOZA 3LT4A 4Q93A 3TFOA 3KHKA 1STOA 2WOJA 2WQ7A 1RE1A 2JHGA 2HZBA 2ZYVX 1MFPA 2F1RA 2W58A 3M7IA 3EWAA 1O5OA 2C8LA 3OEEA 4DJFC 2HHAA 2PUTA 1ONBA 1B1AA 2HHJA 4CIWA 4EI8A 2Y1LA 1E1QA 1UJCA 4FJ0A 4BJ6A 1CULC 1E62A 4MJ7A 2EBFX 1GDDA 3WI7A 1LH0A 4Q7JB 1HFJA 2GVNA 1KO5A 1XMSA 4K28A 3DEIA 4BOYA 3NIBA 1WSBA 1TJ5A 4U3JA 1G6OA 2CFOA 2ONKA 3L4EA 4FMCF 1E3WA 1EP2B 3H2KA 2WTXA 3MSXA 1ESDA 4IQ8A 4HS4A 3RSZA 4DHEA 5ER6A 1T4MA 1JDJA 3IR6A 4QYTA 5FTWA 1WQ3A 2J0UB 1DKLA 1T3SA 3MJ4A 3VYSB 1GSIA 1WRBA 1K92A 1OLXA 1SVOA 4FDTA 4K1LA 5T5QA 1G3MA 1EUDB 1ZW1A 3UXYA 5JSZA 3KQYA 4XUDA 3QLEA 4EFNA 5KDDA 2J85A 3EHDA 5HIAA 1YCGA 2PG3A 3LNCA 1U5AA 4OP3A 5CPFA 1WBJB 4POAA 4Y0VA 4I5IA 1Q0SA 2PZAA 4HI0E 4J4BA 1IY0A 5TR9A 3P9IA 1HL3A 1N6IA 2PL5A 1NU6A 1Y6ZA 2GT1A 2LD4A 3A1SA 5DOVA 1H2WA 3TSOA 3V3TA 3VU8A 3ZGVA 1COWA 1OE0A 4M1YA 2AG5A 4F1WA 4QWMA 3DZCA 3IQDB 4BGDA 2PX8A 4U2CA 3AIOA 5D84A 2XRMA 3M9XA 1QB7A 1S2OA 3CF4G 3QYPA 3RYHA 4B3HA 2C7RA 1OZGA 1POXA 1UK8A 2BMJA 2CUTA 1GUAA 3RLFA 2I4NA 3OZWA 3AYXB 4DNXA 1K6EA 2HDHA 5H59A 1QH8B 3HPRA 4OAOA 3PTLA 2AC2A 2NU8A 1P3DA 3EZ2A 3BL8A 2Q45A 2D0PB 1Z6QA 1Q74A 2GYWA 3DUWA 4HUQB 4KPUA 1KDOA 4UFNA 1JHUA 3T4UA 4IWNA 2X14A 1E3SA 1JHDA 2EERA 1SRQA 3LKVA 1E8NA 4HQ6A 4JQSA 4WERA 4EGSA 4CQNA 4RXTA 4LJ4A 3GQBA 3SX4A 2V0CA 1W4ZA 3QVSA 3JAKA 1BO6A 1BA2A 3KXLA 3B36A 4YDRA 5FKJA 3T3EA 3GLGB 1K27A 1E79A 1T9GS 3CLSD 2D1FA 1Y63A 2VDMB 2P6MA 1PP4A 3A4LA 4RYLA 4KGZA 3EXHC 1II9A 3OHMA 1EFVB 1LDMA 2SECE 4N41A 5EKTA 3UHJA 1WZEA 5ALYA 1GL9B 2I71A 3AVQA 5C1IA 2IH2A 2AZMA 1ML3A 2CB9A 3D0KA 3IP6A 1NFQA 2Q8NA 3C16C 5AJXA 4ZOCA 3C74A 2CLSA 3QVGA 2F43A 4EHJA 4QZVA 5MFZA 5IJZA 1IBCA 1AHHA 1G63A 1KH2A 4X7PA 3T7KA 4J43A 5ALNA 5BW5A 2QVZX 3INNA 4U9HS 3S8MA 2OKGA 5AP9A 5IAEA 1DG1G 2H08A 4IHQA 3PNPA 4EI2A 2R1TA 5JQGF 1TC2A 4QHYA 1DAMA 5CRIA 4EMUA 2Z2JA 4OQQA 3PXUA 2AE1A 4RO0A 4KI0A 1XDGA 2BEVA 5EN4A 3X1WA 2P5YA 3HYNA 4UW9A 3V2IA 4Q0MA 3LXRA 4CFZA 1U2DA 3I5YA 3RD5A 2I1LA 2J31A 5DHUA 1K63A 1E3QA 3TUZC 3G1TA 5IXYA 1T13A 3KD2A 4BWYA 1XTJA 3OP4A 2XUZA 4QPPA 1YK0A 2O3SA 2RIRA 3K09A 2ZBDA 3S2FA 3ZY2A 1NLYA 4R9UC 4YJDA 2ZIXB 4LF4B 1RZRA 1BFDA 4B6SA 1PJLA 1GTMA 4CTMA 3N58A 2CNNA 1XTKA 4DV0B 1KEVA 3HTXA 4NYMR 3DSRA 4AG3A 4N54A 3NB0A 5CVTA 4QGSA 5IN5A 3LCMA 1ZGAA 3K70D 4YCAA 4OHZA 1RPJA 1YZFA 1ZP6A 1KKUA 3K70C 1ZICA 5AICA 1ECBA 1S1MA 3LWDA 5E6RA 4HRVA 2JFXA 5CHEA 1HGXA 4RF4A 2BI4A 4YI3A 5FNVA 5AHRA 4GBMA 5HF9A 2MINB 2O2IA 1EA7A 2QGFA 1PGNA 2LV8A 4KX3A 4BNLA 2DUMA 2QTVB 5JDIA 2NUPB 5C46F 2FPSA 2DY0A 4HVAA 1MOQA 2FR8A 1JR3A 1SVWA 1JPVA 3MLBA 2UYOA 4BMZA 4EPXA 4W9RA 4BX2A 5A9SA 3NGXA 2Q3LA 3C3EA 4F6CA 1C7ZA 3R2JA 4HATA 1G17A 4WOCA 2SKDA 3ISVA 3ZS8A 4BFLA 2AOVA 2RGUA 2LR0A 5K3FB 5JW6A 5EP2A 4DV2B 1Z47A 3IOEA 3A26A 2GETA 1AKYA 2HMYB 2VC2B 3EFOB 1RYMA 4C4ZA 2F9MA 3MWFA 4NC9A 3VYUB 5BOSA 4AO8A 4ZI3A 1ONSA 5DK4A 1X3SA 5E3HA 3ROKA 4HDOB 4AJIA 5IRCD 1NVAA 2XEXA 3EXFB 4O2BA 2WKQA 2WW8A 2QMEA 3ZOZA 5BSGA 4JJKA 1SVSA 4AKSA 4M76B 4X54A 5BORA 2F17A 1Y98A 4LFBB 1PJAA 2Q0QA 1SK9A 3QF4A 4N9WA 1FUEA 1FP4B 4ZOAA 2WRZA 4BB5A 1OA0A 4IDFA 4LOHA 1HFEL 1AKWA 1BHSA 2QAJA 3U80A 3WWYA 3OQPA 2QVLA 1DKPA 4DG5A 5BO5A 4DL9A 5C8DA 1RCUA 2PMKA 3VVLA 3MW8A 1R10A 3LFUA 1A71A 1ONNA 2A7QA 2J9YB 5AVQA 2IYFA 3QPVA 4WA7A 2ZB8A 2G76A 2V74B 4HX5A 5BW6B 2ZI9A 1KDRA 5GJCA 1N5KA 4W1QA 4F2GA 2R6GA 3H7AA 4RW0A 4P5EA 5A5FA 1DHRA 1JRLA 2IP2A 3T0GA 2JZOA 2W37A 4MYTA 4M36A 2O9JA 1QTQA 3HJFA 5MGBA 5EXDA 1T9KA 3L7BA 2FHSA 3ZE9A 1EG2A 1GGKA 3K9LA 4DC1A 4HBGA 1DEOA 4PHHA 4DT1A 1KMNA 1GWNA 3D59A 1CQXA 3TCKA 4TUYF 4YMWA 2NO0A 4P4SA 3I6BA 3OLVA 4NQZA 4AKGA 5BN5A 3ZV5A 3DA8A 1U8FO 2VYFA 5GPBA 3RREA 1F1JA 2O2YA 4YRAA 5D5PA 1D5CA 3BIOA 1RWKA 1UOQA 2WJIA 3AB3A 2D6FA 2H0RA 2GKSA 5L6LB 5DZSA 1ESCA 2G17A 2WVJA 1ATZA 4TXJA 4TVOA 3V8EA 1T3HA 3D3WA 2AEFA 2M6RA 3M1IA 3R75A 2Q0HA 2P11A 4DYVA 1F3OA 4HLUA 3IMGA 3M2TA 2RG1A 1D6SA 1C1DB 1QVVA 5K51A 1VMKA 3RIXA 5GZ6A 1QKIA 3DMRA 4PVCA 5TB5A 3T9BA 1H6DA 1Z16A 3ZU4A 2PM8A 1AGRA 2Z6AA 2ZVQX 1G2PA 4NJMA 1R50A 3ZCTA 1F8FA 3N8GA 1MVOA 1OWPA 2P9HA 1P2DA 3O7MA 4KJZA 4AROA 2C5HA 4C1NA 4TYWA 2PYDA 4DLLA 3KHUA 4BMSA 2HTEA 1RRPA 1GAEO 3DVAB 3F7OA 3QVJA 4TS1A 2F1KA 2ES4A 2ADMA 5FTNA 5KIAA 1PJSA 3L0PA 3LC1O 3ZLVA 3DMNA 4M7RA 2UYCA 2RJOA 3FPHA 4TMYA 4B84A 3DMFA 4ONEA 5LIPA 5DW0A 4MA5A 2VXCA 3BJIC 4BECA 3THWA 3MRSA 5CDFE 4KXNA 5JRDS 1IJBA 1RBZA 2JGDA 4QULA 2ACEA 2BFFA 3ZVNA 1SB9A 4KR3A 1GV0A 2XA1A 1IY8A 2M9MA 2YYYA 1TLFA 1KJYA 1U80A 2B8WA 2J9FA 3PHCA 1MAVA 4OHPA 3TOXA 4DYHA 2EG9A 4TXLA 3HBLA 2FWAA 4LE1A 4ROTA 3RVJA 4AJPA 4QTTB 1NW6A 1O97C 2BGWA 2ZIEA 1W34A 2V9CA 3W6UA 1IBMB 2VLIA 4OGKA 4J90A 1IJFA 2JK1A 4PAOA 3ZX5A 5HW0A 4UMEA 3RKRA 4EA7A 2D2VA 5TE9A 1J33A 4MGIR 5D87A 3QNUA 4G1VA 4X65B 4Z9BA 3VDMA 1Y7TA 3ZDAA 4EX6A 2P6RA 4MLZA 2XMDA 4R0MA 1FSGA 4MRVA 2EHJA 4V0RA 2WB4A 1JQAA 3QLVA 1BX3A 2PV7A 4G4SP 1PNVA 1UJ5A 5EMJA 5TMDA 4Z7QB 5BQFA 5AVUA 3T1YB 3RHZA 4XYMA 1DQNA 1TADA 1TO2E 3AEUA 4IGFA 1CLEA 1M2VA 4HUTA 4MRSA 1JEEA 3TRJA 2ZI4A 3WFIA 4I1SA 4S12A 4N5HX 4WZBB 1Q11A 3BXXA 1LI5A 3GAMA 3F4KA 4AF8A 2WQ6A 2IY7A 4JNKA 2IEIA 4JT9A 3AFOA 2PVCA 1TT5A 1F2TA 3C6BA 1RDFA 2F1OA 3FNHA 3KKNA 4GBED 2ETVA 5LSAA 3PQCA 3HS3A 3RF7A 2RGNA 4JA2A 4DA9A 4XEUA 2J9XB 5DHAA 1YZHA 4MV4A 3DMHA 1Z2CA 4M1KA 3SC3A 4AQDA 4F5EA 4YCSA 5IMSA 2Z1NA 2C9MA 2BM9A 4WKBA 3LDGA 2X0FA 4MYHA 3PGJA 4M9QA 4A92A 4OHWA 4TOIA 4BQEA 1JT2A 3NALA 5IVHA 1QYWA 5AI5A 2CVHA 5CFQA 1TQ2A 3INYA 1GPUA 3RS8A 4PANA 5KJEA 1RW4A 2QTHA 4RVSA 5CLFA 2H52A 4RQAA 4FLEA 3VDQA 4P98A 4Y6LA 5LP6F 1WXIA 4DCSA 4EYOA 3JVDA 1Z6YA 1LTHR 4RCYA 4K05A 4RMHA 5EKSA 4E5KA 1JALA 2PXAA 1S6YA 3GW8A 4FOPA 3TRKA 2J9FB 3C5HA 5SZHB 2IZZA 2Y2VA 4C6TB 2VEOA 5B6PA 4DRXB 1XDUA 2PBFA 4IIJF 4ENUA 1N92A 2AK3A 3OJCA 1VSQA 3PR2B 5HRUA 2C78A 4ACAA 1FRVA 2HD4A 2FB9A 1VL0A 3HDHA 3HMQA 4CDGA 3E2MA 1BN6A 4GRAA 5GM1A 3KSBC 1KO4A 3GRPA 1K66A 1FQJA 2C3MA 3KHSA 4PLGA 4QXOA 1XELA 3D7SA 3EAGA 3N0VA 3NG1A 2ZJAA 3CPJB 1OXXK 2R8RA 3HCOA 4UQOA 2J3DA 5DHRA 5DTRA 3STYA 4IV5A 1YR7A 1R8JA 1ZVJA 1ZONA 2OK8A 4P7FA 2XYQA 3I4FA 2I4IA 1QK3A 4O6VA 1H2EA 1QC5B 3EY9A 4L75A 2ZAIA 1IG0A 2WTBA 1CYEA 3WRXA 1QYIA 1MJNA 2CHUA 2RKOA 2UZ3A 1K68A 3B7WA 5K6AC 4JGGA 2LW7A 2Y92A 5CJ2A 2NMVA 3CQ9A 4KNVA 4Q9IA 1ZJYA 4KZPA 2P2NA 3ZHQA 4FT4A 3C5EA 3TBKA 1X9IA 1L5MA 1Z5WA 1FYWA 1CB0A 1JBQA 1A8HA 1MAAA 4JLNA 3GPBA 3SICE 1DDGA 1E1KA 1HLFA 5K4GA 1KQOA 4LYYA 3VBCA 1GPBA 4GPTA 1GV1A 2Q9CA 5A4FS 3UQYS 3EDYA 1OYWA 3GJTA 2DFPA 3ZHCA 4BFZA 2VRCD 4XKJA 4UEKA 3UT0A 2QX8A 2P7IA 4C14A 1VGRA 3GY0A 1RJGA 4CM8B 2B92A 4V0OA 4OSPA 2GYVA 3GGPA 1UMBB 5FEMA 4TQ9A 1WSWA 1ZISA 3CLRC 3ETHA 4HBZA 3REQB 3SOZA 4LSGA 4D9EA 4MDFA 1YT5A 1S8FA 1AN0A 4PNHA 3AFHA 3I8OA 1UWVA 2DGDA 2XSZD 3ET4A 1SBCA 3D4IA 2IT1A 1QONA 3BZWA 3FZQA 3QQPA 2CEKA 4Z0NA 5LZ4A 1SD1A 5FXMA 4CLRA 4X6YA 1MFZA 3KJIA 1I6WA 3A8TA 1EWQA 4MW1A 4B40A 3IELA 3LV8A 3BORA 1ICIA 1MB4A 4O4LF 5E7IA 3W6OA 3KVRA 2OO5C 2IH5A 1TQ4A 4C3VA 1G4UR 4P5PA 3G2IA 1NG1A 1QRAA 2FPPB 2G71A 3DVSX 3JATA 3LZDA 4ZOBA 5H80A 4ZYYA 3PLAE 2IS1A 3L77A 3Q8MA 2ASEA 3HG7A 3M34A 3MGCA 1QG0A 4YJ2F 5T41A 2XWBF 1NRJB 2JBWA 2F8MA 1SOAA 4FNMA 4OLFA 3UG7A 4S04A 1WXDA 3VZQA 1Y3HA 1DAFA 3FOAA 3G85A 3I2KA 3O8OB 4HDMB 1GKYA 2O7QA 2W2LA 2ZRKA 5DJ5A 3UJPA 2Q2QA 5HKKA 4RPLA 2PD3A 2AZ4A 1YVDA 4RC9A 1WU8A 4O4HF 4IJWA 1J0EA 4W9MC 3UAYA 2R1ZA 3ZH9B 2YDYA 2Q1SA 2GK6A 4IQ0A 4DF3A 2ZIAA 5LL6P 2C4VA 2HJSA 3KUDA 1G7SA 3R23A 1ZUHA 5CA1F 2O48X 3NEYA 1R8XA 4NI5A 1KQ3A 2P65A 5K3CA 2JEZA 3WJ1A 1UODA 1N0WA 5J2UF 1RWMA 4MIOA 1QHFA 3B6JA 4NBWA 4BAUA 4D44A 4C1BA 3OY2A 2DPYA 3MGGA 3U62A 2FF5A 5H9VA 2Z98A 4B4KA 2PWYA 2YW2A 2BFCA 2P4QA 3BE8A 3GO4A 3AM4A 1V95A 3Q11A 5FBRB 4EVQA 3ROQA 1R4ZA 3PENA 4V1CA 3H9GA 3LQ4A 5BT8A 4DFDA 4YMGA 3G2MA 3VNQA 1Y37A 1J21A 4PYOA 1ORDA 1XA4A 4HB0A 1IZYA 2VJBA 3E9RA 3VC3A 3SYLA 3WJ7A 1CY7A 1J99A 4ZVRA 3I0NA 2IHVA 2EZ4A 4ZU1X 1XDDA 5FIUA 4DCVA 1PT8A 1O6BA 2X2FA 1N1GA 1Y89A 3UMBA 3K0KA 2GPAA 3ZUPA 2TSYB 1NBMA 4KL8S 4QODA 3UAVA 1WR8A 4X1YA 3H9CA 4G4GA 4M0KA 2HK6A 3RTGA 2LPMA 1QLHA 2FN9A 2SKEA 3J80A 2PGDA 4DMLA 3GLRA 3G9TA 1Y8CA 3DJYA 1W88A 2D3WA 2W7TA 4JJZA 1O4VA 3ROFA 1O57A 1SKYE 1H94A 2YMQA 3EVNA 1TM1E 1Z17A 2J4DA 2PT9A 2AOTA 2RSLA 3B60A 3OIYA 4ZQBA 5I9LA 2PD4A 5I51A 4WEOA 5C8VA 3JY6A 1LEHA 5CDGA 1DBRA 3PUXA 2H2HA 1VHWA 2BUBA 2XCRB 3PUHA 4IHJA 3K20A 1CJSA 1T1EA 2MTBA 5F3WB 2BEWA 3AB7A 4J0IA 3ADCA 2C7OA 3FMIA 4G26A 3NCHA 3ZWWA 4ARAA 2R1UA 3EFHA 4FFOA 4HOYA 3VPSA 4C9BA 2DZDA 3CJRA 2XCIA 3C7CB 4WN9B 2IBTA 5A7GA 1JI3A 3OZTA 4K9PA 2NQTA 1P8JA 2H4WA 2RAFA 3I23A 5G53C 1P62B 3B51X 4V0MA 5IJXA 4DR2B 1W36B 4E6EA 3JD4A 3QLTA 5K8CA 2IHUA 5KOJB 4LKRA 4ZOQI 2R7LA 3GFTA 3L84A 3QUBA 3TB4A 4NYMQ 4QOSA 1R37A 2QMZA 3CPSA 5AVXA 5DV9A 4MUGA 1O54A 2EVWX 2B83A 1LFDB 4KXVA 4OOFA 3ZEAA 2VDWB 2MMCA 3CX8A 1TZCA 4Q24A 3TLKA 5A9SB 1F5NA 4M9CA 1O94A 2V7GA 3LQ1A 3WSVA 4MWOA 2ACWA 1E3LA 2HEIA 2O7VA 4YB8A 5TGDA 3RIYA 2RGAA 1Q7BA 4O4HB 4WWHA 2SHKA 5EZSA 3KYCA 1H2XA 1NSTA 4DNOA 1I4LD 1RQPA 3AI7A 5IUKC 1GL3A 3E48A 5BQOA 1Q2XA 1LQUA 3PZRA 4ZHSA 3G23A 1LVUA 1XFDA 2C92A 2ZUCA 2ZI3A 2ZITA 1XX6A 2GCIA 4KQIA 1FDSA 4MQUA 3UH0A 5ER9A 4XAQA 4WNAA 5DLPA 2D13A 2W4QA 3OM8A 4MB2A 2PX0A 2PS3A 3A6FA 3DP9A 3OLZA 5AXBA 2NPIA 4G37A 3N59A 4BO4A 1N2EA 1QFZA 4B76A 4KNYA 1V16A 5CJPA 1YDFA 4WCFB 4YRGA 3ZVKA 2NLOA 1XK6A 3QIAA 1PGOA 4FGLA 2G1AA 1XAHA 5BVHA 1Z07A 3M5PA 4PR3A 1KY3A 3M1LA 1GKIA 3O8NA 4NMWA 4PPGA 1SC3A 1SKMA 1E5LA 3MWDA 2A5JA 1H66A 1DJLA 3HA7A 4FCWA 4MPPA 1ZMRA 2QA5A 3RG2A 4AMUA 3ZK8A 2P2DA 1H5NA 3NVKI 1PK7A 4Q00A 4YJGB 1CYDA 4GYWA 4JJGA 3TLXA 3J7AC 3H1PA 3QVGB 4BRZA 3UK1A 5FD8A 1S4MA 1ACJA 5EKUA 3JWJA 2FP4A 4I46A 1I0LA 4OCZA 5EMKA 5CGQB 1CK4A 1SCIA 3KQSA 4HT3B 1RNLA 2QEQA 3S1SA 4GOXA 3EJWA 5AVJA 1H1TA 2ECPA 4YDSA 4Y18A 1E3MA 1ZFNA 4IZ6A 2C0CA 4V0NA 4D57A 4EEXA 5BWNA 1AKEA 2AUMA 3QQ5A 1KQGA 3AZQA 3O4FA 4OLJA 2J59A 4PC7A 3AYZB 5J4HA 4I1VA 5JPDA 3GIDA 1NN5A 5KU7A 4JI5B 2CWWA 1U9ZA 1ZJWA 4L8FA 3EF0A 4TT8A 2ZJ5A 1Z0JA 1JR6A 2WSIA 3AG6A 4CLDA 2RHLA 2IWHA 1FQOA 2VP2A 2NQ8A 3HNRA 1UMCB 4N6NA 4PC2A 1LLDA 3UMCA 4DQDA 1K7YA 2QAGC 1WPXA 2BELA 3AQIA 5D86A 4C7XA 1B8VA 1HO3A 5JVDB 1I2AA 1SQ0A 2ZT7A 4UEWA 5KQLA 3KV3O 1YA4A 3CPHA 1QP0A 4GC5A 2VLBA 3FUVA 4IDHA 3PYMA 4L5BA 3V4OA 4K6GA 1SEVA 4QOFA 3VNRA 1EB8A 2XDWA 1FFXB 3P19A 3COYA 4CKEA 2B78A 4Z0PA 1WDWB 2E82A 4FBLA 5B53A 3HCRA 3H11B 5CNJA 2Y8EA 2VSYA 4ZVNA 2JIDA 3S44A 3VAYA 1TLLA 4BQPA 1PEDA 3CONA 1AUQA 4D6YA 4QFCA 1AM4D 3BQMB 3ELDA 4KBYA 4UAVA 2BJHA 4A73A 4IW3B 2CDAA 2YXLA 5A5EA 1EUDA 3HLTA 3L93A 3ESXA 1CY1A 3MB8A 4IJVA 5IXSA 3KPJA 1YV9A 4DAOA 2H07A 4E5SA 4R98A 4W5QA 1Z68A 1Q21A 4FGKA 1ISMA 1LS6A 3FPKA 3W6PA 4Q3OA 2KSQA 4MUMA 4EPYA 3F3MA 3D3QA 3K1AB 1OZHA 4XJXA 1QJ4A 3MQ4A 5KYGA 3G9QA 2I1WA 2WZCA 4PFSA 3P52A 4RLFA 5C8YA 3RBVA 3CV3A 2ID4A 4IEFB 1U8UA 3VOBA 3DDOA 4Z49A 1OROA 3EXIB 3BB4A 4QWWA 1J5PA 2VK1A 2DKNA 2VK8A 4XJVA 3O91A 3NHKA 4RZSA 5E7JA 3ZXUB 5FEUA 2O5CA 3H75A 5D6OA 4RK6A 4QREA 2VSNA 1QGAA 3UJ6A 2GLTA 2FX3A 2GN2A 1U1IA 3EULA 1A9OA 2O8NA 2RBEA 1D2NA 2B35A 1CR6A 3OQHA 2PEZA 4J3NA 1A9RA 3VAAA 3AM1A 5JCZA 5JRJA 3CF4A 3RS2A 1D4ZA 2O1WA 1RRMA 3AQ4A 2HADA 4MKGA 1MJ5A 4MWBA 3LUKA 3MHPA 4UUMA 3PNSA 3UWOA 4P34A 4L7QA 4OBWA 3NHLA 3PEFA 3JPWA 4P4NA 3SIRA 1XLTC 4BO0A 1GP2A 3W3ZB 3F4BA 4LZOA 4B43A 2OT3B 2WY2D 1HX7A 1J20A 3U40A 4KMRA 3IO5A 2CXHA 2DUUA 4BFVA 1IULA 1OGYA 5IDXA 4RABA 4R5MA 2ZGVA 1V26A 2HXSA 5AHKA 1TUIA 1PZEA 3H11A 1R0LA 3PP8A 3QPUA 4M8NE 2ZB3A 2XX3A 1G8PA 1L7VC 4XM0A 4KQXA 1M6YA 4PXAA 2VPXA 4LJSA 4MR7B 4W8OA 3RUDA 3UMGA 2XCUA 1G0OA 5A3VA 5FBQB 3WAJA 3N0XA 4BP1A 4GZ5A 3PRJA 4BGVA 4FFWA 1LDBA 4MYSA 4B6QA 5LU9A 1VG9B 4DJTA 1CZOA 4ZHQA 3Q0IA 5TT0A 3VNAA 3KDAA 2QN6A 1L6IA 3DOFA 2QMYA 1GAJA 2BP7A 2G1JA 2F6RA 3H42B 3JQ7A 2P1RA 1QZTA 1M33A 2QQ0A 3NETA 4MS1B 4OAPA 2AW5A 1LRLA 4LRQA 3FGOA 2GHQA 4C3UA 2UYHA 2EP8A 2XTJA 2YXNA 2YDXA 2QTMA 1PJQA 1NQAO 2BMDA 1QYDA 3IUPA 2O23A 1BYUA 3L8HA 5COBA 2ZTLA 2FX5A 1QG4A 4GMDA 4CIDA 3MJTA 3HRKA 2HH9A 2ISQA 5IT4A 3SZUA 5E6SB 2IXEA 4GMKA 5LB2A 3JRWA 2XUPA 2D62A 4FHCA 2YYZA 4UM9D 3IVMA 4RY2A 3OPYB 1ISFA 1Z4MA 3BRWA 4PQYA 1KR5A 1CUGA 3FR7A 3PNVA 4V2IA 3FX2A 4QOHA 3FNBA 4WLEA 3SS7X 2EIHA 4OLBA 1XZPA 3ES9A 1XLUA 2L42A 4QXAA 1PFQA 3WZMA 3ZDEA 1DCFA 2D1SA 3EJ6A 1CY8A 2NZXA 5HQJA 1ITZA 2GMWA 2K6GA 3KUKA 1GA1A 2IL1A 3PCXA 4P0TA 3KAPA 5A4JA 2I03A 2OHVA 1CDEA 2ZIFA 2ZZNA 3OFJA 1VPVA 3DO5A 4NENB 3AINA 1M6EX 1X8JA 1ZIXA 2HK9A 3A9UA 2IZ5A 3DLAA 3QKRA 5CX1B 5EIOA 3SE0A 1V1MB 4FSDA 1KJ9A 1GTG1 1LPBB 1B0ZA 1EAYA 1KMMA 1OASA 1VYTA 3ZTTA 3G02A 3RUHA 1IE3A 1ODLA 5KCZA 3NOXA 3IPYA 2Q0SA 2GNPA 1GYPA 2XRYA 4C0KA 1PV2A 2V9ZA 2HT6A 2JFVA 3O6VA 1EBFA 4JEHA 3GJ4A 4I1IA 3TN7A 3KQUA 2Y1OA 3K4QA 1ZESA 2H1CA 4QYWA 4J4TA 4MULA 4WLOA 3T7EA 4DCJA 5KO2A 1DOZA 3OZEA 4EHNA 4YH1A 4KE9A 1NXSA 1U0NA 1W49A 1YR1A 4MUYA 4PHTA 4A2WA 4EHBA 3NDPA 3ITNA 5FDFA 4NLLA 5JS1A 1DG9A 2HRDA 5FI0B 4NEHB 3ENKA 2NSHA 4MR8A 3BN3A 4UCWA 1UBRS 1ZA1A 2GKOA 3O74A 4TMKA 2Q41A 3R9WA 1UXKA 1T0BA 2C4WA 2X0IA 1I30A 2FGKA 4YMSA 3DG9A 5DRYA 3ZS9A 5CYGA 1FK8A 1XE3A 2HU8A 2IV7A 3ZDCA 1UXIA 1HH4A 5FOXA 1YB1A 3FYUB 1CR1A 4IIXA 4H7DA 1TAHA 5E6SA 2QD5A 2ZG6A 2I4MA 4QU0A 3RB8A 3QKWA 4H77A 2VF7A 1VHQA 1QV7A 3LRXA 3IUBA 5JCJD 2BR5A 2ODPA 3AWIA 1VLZA 3B6IA 5IAGA 4Z3DA 1TT5B 2WYUA 4REQA 2AQIA 2A9VA 2PL1A 3ND6A 4EG5A 4DA4A 4N49A 3L7NA 1BKYA 1V1RB 2AJLI 5ICSA 2A1IA 3MWDB 4LV5B 4B2YA 2WP8J 4F3KA 2DTXA 3EGDB 3C8HA 5CFNA 2W98A 4RCZA 3ZU3A 3CZMA 1KP9A 2QRQA 3C87A 4EJMA 3ITKA 4S35A 4KO3S 1L7OA 4W6QA 1L5NA 1T5BA 3DV9A 1RPNA 2QMUA 2X7HA 4ZC1A 3LUGA 3HWX1 4TMTA 3F78A 2NUAB 3LUAA 1ESZA 2HPVA 2JIBA 3Q7IA 2CW5A 2BONA 3RSLA 1X8LA 1VE9A 2QW8A 1EK6A 1BWRA 3AH8A 4ZKEA 2ZWMA 3RF6A 4UUBA 3ZVMA 3QX8A 5ECYA 1QTNA 3WYGA 2GFHA 3H2SA 3HCBA 3P2EA 4NJEA 4GH5A 1IMOA 1PEAA 1YL6A 2VHTA 3JVIA 1ULHA 4UHDA 3ESYA 3H7IA 4P0QB 1CT9A 3H65A 4DOMA 1ORRA 5E9QA 2I0FA 3PGLA 3RKUA 4AP9A 1J8DA 1UT6A 4QJBA 4G56A 1U1CA 2A0KA 5IVPA 3ZQ6A 2CD9A 4B3TB 1TCCA 5J43A 2OVFA 3CJTA 4J1SA 5TDHA 3DVLA 3F7MA 1PVVA 1NBEA 3A6ZA 5JNWA 4O08A 3WNZA 2ZQZA 3BK1A 3LVRE 2KX7A 1TU0A 1KOJA 1SBYA 4MQBA 2O8CB 2P2LA 3EE6A 2FJUA 4TYQA 4AUEA 1YRHA 2AG8A 2PQ0A 3BWYA 3K8YA 2ZSUA 5I3CA 3JVVA 3ZIUA 1G18A 3UXHA 3FH0A 1PO7A 3SBXA 1QO9A 2AMFA 2QIOA 4NBNA 4YR7A 1I7QB 2QBYA 2HU2A 3EIEA 3JQEA 5E8RA 1QIIA 4JB3A 3TW6A 4ETWA 5FOSA 4AZVA 1PX2A 4RVGA 3ECCA 3DF9A 4ITVA 2H4HA 2PUWA 4J9VA 4RK5A 1WOYA 3VYTB 5JH7A 5D51S 2NZVG 1HZJA 2XQVA 4JENA 4UCQA 4GMXA 4XWYA 2QW1A 1ISSA 1Z6AA 3FTPA 3ZCVA 2RHJA 4WGFA 3Q12A 1G16A 1Z8DA 3AILA 1KVSA 1T5SA 2GM4A 4Y0NA 1QZ3A 1MZPA 3IBYA 4L95C 2WA2A 4A82A 2IODA 2O1XA 4CQMD 3NDJA 3OO0A 3WRYC 5EQFA 4PG5A 4IS3A 2PK3A 3LNTA 4FFRA 5FI1B 3RRMA 1G3QA 2BI7A 2E5FA 5T8KC 1HG1A 4MAAA 3RS5A 1KI7A 3HZHA 4LYFA 6ADHA 4LHVA 4DXDA 2C61A 4OA8A 3U13A 3IAEA 1QNLA 4PZLA 4C07A 5JJKA 3TFWA 2AR0A 2NXWA 2EP7A 2HDNB 3KELA 3O8OA 4HDMA 4KODA 1FXWA 4GPAA 1G55A 4KVFA 2AHOA 2D8AA 1LVHA 3HB5X 3EF3A 3L18A 5ELMA 3W2HA 3KQNA 4OK3A 4E6PA 1WMFA 3DEZA 1IY9A 3R0ZA 1PQ4A 3QMWA 2GM3A 1JHYA 2WSYB 4IRUB 2EWMA 3U9SA 1YWGO 3G9XA 1XR3A 3AV3A 4WXEA 1SXJD 2A59A 3KX2A 5DLQC 1IUKA 3OT1A 1XNGA 3GDHA 3H2JA 4QUEA 2C7VA 2QI9C 2XUHA 3AERB 3BA6A 3DM9B 3MOGA 3KYBA 4P38A 3E9CA 4RSRA 3IDSA 2COEA 4QTUB 4YRBA 2P4EA 3EA5A 1NG9A 3GA5A 2CBGA 3RFVA 4FQ7A 3VYWA 3A6KA 3ZE8A 3LYAA 3PXAA 4M38A 3ACCA 4A26A 2ZJZA 2C20A 2ORED 3GRCA 4JXJA 2JKVA 1JU4A 4H59A 2AN3A 1UBCA 2AYXA 3MA0A 3QKSB 1Z37A 1K6IA 4L27A 4P3KA 3OHSX 3T5BA 4B5LA 4CEJB 3FZGA 4A6DA 5A4KA 1Y1QA 1ZH4A 1EVYA 4RSHA 1SZCA 1HLDA 1SC9A 3MS2A 2QTGA 4B09A 1L5LA 4F4CA 3COJA 1PL8A 1HF3A 4LWZA 4DG8A 2K2WA 5A02A 5JNRA 3B13B 1M1UA 1UZMA 2H7XA 2G9VA 3K0HA 4X20A 3SSOA 3U19A 4B7UA 4JI4B 3CLUD 3H86A 5LA6A 3PR3A 2A0WA 1V2HE 3LHKA 1RWNA 4XX1A 2XCOA 1IXRC 3O3MB 3WL8A 4JKIA 4Z8YA 3COSA 4ZOLB 2G09A 4D7AA 2NO4A 3GH1A 5EZ5A 1KH1A 3OPYA 1VL1A 3RAGA 4BFUA 2ABWA 4DT1B 4B81A 1XPRA 4FLFA 3EZXA 2P90A 4KWEA 3BH6A 3SZLA 5KQSA 1FUUA 2PUVA 2XKJE 1IAQA 4HLQB 3RIEA 3B3GA 1YGYA 3M1YA 4XWGA 3L2OB 3WADA 4ZICA 3OZIA 4R8KA 1VIVA 1M8FA 4DY6A 4KBGA 2YTZA 3AF0A 3LK6A 2W2NA 4R7GA 4KB5A 3C3DA 3MAJA 1R0CA 2JC3A 3AF5A 3ESDA 3IEUA 4TXNA 3ND7A 1H42A 1YF3A 1ZNZA 1N0IA 2HEGA 2HYDA 2ZS7A 3UB2A 2RFLA 3E3AA 5CA0B 3JYOA 4JI3B 1GQ2A 1XEWX 1RAEA 1RLUA 2FUNB 1OMOA 3QMPA 1CEYA 2UZAA 3K1JA 4EZBA 2UVQA 1H2FA 3CH5A 2X3YA 4F4FA 3HDJA 3DBLB 4KGXA 3VR4D 5EIEA 5HQ3A 4QOGA 1WEHA 2YJ5A 1ZN9A 2NXEA 3D8RA 3EVGA 4PSCA 5KTPA 1YFLA 3G7UA 2LP4Y 5A9TA 5A0VA 3CZPA 1WV0A 1T6BY 2YVLA 3T95A 4DR3B 3PFHA 3D6NB 5G41A 1C8VB 4JC8A 2JI7A 4M8IA 2H1OA 5EJIA 3OG9A 5TARA 4R71A 4OHXA 4O1HA 4QQFA 1D04A 1ENYA 3AKYA 4WBXC 3AHEA 2QRMA 4YO7A 1HTTA 3QVOA 1R7RA 1VMDA 1VB5A 2GSDA 2RKWA 3W9UA 1LBHA 1M1XB 4Q6BA 2O20A 5CAEB 1KJZA 3JYQA 2Q3BA 1KYZA 1U0OC 4RS4A 5JV5A 3H99A 1JZSA 2MYUA 2YV5A 1EUYA 1AQUA 1OBCA 2OK7A 4RTQA 2E37A 1P72A 5BSVA 3UUFA 2Z83A 4LDAA 2ERCA 2O2EA 5J63A 1RRCA 1KPIA 2H48A 5HYVA 3FD8A 2WHPB 3ZZMA 5K3OA 3E4CA 1DFIA 2QORA 3PF9A 4I6JA 4NARA 4WZBE 1YI0A 1CQZA 3V1YA 4AX8A 2PT5A 3QXSA 4Q21A 4Z1MA 5L7WA 2OP1A 4HN9A 4MCAA 1QYXA 3IIKA 3N28A 3F9CA 4R5HA 1UBTS 4N12A 4EFMA 4KYVA 2HF8A 3H8SA 3L1IA 4N7BA 1TGVA 1WABA 3ZHZA 3BIFA 2X22A 4RWEA 2VUSA 1BOFA 2ZCJA 3OO1A 4X41A 2QX4A 3UHPA 4D8TA 1Q20A 4ITUA 5DWVA 1AB6A 1OFVA 2ZIXA 3K2QA 1NJSA 1ZGBA 1U3TA 1VKZA 2AMVA 4H3VA 1UBLS 3OZUA 2EKQA 3OE7A 2BGTA 1JAZA 3EQ2A 3FVTA 3O95A 1T5HX 3OFSA 1Z28A 3CLUC 3PSAA 1NX9A 2RGEA 3N7UA 3WL6A 2FUKA 3I9NA 1UXOA 3ZWQA 5HTOA 2GLXA 2CYAA 5DH9A 3G13A 1KAGA 3JQAD 1JQJC 4BCCA 1ZSVA 1OB2A 2V1UA 1OOEA 1Y7PA 1P7ZA 5D1HA 5JY1A 2I7XA 2ZRFA 3SXUA 1TVKB 3R0VA 5THKA 3GLHA 4DIBA 2BGLA 3K0SA 1I2MA 1N8TA 4L6AA 5GV7A 3ROTA 3GUUA 3OJXA 2G80A 4MDYA 4JROA 1R0WA 2ID9A 3HA3A 2IH4A 4XLTA 2FJ0A 1Y6RA 1CDZA 4FK8A 2XBLA 3KZMA 3NFYA 4H3HB 1TIBA 5AUOB 4MROA 1EAMA 3V3KA 2QGZA 3CUSA 2DE0X 5JMOA 4LXTA 4EW2A 2ERYA 3WB9A 2XTAA 3D0RA 5E9WA 3NJ4A 4YJKA 2JFGA 1A0OA 4K2HA 2WICA 2YR0A 3KJHA 4FE7A 3BXGA 3VZSA 4YQFA 5CFZA 5B7GA 4DJ5X 4C7VA 2WJ3A 1XPUA 1NV9A 8GPBA 2W2XA 4G1UC 1MXFA 3M0EA 4FNOA 3G6WA 4LMRA 2UUAB 2VJKA 3D4OA 3JATB 1E6EA 2C1EA 1F6WA 2AFHE 1YE8A 1E99A 3H19A 3O73A 4K26A 1BROA 2VPTA 1XU4A 2GAFA 3ABOB 3PQDA 2X5KO 3WLKX 1J7KA 3SSAA 1QCCA 1QH1B 4WV3A 3QH4A 5I6DA 1VKNA 1Y1SA 2BTQB 3V8VA 3BCUA 2JIQA 1XVIA 3IKJA 3MLAA 4K8OA 1FNCA 1SCUA 2K7ZA 3FUXA 3JQ6A 1HDXA 2GILA 8MHTA 2P6OA 3SSMA 4UOZA 2XRFA 3H0EA 3R5JA 4V0QA 5ALDA 4FYHA 2PZ8A 2IHYA 4M88A 2F4VB 4MLDA 1GY8A 3WK9A 4CIBA 5I7WA 2AKYA 3Q7QA 5TQ2B 5I47A 4RELA 3WDKA 1WULS 3DUFB 4JOQA 4Y1FA 5DIZA 4Z4FA 2HRCA 1RXVA 4RFSB 1MX1A 4BNGA 1PQUA 4L6IA 1H8HA 2PRJA 4C7BA 1GPMA 1PW7A 1Z8HA 3GYBA 3LS2A 3PFKA 5JTTA 3IALA 1BZYA 4OP2A 1L4YA 1L5QA 1N2JA 4RA6B 5TPWB 1P5JA 3IJ5A 1CY6A 1S3FA 3MSCA 1HYEA 1XCBA 1Z5UA 3PJEA 4QAJA 5DEOA 4BQQA 4DSNA 4FW9A 1WUJS 3IA2A 3EXG1 3NYWA 1AKMA 4C89A 3B6EA 2H59A 3L4BA 1AK1A 1RS0A 1WL8A 2AI1A 2GSWA 3D6FA 4CR7A 2R84A 2JIZD 3R7LA 4TVKA 2PZBA 4L4UA 1Y9JA 3O47A 3AF3A 3NAZA 1UMBA 2K5UA 4J0CA 1KSFX 1CS0B 3NBZC 4V24A 1KFKB 4UZSA 3L01A 4HNRA 1ZQ9A 4MYDA 2P0EA 3OCVA 4K5QA 3T4EA 2B4QA 4CV2A 1K06A 4IHJF 3ZLJA 4C03A 4MAMA 1NVXQ 2NM0A 2B9VA 1UZUA 4O2BF 2YFYA 5FLEX 1K8ZB 1X1EA 2GF9A 4NE7A 4E0BA 1E1RA 2O0HA 4XIGS 3AKCA 5AR1A 4EM6A 4U6QA 2ZAYA 3IRVA 5AQEA 2ZBGA 3IQWA 4CVNA 4U8HA 5DU2A 3MTGA 4C30A 1ZM7A 4EZIA 1Z8NA 3KSUA 5B1HA 1D0SA 4RIIA 1GGEA 4QNMA 2EAUA 1AT1A 3ANLA 2QD4A 2HT1A 2F9FA 1KRHA 1QNFA 3ADBA 3DWEX 4EA6A 2H7VA 3GQVA 5TPZA 3NVAA 2IZ0A 3PPYA 3FXAA 1MIOB 3M4ZA 2B0JA 4PICA 4QOEA 1U8ZA 3S2YA 1PS9A 2XITA 3SIXA 1AO3A 2UUBB 4IIUA 1BHQ1 4IZHA 3SJBA 4UE6A 1RR6A 1DL5A 1U28C 3P2MA 2CD7A 4TLLB 4LZLA 4AECA 1XA0A 4HHEA 3LVQE 1ZCZA 3WYFA 4O4IF 4FS3A 2IXBA 1GCOA 1USKA 4JUBA 2OQIA 4XX0A 1S5PA 5SY9A 1E4OA 1J4AA 5A5DA 4ZQHA 1JAYA 2G88A 2JHPA 3NNNA 1N5LA 3CFYA 3EDMA 3J81A 4WCFC 4N76A 2Y67A 1XVLA 2G67A 2FHPA 2ZXFA 1UFQA 1VTKA 3TDNA 4Q4JA 3TQCA 2A0XA 2C9DA 5HDBB 2HSGA 2RHOA 2KM1A 3FUCA 4BBJA 2C4MA 1P5FA 3DXXA 2VHWA 2P9YA 3VR1A 5DTMA 2Z8YM 5JZSA 3R7WA 2ZBVA 3DWFA 1QHHB 2IW3A 3VPGA 4DLSA 4UAGA 1HQDA 2I78A 2VHEA 2HNKA 5I4BA 3MD9A 1IK4A 4F1KA 4OY3A 1R74A 3FOFC 1VIAA 4K0RA 1GPH1 3TQRA 5DNYB 1E5XA 1GGJA 3GLQA 3ODPA 3EW9A 4B4DA 2EBHX 2EHDA 1ORWA 3UNXA 1UDXA 2FZVA 1CF4A 5FOUA 3ZYCA 2V7PA 1Q44A 1RABA 1NC1A 2VNHA 2O1EA 5JAMA 4HGZA 5EIXA 2XCSB 4DCCA 5ICFA 4ALKA 3FLBA 2X41A 2FY8A 3IXQA 5AKEA 3W2TA 3ZCPA 2IYLD 3P20A 1AMNA 1PNTA 2H9IA 4C08A 4HLCA 3PEYA 4B3DA 2ORWA 1NVUQ 2IPXA 3P97A 2OEPA 1X7ZA 3NPAA 2C7BA 3GD5A 4NNOA 4RGQA 3FRHA 4X61A 5BSRA 4C4AA 1R8YA 4EDFA 2Q4TA 1AKTA 1PWEA 5EG5A 2DFDA 4DEXA 4QYMA 2ZATA 1VL6A 4L85A 1CJTC 4M4SA 4PZDA 1HE1C 4C4YA 4CKCB 3C7DB 3OEHA 3THYA 4HPWA 2BSAA 3PFIA 4U4AA 1AH2A 5LDDC 2A5LA 3Q7TA 2RGWA 4RY8A 4A5OA 3HXQA 1GGMA 1QHSA 2VTVA 2PLRA 5MFPA 4JI8B 1ZG3A 1ANKA 2VBIA 2WTMA 2JDID 3G8DA 3NBQA 3IOYA 4ZALA 2QBYB 4C6TA 3UAXA 4ATNA 4FOSA 1ECFA 1EEHA 3QEJA 1DTEA 1QIJA 3AIMA 4F5WA 1B8UA 4NBUA 4EQ6B 2IDJA 3E5NA 2J4CA 2ZRMA 4ZAZA 4PYJA 4ETMA 1RZRD 1MJGA 1VE6A 3ZY4A 3CB4A 3NO4A 1U99A 1OFHA 1OJLA 2VNKA 3WLIA 4P80A 3MTAA 4J03A 2LCQA 4KXLA 4PY2A 2IYZA 3DHEA 2WE7A 4P4UA 1VSBA 1QVAA 3DTNA 4JEUA 3VOTA 4QTYA 2OBYA 4WNYA 1SR8A 2R48A 3QXJA 4RZ3A 3RGWS 1MR3F 1BJKA 1OI3A 4DIFA 2PGAA 4BLVA 5JEEA 3R7AA 1KU6A 9MHTA 3BD7A 4NE9A 3VRHA 3OCUA 1KIMA 2CMKA 2EARA 4QOJA 4RJTA 5ADUS 3SJZA 2DEUA 2BFOA 3KJGA 3Q3GE 1FDOA 4LWQA 3C4QA 4G8BA 4X64B 1C8LA 1DDOA 3I58A 2OPBA 1G60A 1UPFA 2QM0A 3ROXA 1JEJA 3JYHA 4O2AB 5C5EA 2ZSJA 2LDBA 5A0TA 3IVAA 4RIHA 3C1OA 2V9PA 2NTVA 1CDDA 2ZS9A 3GMSA 3ZY3A 2NV0A 4RS3A 2HNAA 5CXQA 5KYXB 4JVOA 3ASVA 1R0RE 1SURA 3MGKA 3P0EA 1PQPA 2WV9A 5ESDA 3CNBA 1DC4A 4MB6A 3H2IA 4XJTA 3B1ZA 4PE5B 5DSTA 2F3RA 4FYKA 3CNLA 4IOMA 3T7IA 2WUWE 2EX0A 2OZLA 3UQZA 1PT9A 2BV3A 1JFFB 2AWNA 4MHSA 2ZSEA 4B71A 4RZUA 4CM8A 4H1TA 1U3VA 4ECAA 4WK6A 4EG4A 2CHFA 3BWCA 1YBHA 3CLVA 3CG0A 3GL9A 1GTJ1 2AR9A 3SHOA 4JASB 3T1QA 3G8YA 4QRDA 4E2XA 1AKQA 5E2BA 2F1IA 3FTNA 1VIDA 2WWVD 5K0CA 4D99A 1ZHHA 4RHEA 2D2IA 3CZAA 3K0CC 1ZI6A 3GGOA 1V4VA 2C03A 1E1MA 3A1CA 4BLPA 1WZNA 3GLIB 2E85A 2JVKA 1YD7A 1DZ3A 3KUUA 1M2KA 3KSZO 3HGMA 3L0BA 1C4OA 2HRBA 5ERGB 1BMQA 1A50B 1ULSA 4LJYA 4PN3A 1PJCA 5I7OA 4IIGA 3BX1A 2JAHA 1FC0A 5FUVA 1AD2A 4ENTA 5T64A 5IM4F 4MXDA 4LNAA 1XPOA 2YYSA 1KDZA 5I5EA 1PX0A 2OM2A 3ZLBA 1K97A 4UXIA 4JQCA 3ERCA 2LUOA 5BUSA 2ZUDA 1EK2A 3A4VA 2AQKA 5EZYB 1I10A 1MTZA 4WGGA 4RE6A 2I62A 3H6KA 1Z6TA 5IH7A 3DL7A 1Y4AE 4MA4A 3LWNA 3S55A 3ESRA 5FL3A 5I7RA 2DPMA 2VT6A 2YW9A 1GU1A 4L76A 1I0ZA 4LPSA 7ADHA 4NZOA 3I2IA 4LNUA 5FR1A 1FJGB 1WZCA 1E5QA 2WIKA 1T2EA 1GSHA 3EIFA 3TBFA 1UBEA 1JH8A 2ATCA 2C8JA 4BGIA 1ID8A 3LSTA 3F8WA 2J7PA 3QE3A 1G20B 4LMPA 4LKOA 4PNZA 3MUFA 4U00A 4BUJA 4ZDIA 5FX2A 3I53A 4HH3C 1R15A 5FBKA 4CT5A 3PDIA 4B9AA 3N70A 1FB5A 1N0HA 1XD8A 4Q37A 4ENVA 5EHNA 1RZ3A 2VTKA 2Q3CA 4QAQA 3QUTA 4ETIA 5CK5A 5K20A 1GTZA 1AUPA 5JJLA 1TI7A 4RNDB 1SPBS 1JIVA 2JH9A 3OY7A 1JSCA 2JCVA 3B48A 4PYIA 3LY9A 3QW4B 4HWTA 2CMGA 2G83A 2WUEA 4TT3D 2BE7A 4PBTA 4UHEA 3MGAA 4QNRA 1DX4A 3Q10A 4Y2JA 1OVMA 3CY6A 4MCHA 4K9QA 3H3JA 2GARA 2XUDA 4CIAA 4JGIA 2XADA 4GZMA 4KTTE 4OV6B 3ZBQA 3LKDA 3MWEB 2P6UA 2UXDB 2D0DA 1EUQA 4ARCA 2YOGA 3BMQA 3ZCXA 2WTUA 1X80B 3OZDA 2NG1A 5A4DA 3EOZA 2IBSA 1W0JA 1Z18A 4BTLA 3S4YA 3GMIA 2IZ6A 5DDIP 4YREA 1W48A 5ECDA 2O8FA 1XROA 1Z5ZA 3CEMA 1ULZA 3NC1C 3NRCA 4Y9UA 2HJRA 1LSUA 4CBVA 4CPDA 2X13A 4UVIA 2QVGA 3HKDA 3P27A 4H7PA 1U6IA 3VU1A 3AY6A 5DB4A 4ZJUA 4W7IA 2QL7A 1ABEA 4PW0A 2BI8A 4DDUA 1OFGA 4RD2A 3AJ9A 3HN2A 3BMNA 5JFGA 1MDFA 3A3PA 2ZU0C 3EDQA 2YVQA 5BUQA 2V6IA 5THXA 5LYJB 2OBXA 3GOQA 3LDFA 1JE1A 1A5ZA 4Q1VA 4C04A 4U2FA 6GPBA 2OLJA 4DBLE 4MS3A 1FUKA 1AXRA 2HL6A 1FNNA 4EYEA 3F9IA 2GTHA 1LS1A 1YBVA 1PG2A 2HBRA 1MJHA 1Z6XA 4LZAA 4ZQFA 2YINC 5F1PA 4C5AA 1OTYA 2QM8A 5YASA 1DI0A 4CQJA 5ICEA 2FMUA 4I5DA 4IDPA 4ZEXA 4P08A 5T6BA 5CLJA 1E9SA 2E6UX 1U0JA 3STXA 1T10A 2HHCA 4II7A 2PWPA 4DJDC 3K6SA 1NZJA 1SKUA 3S29A 4UNNA 1KI6A 1DC5A 3T7JA 1TK2A 1GLVA 2WKSA 1MHPA 1P9RA 2QAGB 3AESB 3TW8B 4FKMA 3VNSA 4I4TB 4Y6OA 4DN6A 1SQSA 1ZW6A 1TF7A 3TNFA 4DQXA 2QG4A 3BWXA 4QGFA 5CD9A 2W83A 3KTAB 3F5MA 5AKKA 1RYDA 2OCXA 3D6JA 1YZTA 5EZYF 3VR5A 3MMZA 4BS9A 1HFWA 3SEZA 1M5RA 2DHEA 1A5AB 3R0QA 4FYMA 3BT7A 1ECPA 3BDVA 1CQWA 3ZK9A 3SG0A 3AUSA 3I5MA 4DSUA 2FFQA 4JJEA 3LTEA 2JFWA 3T9CA 1AMUA 1ZR2A 3J81k 4JQYA 2NZ2A 4CNBA 4BRUA 4DV5B 1PJ4A 1V39A 2JATA 3IT0A 4YK7A 3V6MA 3WWDA 2RGDA 4WBNA 1MPXA 1XMIA 1GZ6A 2HHLA 2PLWA 1O95C 4AJLA 5HKBA 4LCJA 3FOCA 3KOWA 3LX5A 5LB4A 1TEHA 2II6A 2R85A 4J4HA 3H1AA 3SGLA 2XR1A 3PQ6A 3ZY6A 4B1FA 5GV8A 1VIMA 1XTZA 4IDCA 4TVBA 3KYIB 3L8FA 1KMHA 1YMQA 5JAOA 2X7JA 4R8MA 4LF5B 1SFRA 4ZQGA 1CVIA 3AHHA 4YYEA 3L1VA 2FP4B 4QUKA 1PL6A 2BTQA 3PHLA 3X1YA 4BAGA 4PS0A 1VPWA 2E18A 1BQEA 2HJVA 4G84A 1Q22A 4WH0A 5U9CA 2PBZA 4O4LB 3DDHA 5DTQA 2ZR0A 3PUIA 4MI9A 4PHGA 5P21A 2ODAA 2V7VA 5B7NA 3W9BA 3GB9A 3TEJA 2CZQA 4G5YA 5F5XA 3GBVA 3CVVA 2XPCA 4XD7A 3HCPA 3QFRA 4NEGA 5IDWA 1MT3A 3CRZA 2VH2A 3DMTA 4MS4B 1KJ8A 3NRJA 4RKFA 1BMFD 2PIAA 3KPVA 3QPBA 2QTCA 1FP4A 4UHFA 2WJZB 2ZULA 1XNQB 1LBQA 2CMFA 2ZUTA 1NLFA 2RC5A 4JT4A 4EUFA 1F6BA 5D7NA 5BT9A 5DLEA 3ZWBA 3FYHA 5TGTA 2HLDD 1W8DA 4MWSA 4BX8A 4I9NA 5H16A 4MVJM 5JAPA 2XE8A 4OK6A 3I8SA 1VL5A 1K5HA 1KWKA 2HPAA 1M2WA 2XDQA 2ZDHA 1NVMB 3HZZA 5CXUA 2I76A 1QRTA 1ZD3A 4B47A 1SUAA 5EHXA 2AXPA 2XMPA 3I73A 4JJIA 4PIMA 3R44A 3TNLA 2Z6VA 2H1IA 5DGTA 3MJRA 2V6FA 4NVRA 2HQOA 1JT9A 1VPEA 1CQIA 1JV2B 4CL3A 3PF8A 1J9ZA 4JU9A 4DLKA 1U0LA 4U7FA 5KUTA 4RIFA 1P81A 1JLKA 4IDOA 4DJEC 2NO1A 1PWYE 3SS8A 3EMVA 4ZT5A 3PXBA 4P4LA 2ONYA 4UNSA 3L0OA 1Z7GA 1FXWF 1CR2A 3HBNA 1VZ3A 4ALMA 5CPBA 4NOLA 3ZNNA 1RWOA 2X1MA 3DF7A 2XCQA 5NLLA 3S2SA 3V1UA 3W5UA 4HH4A 3B7GA 1SCDA 1BE8A 3GUVA 4OMFG 1XUOA 3W3AD 3Q15C 4MQFA 2V03A 4DRYA 2B1RA 5TGZA 3QBDA 2GA8A 4QU9A 4YCNA 1IEQA 1H0RA 3H5NA 4UTNA 3FWPA 1KR2A 3OA2A 3K0AB 5B4UA 4JOCA 2ZBUA 1KAHA 1P7PA 1CXZA 2WWTA 3M82A 3DEFA 4LTDA 2V1XA 4OM8A 4Z2AA 4AS2A 2R44A 4GL4A 1O6ZA 5IC6A 4UAUA 3T8YA 2V4ZA 2QN1A 1EFAA 4NABA 1RHRA 1GRCA 1NM5C 2P69A 2QSJA 1GITA 3CLTD 3PDCA 4NBLA 4NMLA 5EJMA 3U3KA 3PGMA 1GL6A 5FPSA 4B9EA 2PGLA 5KNCH 3LOPA 4RDXA 1U4SA 3CU5A 3FZEA 3FDFA 3U3MA 2CXXA 2VJPA 3GRYA 1LC3A 2POCA 3VZCA 4IV8A 4I3GA 1EHCA 1X1TA 1JGTA 4PAQA 1X1CA 4ZREA 5E9JA 3WGIA 2ZAGA 4MMXB 4E4YA 1Z2AA 3KAQA 1PLLA 3TL3A 1HKUA 4Y7DA 4AZSA 3O8BA 1RHUA 4PNEA 4YXFA 3SNKA 1E6CA 5AKGA 1KOFA 1CIJA 1U8EA 5AI8A 3BOSA 4KR9A 2FZWA 2OORC 1WB4A 1EPUA 1USVA 1WUYA 2OGTA 4URZR 1PSZA 1E5VA 4KDFA 1QGUA 4FVTA 2ZKIA 3Q0EA 3VZDA 2ECKA 3HKEB 2Z30A 4FKZA 4JLWA 1LLQA 3T5MA 3ST7A 3FPAA 1JVBA 2KLBA 3R6WA 1FYEA 1G6HA 1VRCA 5IDVA 1BCSA 2LE0A 3I9JA 1CG6A 2FSVA 3KKPA 2MSKA 4YCBA 2HA6A 1JKJB 2VT2A 2XDAA 4Z8XA 3SYKA 4HNUA 1QO7A 2B0CA 2Y0DA 3ILHA 2OXRA 2XVYA 3VTAA 4EJFA 3U0VA 4OSOA 3R7DA 5AW5A 4NAVA 4R83A 1UWKA 1ZH0A 4NCIA 3UK6A 1C9DB 2EWVA 3VUEA 1R16A 4DVGA 3ZXSA 2FWPA 3ILSA 4WK4B 4JOSA 4X95A 3D4LA 3N2YA 5KBYA 1SNYA 4R84A 1V4NA 1MORA 5DMXA 5AKXA 4Q1BA 5IKMA 1F20A 4TTPA 3V7NA 4U02A 2JGLA 3AEUB 2G6BA 5A4IS 2CCJA 1I4WA 4JQOA 3LLUA 1GYQA 1D6MA 5HPYB 1HNZB 2HU5A 2VK4A 2X40A 5CLGA 1E2FA 1W85A 3OMLA 3GG9A 3WRXC 4EFKA 5B3JC 4J7CA 3G0OA 3LXMA 3AL2A 4NICA 1U7PA 3OWHA 1T5IA 4X8HA 1E8MA 2Y4NA 2VP6A 4FQ8A 1JWLA 2C5AA 1TPZA 2VBGA 1Q0UA 2GB4A 3GLVA 2AHRA 3QUSA 2QTBA 5C8YF 3EOAI 1XMOB 1DC3A 3DHNA 4FSHA 1UWLA 2W11A 4P7KA 3BEDA 3S6JA 4CF5A 1NNEA 2BR3A 2VTEA 2PPLA 1APBA 3WNQA 3DKVA 5DNWA 1AZWA 1YOVA 3CKYA 4FXOA 4KXWA 4BVHA 4MQEA 1J24A 1RWPA 3AF2A 4MR9B 1SVIA 2JHCA 1WKBA 1TYEB 3RYFB 3ZI7A 1CIPA 4EQ6A 3TYXA 2PJRA 3A36A 4HYEA 1RI2A 2A1UA 5T6MA 2ID8A 3KPYA 2C54A 4A6PA 5IYZA 4YXWD 2FN3A 2QAGA 3TW8A 1XHEA 4HGYA 4D4IA 4RVCA 4A0SA 3QYJA 4JITA 2BL4A 1GL7A 2JPDA 3MQFA 4KK4A 3OMXA 4ZAWA 5TEWA 1FE8A 1N7JA 2OR3A 1UOOA 3OLCX 1GEGA 2CVOA 2O07A 2Q3MA 4FYJA 3MRXA 1PLJA 4LRSB 4RORA 3AERA 4RK7A 1A2KC 3TOSA 1OAOC 1NUSA 4E33A 3C41J 1ECGA 4IH1A 1QRDA 3OEED 4JYMA 4L08A 3TTSA 3VSCA 4D41A 5F5LA 3T5PA 4F3NA 3JAKB 4IDQA 2E4XA 2DCMA 3LLMA 2P9ZA 4HB2A 4W4TA 4K9OA 4OQ4A 1OYYA 2PVPA 3UFXA 4XIYA 4H4DA 4OIMA 2AXEA 5LZ9A 5J3JA 3E3LA 1I2CA 2FVYA 3MT0A 3TTVA 3KL4A 1H69A 2GN0A 3OWOA 3PEEA 2PX2A 3HXMA 2H17A 3OE1A 3PNQA 5JJBA 1AE1A 2IHJA 3DEYX 1QIGA 3BHNA 3KLOA 5B36A 1T9GR 3EA0A 2IHTA 3WK7A 2V7UA 3EXEA 2R2AA 3IP9A 3CHYA 1IIRA 4WASA 5GIPE 2X0JA 2P41A 1T29A 3AR7A 1HQCA 3NKVA 3B3QA 3R7BA 1ZSNA 4KIUA 1KE2A 2F62A 2NQ2C 4KQ6A 1P8AA 5L3SA 1NMEA 1EFRD 2PMCA 3S27A 3BZUA 2Q7DA 4FZ5A 3W0LB 4F71A 4AZWA 2PRYA 3WGVA 1UBMS 2R1VA 1N6KA 5G1PA 1F6DA 5EGNA 4RHTA 1COWD 1C0PA 2WWWA 4PC6A 2P9GA 3TSYA 3WY9A 3E1SA 1P6UA 3X2EA 1W5FA 3BXEA 3IA7A 2JI6A 2PR2A 4IFBA 3V4RA 1U81A 3BTUA 2GVDC 1HY3A 5JCXA 4U0JA 5BW8A 4XPIB 1OKKD 3WYBA 4OQLA 2BM1A 4TL7A 3MAGA 2H5IA 3WGLA 3KKMA 1ZAKA 1RQ7A 1VXOA 1XRNA 1XZDA 3QOYA 4QBFA 5LUAA 4UDYX 2CVFA 4Q66C 1Z13A 4PINA 4TTJA 2AFIB 1PNRA 2PXCA 3TIVA 4F3RA 5CDSA 1US8A 4BIIA 2WTEA 5JSUA 5JS2A 1QFSA 2I55A 4YP1A 3GIWA 2OCYC 3QKUA 4E2YA 4YDHB 2H1WA 3LPCA 1IN6A 1ISJA 7MDHA 3CUKA 1WAMA 2WYHA 4M2LA 2NACA 2MSDB 2E48A 1FL9A 2QR2A 2JGKA 4PSDA 1XQWA 5AI4A 5F5NA 3SFVA 1PSDA 1MH9A 2YMLA 1V8PA 2WVAA 2X5XA 3OU2A 2EGGA 3U7IA 3GRZA 1HYGA 4GKKB 4FBMA 3LQ2A 3OF3A 2OO3A 3SYNA 4M22A 4MWDA 2Z5VA 4FYVA 2W6OA 2FMKA 2HCTA 3EZ7A 2G82A 2YX1A 3NVDA 3WHLA 4G0WA 2FG7C 1ADFA 2RDMA 4E5PA 1GNTA 2ZEJA 2X9GA 1F12A 1C7RA 5CG1A 1E7SA 1Q7TA 1E1YA 1XZQA 1NLMA 2QMHA 2VUHB 3HU2A 4MKIA 1P4HA 3VOSA 5EXPA 3W34A 1KYTA 2EFEB 3TZHA 2FRDC 1UC9A 1XCMA 3W79A 5BVGA 1EBUA 3JQQA 4C0JA 4DLAA 1UBJS 5EIAA 2XNJA 4PXYA 4L9SA 1W4RA 2I7CA 4IILA 4ZA2A 3VHXB 2PZLA 3K31A 4GL2A 5BV2P 4JDUA 4XA8A 1M6WA 4XR4A 1ISGA 1KERA 1ZK4A 3DOEA 5JYDA 3H17A 3CXUA 4P83A 4XR9A 4JBHA 5KC8A 2R66A 3K4PA 1VJTA 3M89A 3E15A 1V11A 1RM5A 1LX7A 5CT4A 3GVPA 5JAHA 1X70A 3K6SB 1SC4A 4OM7A 4II3A 4E7PA 1ZD9A 4CM5A 4DILA 4JELA 2E55A 1WS6A 2PAAA 1QHNA 2WOOA 1PW5A 4TN1A 2BM0A 1PEYA 4IRMA 3V9AA 1XOIA 4F45A 1D09A 3UWSA 2HO5A 2O4CA 1I3OA 4WFQA 2IYNA 1EESA 1IC6A 4PO1A 1OILA 1J2YA 3RSGA 3N76A 2P67A 5B4TA 4L02A 1BH6A 3H1GA 3ABRB 1R9MA 1AS2A 2GNOA 2EC5A 3KP1A 2GXUA 2IW1A 2OV2A 2Z3VA 2ZRLA 4FWBA 4JWTA 4KV9A 4IWXA 4NFLA 5EPEA 5TQ0B 3OQBA 4C0QC 4E5YA 4YT2A 2C04A 1ADBA 9GPBA 1U3WA 3EC2A 2XZLA 2D06A 5JQGB 2H8KA 2LVBA 3GUYA 3OQIA 4FFPA 1BFUA 4JUAA 1OPXA 5EP1A 4B3IA 2WMOB 2ZE5A 4DBLC 2VJMB 3DL2A 4OXXA 2BFWA 3L8DA 2NP7A 1I0IA 4KQGA 1Q83A 2QE6A 2NZJA 4TYMA 2AXQA 3L41A 3T35A 2Q7XA 2HWYA 3C1AA 1Y3CE 3FMOB 3WYCA 5BR4A 2QPOA 4BU1A 1XXLA 1X13A 3ETGA 4PHCA 1B93A 2D2XA 4YV2A 5HF6A 5BPFA 1UK9A 1KJWA 2G9UA 1NA5A 5IVDA 3ANTA 1RIIA 5ARDA 3R0IA 4PSKA 2J6CA 3CNEA 4JJ6A 5F7OA 1QQ6A 2JEOA 4E14A 1KI1A 1M8KA 2PMBA 3S1LA 2FR1A 2IF2A 4IS2A 4B3FX 3MCWA 3U0BA 3MD0A 1YB7A 3GFFA 3VJLA 4H7FA 1B43A 3G2PA 3L0IB 1QWOA 2WD9A 4Q4AA 4BNKA 1R00A 2B61A 1FLVA 2I4OA 5HKKD 4OL0A 1UIMA 2GJ8A 2GLUA 2WHQA 4FPXA 1C9JA 3IKLA 4NRDA 4NS1A 4INPA 3V7FA 3TZCA 4AZ0A 3GQBB 5I4KA 4PZZA 1TD9A 1AOXA 3NT2A 3BRWD 1YRWA 3VAZA 4ESVA 3O8QA 5E2IA 3R0XA 3B5JA 3K8QA 5K0SA 3FKSA 4C7OA 5AVOA 3VFDA 1ENOA 4B6JA 3SX2A 5B2FA 4MR7A 4DADA 4FYXA 2CNBA 1AVTA 1XQYA 2G63A 2JFNA 3BMOA 3REFA 4M1TA 3JZIA 2YNMA 2AVNA 2F67A 4KSYA 3RH0A 4KN9S 2XBMA 4RPGA 2JLBA 1RMYA 2ZI7A 4GPD1 3S2GA 1HTBA 5B1EA 3CVUA 3IXMA 5IKPA 3EZGA 1Q91A 3DE4X 1E59A 1M0TA 4F11A 2V59A 1UQTA 2X42A 3IAAA 5DTJA 2FZ5A 3TAUA 3QV1A 1ZXBA 3RVSA 4FOLA 1PZHA 2OVBA 5HJ5A 2FFHA 4IUBS 2W6JD 1AS0A 2FNAA 3KKQA 2YQ5A 3I28A 4NDAA 4O8CA 1JDBC 3FSGA 3COPA 3O8CA 3EQ9A 3VNBA 2LZ0A 1C0KA 1QLWA 1EQAA 2MHCA 4B7AA 2HWXA 4LGCA 3HVIA 5ALJA 2YWXA 1XMVA 4Z3KA 4N1AA 2RH5A 1SCJA 1M1YB 3IP8A 4GYYA 1LWOA 5DYGA 5J5VA 3WGOA 4ZT4A 4EVSA 3AY3A 1OX5A 4IKOA 4L2IB 4BYMA 5BQ3A 3VNUA 5FOVA 1QQBA 2G08A 1UAAA 4CKBB 4C2TA 2G40A 4MQ6A 3BE6A 1J22A 4AM8A 4BNXA 4AY5A 1GKKA 3JYNA 3LIIA 3WTCA 1NBOA 1NZFA 1TLTA 3E9NA 3SJUA 4BZWA 821PA 1XTRA 1PLKA 1FZTA 1KRWA 1VG0B 3M3PA 1ZVMA 3PWTA 1Z3CA 4GPBA 4LOIA 4JP2A 1E9AA 4B75A 3OZAA 1C30B 3EEBA 4I4TF 3TRHA 1Z3IX 4EABA 2PZKA 3D6VA 4TXMA 5LP6C 5B3LA 3ORQA 4LOKA 1J5EB 5BSWA 5CXXA 2L17A 2NGRA 4QQRA 3TR5A 3FVVA 4FQ5A 3WMEA 3GRAA 4X1KB 1I14A 1OHHA 2N75A 4A15A 5IAKA 2IU4A 1NP7A 5ALQA 1Z0IA 4MGYR 3OQJA 2APJA 2W6MA 3AKEA 2WSSD 4H0NA 4WPGA 4I50B 3VZPA 5F23A 2WM9B 2VIIA 3MRTA 4UBOA 5EFOA 1GT91 1OC2A 4ZVKA 1LZLA 2ZIZA 4NU8X 4B35A 4NAHA 3S5UA 2FDRA 2FPRA 2KBEA 4TUYB 4G6ZA 3C6MA 4QOIA 5JMWA 1HDEA 3RJ5A 1O7JA 1QOZA 3WE7A 4JWKA 1YCHA 4U2KA 2PJDA 4GMGA 5LYJF 2OYSA 1SKQA 3CX3A 4XQEA 4MJLA 2GF2A 4FEEA 3WLSA 2I3GA 5KSYA 3D9QX 3T7AA 3I42A 3FCUB 4FFLA 2GBCA 4QSHA 1ZK3A 3T1VA 3V1NA 2QRPA 1P2TA 3UK2A 4BVJA 4F5YA 2XGGA 3G2LA 4P33A 5DM70 1P9WA 2OHFA 5G3ZA 3DTVB 4L5CA 1GHTA 3HI4A 4MDHA 5AI9A 2OM6A 2A84A 4EG1A 1IBKB 1VG1A 2OAGA 2C5SA 3EDCA 4QLOA 5LN1A 4RLSA 4HDSA 2Z95A 1YK1A 2ODEA 5DP1A 4D5EA 5KYTA 5EUCA 3T9EA 4BWVA 1KY5A 4Q82A 4W9NC 2AC4A 1VC2A 1QKKA 3LT2A 4A10A 4WQMA 2Q5QA 1T91A 2V8OA 4ZMBA 1OF1A 1N3BA 1WW3A 4YIKA 1G9XA 1QM5A 2J30A 3ZHSA 4KQCA 1Y6QA 4O4LA 4YRFA 4QFDA 2GAIA 5CCEA 3FSEA 3VO8A 4GG1A 3FNQA 4IF4A 5EHGA 1RJ9A 3VGJA 4OJKA 4BKUA 4WBNB 4GLBA 5F21A 4MWCA 4YUAA 4X8MA 4PR0A 1T2AA 2E1PA 5BYBA 2HF9A 3KSAC 2BMVA 4TM7A 1SMKA 2X0RA 3QRWA 1QO0A 1LK0A 3M6AA 2GCOB 1E98A 1AQLA 4MVCA 2B4AA 4XB2A 1B8NA 4JXZA 2BGJA 2FQXA 4Q1CA 4BX0A 4N40A 1DARA 1NIPA 3P4UA 3TKLA 2G4CA 3EXHB 3QLVC 5KHOC 1MZVA 2ORYA 1QYRA 4R2WA 3BRQA 3FM9A 1G5HA 2XJ4A 1VPDA 3UOGA 1PYDA 2GAOA 4IVRA 4UMDA 5I9BA 1QQAA 2J9ZB 4M7PA 3FFXA 1E3JA 4KXMA 4R8VA 1P77A 1MJFA 1DBQA 2C2KA 2Z4TA 2QNIA 1VQ1A 1EX7A 1G5TA 1XJQA 3MB5A 3NTXA 3P0IA 5LQNA 4RTNA 5K8IA 4CG0A 1ZJ6A 4IO0A 3I9FA 3CUUA 4DUGA 1AV6A 5G0TA 1Z83A 2PPVA 4CUJA 3WS7A 4N7JA 9LDTA 3DYBA 2YWEA 3HRIA 3WXMA 1HWYA 1AS3A 3H5RA 3TBHA 4JUIA 3Q3VA 3JVEA 1JIKA 4PZEA 2EZUA 1U5CA 4RPCA 1XD2B 2LCFA 2WLSA 1XXHA 3QI7A 1ZMXA 4WECA 4ZYUA 4EY3A 4BO6A 2BEKA 2D5LA 1I9GA 2R65A 4YAWA 1GFIA 1ZXXA 4JFAA 2PU5A 3HDQA 4Q15A 4ODIA 4X93A 4BMCA 4WUTA 3H2BA 5T3UA 1G41A 1RIFA 1PR9A 3MGBA 2QZ4A 2Y3IA 3GZJA 4YCJA 5JRZA 1U7WA 3BICA 4RK0A 1XF9A 4TLCA 2Q2NA 1UPAA 3LMKA 5EEGA 2PGIA 2XVMA 2VOEA 2W2LD 5IPFA 3KVVA 5FFMA 4N0QA 4IIBA 1YSCA 5E1OA 1RKBA 1OI2A 1QOPB 2GX6A 4JVNA 3S7TA 2GERA 1FMLA 3LGAA 1KEEA 1GCIA 2HC9A 1GG9A 1A9SA 3H9QA 1V7QA 3SD7A 4YJ3A 1KYVA 4P0PB 1N7HA 4MZXA 3ZKAA 4E13A 4EB8A 3URKA 4MKHA 1U2QA 1C9YA 2WHEA 1THZA 1VIYA 3DW1X 3FLMA 5IHXA 4Q19A 4ER3A 2GHRA 3HFRA 1WWKA 4UZEA 4F5ZA 3A6JA 5F3DA 3WLLA 3QY9A 1FOEB 1ZU4A 4WXHA 3PD1A 3BC1A 2GBFA 4I36A 1DQRA 2ENUA 4DZTA 4UTVA 4KVAA 2VZ8A 5BMVB 3IHTA 1WNTA 1L7BA 3VR4A 2ZJBA 3LP8A 2DF8A 2QYOA 1E3DA 3DE0X 4FGJA 4PAWA 2D7CA 4JI6B 4D0NA 3CE6A 3GNSA 3JS5A 4LS3A 1WQ1R 1C1HA 1ZPDA 2C29D 4H7JA 1KA9H 3WHKA 3FKJA 2EKBA 1LB1B 1IN5A 1X15A 3HABA 1DPGA 3NKFA 3OZVA 3PGXA 2QHXA 2G6TA 3O1HB 4B7CA 3LRTA 4DMKA 2CMDA 1ODIA 1DPFA 1SZDA 2GO1A 2P27A 4PLYA 1MC4A 1L5WA 4GI1A 2C84A 2PUAA 2ZRGA 2O3TA 5AHXA 1S02A 1NLUA 1J2TA 3D4PA 3IOMA 3KVNA 4Z0HO 2WJGA 2HJHA 5F76A 1HOTA 2YIMA 1U2ZA 1A88A 1L7AA 3ESQA 4HGPA 4KJXA 3QLUC 4LE2A 2C9BA 1BMTA 2QPLA 4ASUA 2CLDX 2IUFA 1HRKA 5EEHA 1Z2DA 1CFZA 2HA5A 1J8VA 1GG2A 2J5XA 2WKPA 1B00A 3EVEA 3MYYA 5EJGA 5EZYA 2VNIA 4GLLA 2PUEA 4WNCA 2BY4A 5M5BA 1QP7A 2GGSA 4EJSA 1WO8A 2N42A 3O7WA 3RO7A 3B6ZA 2JJYA 3GJYA 4IIJA 1G8YA 3TAXA 2OCAA 2Z8XA 4U1RA 1CHNA 1PJ3A 4YRPA 3A6GA 5EQTA 3E9QA 3NOVA 2CNDA 1WM1A 4DCOA 2PT7A 4EA9A 4YRNA 4ZK6A 1NBHA 1TXGA 1TKAA 5FO1A 1JHPA 1KAEA 3KVYA 3OTQA 3RAFC 3EPKA 2DETA 2KMLA 1HT1E 4TS9A 2W6PA 2WV7A 5DI3A 3MM4A 3FA2A 4FB5A 1W29A 2JFOA 3QWHA 4KXUA 1SVMA 2QR5A 1A77A 1L1QA 2Q1TA 2QE7A 3KQTA 2QAIA 5KYVA 1DDIA 2BGRA 2Q49A 2Y9PB 2HU7A 1C7JA 4NZZA 4U7DA 3IO3A 1ZR4A 1YR8A 5KWJA 3MCVA 3VX3A 2JA2A 2VHYA 5BSUA 2CNKA 4LVUA 1L0BA 4BO9A 1PV4A 2EJWA 2XUQA 1KOGA 1L8OA 4PF1A 1ZKDA 1R4NB 2WU8A 1WEKA 1QH9A 2RHHA 2O0MA 3H8JA 4KE6A 4OHMA 5F1YA 1OI4A 2IC5A 2RGXA 5EIBD 5FQOA 3CH6A 3CJQA 1E7YA 4CKWB 1N3LA 2V7WA 3GVHA 4YUYA 2IS2A 1M1NB 2Q6OA 1Z4JA 2RI6A 3L0YA 3IQGX 1ULUA 1UXGA 1YRLA 3JQAB 2GHTA 5CVUA 1L4UA 5HS6A 4DNQA 5E8JA 3LUPA 2ZSHA 1D9XA 1SXIA 4MEBA 4ZVPA 4EGCB 1KKLA 3L6BA 4TZTA 5DEIA 3ICVA 5BYAA 4EKYA 1U4OA 1A8QA 1WF6A 3IILA 2GFQA 3HKCA 5KAPA 3BWMA 1XTUA 3CX6A 4LJ7A 1XEFA 4HRAA 4WKOA 4XWTA 3S68A 1CNEA 4LBWA 4HAZA 1U9YA