3PFIA

2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
301
Chain Sequence
LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvB
publication title 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
total genus 86
structure length 301
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05491 RuvB_C RuvB C-terminal winged helix domain
A PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain
A PF17864 AAA_lid_4 RuvB AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3pfiA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3pfiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pfiA01
1XJQA 1NVWQ 1SXJC 2P67A 4C0BA 4NYIR 1FSHA 1R36A 3EETA 1E2KA 2GXUA 4R2IA 3V00A 5JRZA 4I7HA 4AD8A 3NG1A 2IS1A 4DJTA 5AK0A 1ZRFA 2O6GE 1W0KD 3NC1C 1TEVA 1OLOA 1J9IA 1EG7A 2DLLA 3E97A 3H1TA 1I2MA 2CK3A 1TLHB 2A3SA 3OEEA 1U5TA 3HSRA 2PLRA 2RHMA 2V8OA 5LPNA 2JLWA 3EQLF 2GBLC 4TLDA 1UHMA 1CGPA 3KKOA 3TVTA 3OHMA 4KUMA 1FT9A 2WWHA 1MABA 5CDFE 3ADDA 2GCNA 1G20E 3CWQA 4MKGA 3DPTA 2VOPA 2C6YA 5LGUA 1DAKA 2ASEA 2XNDA 2PZFA 2H16A 4HAWA 4DUGD 2AKYA 3CIOA 2GJ9A 2A69F 3RTRA 1Q3TA 2XNSA 3LVQE 3RDPA 4RD0A 2A07F 3I61A 1BIBA 1G3TA 1STZA 4GXOA 4EGYA 1ZIOA 4Q9KA 1RI7A 3WBKA 3VX4A 3GQBA 2ORVA 2MSCB 2FMYA 1OE0A 3T8TA 1G3MA 2REBA 3VX3A 1H0MA 1X8LA 4XSHA 4JLOA 5F9HA 2FNAA 1NHAA 1II8B 3KUCA 5CLLA 5KU1A 4BPBA 1U78A 1XBTA 3L82B 1XNJA 1GDDA 4RB3C 3BIFA 3X1YA 2JLQA 2ZXJA 3SFVA 2QORA 2IX3A 1OIVA 1C0WA 3M1IA 3LX8A 3C15C 3REGA 1BM9A 2X1VA 3RHFA 1PUIA 2G0NA 1HE8B 4QL3A 1G3SA 2D1VA 4GCVA 2OM2A 5SZJA 2CK3D 5EP2A 1JHHA 4RB0A 1Z63A 1XB2A 4AYXA 3RYRA 5EP3A 2IF0A 1DPFA 3K0EA 1WBBA 2QA5A 2CYYA 2MD5A 1OFUX 4L15A 3AF3A 5FL3A 1QQIA 4BFTA 4D4MA 2DFLA 2OBLA 3K9HA 4UNQA 3U4QA 4M72A 2UWMA 5FUYA 1JHFA 3T1VA 1OXTA 3OFND 1XSXA 3CO5A 4F4CA 1ZU4A 1CR4A 2BBSA 1XZPA 3EYYA 4ACBA 4OIRF 2RB4A 1JQJC 2HJGA 2XAQA 3F21A 1R8SA 2EFOA 1CTQA 4PAMA 4KSCA 2ZSAA 1IQPA 4URZR 5D5UB 4G94A 2YOGA 4G5QA 4ZDJA 1NSFA 1MGTA 1Z2CA 4WXCA 3DL0A 4AURA 3KP3A 3PQCA 3QJYA 4HLXA 2CO5A 2HLDA 3SN6A 1FTSA 2AFHE 3TO7A 1ZH5A 3RS7A 2FMXA 1ZMXA 2LF8A 4WA7A 3LY5A 3UK6A 1O87A 1CBUA 2IEYA 2NOAA 2PJZA 3KTAA 4EJSB 4ZIRB 2J41A 4GFDA 2K02A 3OIYA 4TSFD 4WCGA 2EFGA 2ZRCA 1CS4C 1U0LA 2JSCA 1VG9B 2EWVA 3F23A 3KP7A 4M74A 2K5UA 2Z43A 3CX6A 3NH9A 4BEBA 5DH9A 4TMTA 1ZGAA 4N0EA 4B76A 3I62A 2F43A 3OEHA 1X1RA 1QO0D 5EXTA 2O8EA 1OMIA 5CVUA 3CNLA 1S7AA 2M87A 2CXXA 1ZAKA 4ON9A 4JLDA 2RDPA 4FWTA 1P5ZB 1YW7A 3T35A 3CO7C 4LHXA 1QVAA 2Z0MA 1YTYA 3I92A 5FOVA 2ZUDA 4QGAA 5FD5A 5E1ZB 2YC4C 4EQ6A 4QM7A 1EFRD 1HA3A 1TQPA 3HRMA 2VBZA 5ERIA 3FM3A 4HDUA 1E2HA 1Z8FA 3KFWX 4JT2A 4MGIR 121PA 1GRQA 1RW4A 1IY0A 4IVRA 5LBIA 4BWYA 4E07A 2QE7D 5KSYA 1OH7A 1Z22A 2XHKA 1JGSA 2P5TB 1HEIA 2VSOA 3QG1A 3QPUA 3I0TA 4EPXA 1RUOA 4MQVA 3QSYA 3EASA 3WTWC 4UV8A 1HT2E 3REFA 5KNBA 5JI2E 1ZGJA 2J5PA 4N9IA 4C0LA 1MDMA 1D6JA 2WBLC 1W2HA 1W4AA 4M22A 2D3WA 3KKQA 1E79A 1WSUA 1YG2A 1M7GA 2ZITA 3FXUA 1IAQA 2JJ1A 3R9IA 3CUEF 2NO6A 4KICA 4KN7X 4P4TA 4EPYA 4HF1A 1GIAA 2BMEA 1TQ4A 4A36A 4KITB 2WVJA 3NKVA 4P0TA 3DQVC 3HHGA 5FH9A 1U99A 1IHUA 1XCMA 2ZI9A 4OK6A 2GDJA 2O8FB 2DWPA 2DZNB 2EFDB 4IVQA 1P75A 1WB9A 1G7TA 3L9FA 1MT0A 1KI8A 2PT7A 3OAAD 4BGDA 4UNSA 1QPMA 1GRRA 1Q1BA 4KV9A 2XAJA 4DDTA 1OH5A 2FEOA 4DDVA 2OG2A 5FTKA 2FEMA 1F48A 2DCUA 2IT1A 5IK2A 1LDKB 1RNLA 4RKFA 5DIFA 4OHYA 2A30A 3FHZA 2O61A 3FMQA 5K8TA 2B6HA 4UQOA 2RCNA 1W7PA 1R1TA 1TTTA 1E9DA 2WJIA 4P4SA 2EFEB 3LXRA 4OI1A 1MJ9A 2MH9A 3PUWA 3AKYA 5K8LA 2YSRA 4HAZA 1G7CA 1IZ1A 3UANA 1Q1ZA 4QGFA 1B59A 4KYUA 1VHLA 1LEBA 2B92A 3ZJYA 2MSEB 3G73A 3QXJA 4X8MA 3V7SA 2A61A 3TSWA 2PG4A 5JI3E 3AB3A 4HQEA 5D6EA 4JLMA 3DZDA 3U3MA 4YG2F 1S9HA 4ESBA 2BEKA 4OHXA 4PXAA 5GADl 4XBFA 1GZSA 2QEQA 2XGJA 2W57A 1XJ0A 2C2HA 1ONVA 3GLGB 3BS4A 3B9PA 1W0KA 2BC9A 3SC3A 4EPRA 4LFUA 4DDUA 4DLRA 1PP7U 4U88A 4FD2A 3IL2A 4PSVA 3C8UA 2KKOA 1OHHA 3F8TA 4FMDF 2BMJA 3JVVA 2BE5F 2J7PA 3P1JA 4KJZA 2P0EA 2NRAC 5EJEA 1G7SA 3LD9A 2LCFA 4GI7A 1WI9A 1P6RA 3ZS8A 4M1KA 2UZ3A 2DFKB 2YKGA 2P6NA 2IYLD 4LB6B 3KJHA 4ZZDA 4BYYA 4EPVA 4IEEA 5FR2A 5DCMB 3DVLA 1X86B 4LC0A 5EXSA 1U8RA 3GLFA 1NMZA 1SVWA 3VODA 3TQFA 1M7BA 4B3GA 5FTNA 1OHHD 2FBHA 3R8FA 1RJ9A 1KK3A 1FZQA 2XAUA 3NTUA 3A4MA 1AQUA 1JQLB 4ILEA 2XJ4A 1G3QA 1NN1A 2D2FA 2QRZA 1X6VA 5DD8A 4GZLA 5EUQB 4HB2A 5P21A 4A6DA 3P27A 2HCBA 3CRRA 3JTHA 4B71A 5FBRB 3RS0A 4ZI3A 3NEUA 2Z5UA 4Q4JB 4BXUA 1B9NA 5EUMA 1YR8A 2GAAA 2WV9A 4GMDA 2I1QA 1UFMA 1OW3B 4HLDA 4IXNA 5G40A 5DCFA 4JLVA 2XKOA 4BRWA 5IT5A 4PTLA 2G1KA 5CVRA 4TQ9A 4V03A 5B64A 5J47A 3TW8B 4CZ2A 3UMFA 2O8FA 3GJ0A 3J80Z 1KYIA 3RVBA 3CJNA 2X4HA 4A0GA 2OBPA 4IDQA 1XXHA 3VKWA 2AXPA 1YJ5A 3F3XA 2GTPA 4GP7A 4KT5C 5TDHA 2VODA 1Z0DA 2QN6A 3LFKA 4PC1A 5LDDC 3JAMZ 4D25A 1LDJA 2GZWA 2J46A 1J5YA 2WSMA 1U9IA 1VDZA 2CEAA 2AHOA 3QBVA 3RS2A 2RGEA 5ELXA 2A6HF 1GFIA 2WHXA 3W34A 2FBIA 1D8TA 4D2IA 2PH1A 4PO9A 1K78A 3MFYA 4R9UC 3GXOA 5HKKA 4D0LB 4DBLC 1WQ1R 1ONBA 4DLSA 4MKIA 2JJ8A 1ZNXA 2F5CA 4MEYF 4E22A 1IUYA 4DSUA 3KQHA 4I01A 1E9BA 2CHGA 1W7AA 1X37A 1WRJA 4A0ZA 2IHBA 4LDJA 4LUCA 2B8TA 5H6QA 1E9SA 2X8AA 2XAFA 1W48A 2DI3A 5TV2A 3T61A 3GJ5A 1C1YA 3R7WA 1L7VC 2HYIC 3PQJA 3MCAA 5EZ6B 4ASUD 2P4WA 3D5LA 3LAWA 3ONWA 3QNUA 3D31A 3E5XA 4N0BA 3WNDA 3V7CA 4G7HF 4AKHA 3I64A 3JSOA 3QEOA 4B48A 5JS8A 1Z6XA 1LW7A 4O2RA 3IHWA 3OOPA 2H94A 2OAZA 3GFMA 4TYYA 4LHVA 5CB8A 4Q9JA 4DDWA 4Q7JB 1T6NA 3DFGA 1QHHA 4ITRC 1G6OA 4P96A 5UKDA 4OQXA 2IBMA 1JR3E 2V6ZM 1N5LA 3TRFA 5JR3A 4Q9HA 3SS8A 2P6TA 2XB4A 1EK0A 1VYUA 5JHGB 2RMKA 2QP4A 2DWQA 1OF1A 2VE9A 5EE9A 3U61B 3OE7D 1DO0A 1W7PD 1NLFA 3U7HB 2EB7A 1KGDA 1EV7A 1G4AE 4OMYA 3WYGA 1N5JA 2FSHA 1FUUA 3B8HA 1GOTA 4B2IA 2JASA 2CQKA 2HUPA 3B73A 1YR7A 4BLQA 5ICGA 3QOFA 4MEXF 4Q4HA 5CJPA 5FOWA 1ON1A 2B8WA 3I4PA 5EEGA 4Q1EA 1P9NA 2OAP1 3X1XA 4JLAA 1P4WA 1H8ED 2PEZA 4HLCA 3GYHX 1G4DA 1F6BA 4J0QA 1BH2A 3KX2A 4PSKA 4L9SA 1TU3A 1Z2AA 2ZEJA 4ASUA 1RC8A 3KLOA 1LQ1A 1ZNYA 3J81k 3AVTA 2IW5A 3ZVNA 4H1VA 5F1RA 4L5JA 3QQ5A 1XSVA 2A78A 2VE8A 4AYWA 4UVAA 5FTLA 3FFAA 5AJXA 3ADBA 2FDCA 1EX6A 3S2WA 4XD7D 2WWGA 4Q4JA 1U5TC 5ICCA 4LBYA 1OJLA 1Q22A 4NMMA 1D2MA 2FSGA 5F98A 1DDNA 2JJ1D 3OIUA 5IDVA 1LDDA 2VHCA 3J7AO 3BAFA 2F1HA 3W6KB 4CT4B 4EPWA 1Z91A 2HF8A 1EX7A 1J99A 2CL0X 3N5CA 2O8BB 2TMKA 1KK0A 2A9KA 1W1WA 1WF3A 3T1QA 3ZZTA 4AI6A 4HAMA 4IVNA 3L09A 4BZQA 2D2EA 2K86A 5L3BA 1A5TA 2VYFA 1G5RA 4G5RA 3THOA 2MMGA 5DO9A 1QZMA 1S3JA 1F2UB 2NNYA 4US0R 3GJXC 4IDPA 2QQEA 4HZUB 2HKOA 2WOJA 4D26A 4AVPA 1SVOA 2KI5A 1FOKA 4TYWA 2ZR0A 2OXCA 4OJQA 3GLIE 5JJKA 1KI6A 2IYZA 2R3SA 4ZYEA 2ZRFA 4K8OA 2Z83A 5D5WB 1KDOA 2BM0A 4HYYA 4C0JA 4YDSA 2ZRGA 1W7PB 3QPTA 1R4AA 3J81K 4TZ6A 3VU9A 3GX4X 4TLCA 3MHVC 4B2LA 4EAQA 1UKEA 3SYLA 3CF0A 1GNQA 3DP7A 2F6RA 5H8WA 4U0WA 4KA4A 2O8CB 2OXRA 3EC2A 2R7FA 4CIDA 1VKJA 2IA2A 1OKRA 2EQBA 1RZ3A 5E1XA 3WU1B 4I98B 1FX0B 2ZSBA 2UZKA 4PC6A 5FBVB 2JCSA 1E94E 1M6NA 3MWLA 1E2PA 5HLGA 1YW9A 2ESNA 5HE9A 4LK0F 1W5SA 3KQNA 3I58A 3MWJA 4IHTA 2RKOA 3THXA 2WOOA 4Z1MD 4I2OA 1HURA 3PIRA 1MH1A 1W4MA 2ZYTX 4RCYA 2STTA 2ODEA 2ZRBA 4LV5B 1XGOA 4UXNA 1ZREA 4PFSA 5L3SA 1NVUQ 1UKZA 2ONJA 2FNPA 3FHTA 1LF5A 2DO7A 3I59B 4I1SA 2ISYA 1I1GA 3FOZA 2AD5A 2WWIA 1TU4A 4R7ZA 1UBCA 4L9VA 1ZUNB 1ZARA 3IQWA 3MGCA 4W9MC 2JAQA 1G6NA 2HCJB 2W6ID 4QBIA 4TMWA 5HKKD 3GMTA 5IRCD 3SEAA 3WYFA 4CEJB 1P4SA 4YMSA 3KKNA 1AIPA 4XSGA 4LJ5A 3DZ8A 2Z33A 2QZ8A 1ULYA 1B1BA 5LEKA 1VPLA 4O6JA 2ZVQX 4LV8B 5KVRA 1W4BA 1FP2A 3JTGA 3KLNA 4PCQA 3EARA 3K0LA 1BI1A 2VXZA 1QHIA 3GFIA 4YFXF 3FF5A 2EYQA 3HPQA 3A8TA 4HQMA 3RWMB 1YZQA 3BJ6A 2F9LA 1Z07A 3FE2A 4UHTA 2H92A 4ARZA 1I6XA 2P5LC 1O7LA 5FFMA 3KDSE 1Z0JA 1CRQA 2YR2A 3MG9A 5J6XA 3R20A 5TY0A 1ZG5A 1B0UA 4MQBA 4M9SA 4URYR 5KYKA 3TH5A 3LA2A 3SI7A 2AXNA 4RFVA 1G41A 4RKEA 4V0KA 4PHHA 1GL9B 4ESJA 2EWWA 2QT1A 1IXZA 2D1HA 5DE3A 2XXAB 3HR7A 3WRYC 1EH8A 3B1YA 1DO2A 2KIUA 2XGXA 3Q5FA 3C1DA 1GTVA 2RGNA 4G3XA 4TMVA 2FOKA 2IUSA 3B9QA 2FWRA 5EZ5A 1GNPA 3EPHA 4ENKA 2ZJ5A 2QQ9A 2W6IA 1GILA 2DQLA 3QKUA 4PDKA 3K1PA 4I1OA 3OF5A 1T8TA 1OFHA 2VHQA 3JZMA 4Q1AA 5JMTA 3BH0A 3RDIA 4HAUA 5DDGA 1ZRHA 2VF8A 1RPZA 3KQUA 3DXJF 2CCJA 3SDZA 1FMLA 2GXGA 5CYOA 1U2WA 2CGPA 2HYFA 4UUVA 1T91A 2PX0A 4HI0E 3HUGA 1EXMA 1HV8A 2PCJA 4B6EA 3PEWA 2IS4A 1SVKA 1R10A 1AKEA 4OI2A 4BECA 2KE5A 1ZC3A 3F6OA 3NDPA 5JEEA 4RGUA 1UEIA 4D81A 2VP9A 4ESVA 4Q48A 3UMSA 4GDFA 3QXHA 1OKKD 2QUZA 5GJCA 5KSZA 2V9PA 1OSNA 3QU3A 4MGRA 3W6JB 3JZAA 5IT9K 5CK4A 2J59A 2WWXA 4ZKEA 2Q0HA 1II9A 2VBCA 2ZUCA 2O0HA 4YFNF 1XEFA 4BHCA 2D7CA 3WHLA 5K5OA 4KN4X 4R8HA 3B82A 3FMOB 2P6SA 3K9GA 2DW4A 3IEUA 1ESNA 3M4YA 1RUNA 3ZD6A 2V55B 4NE2A 1O3TA 2ACJA 1XMJA 3AVOA 2WICA 3GFJA 4FW9A 1MJAA 4JK1X 3HDTA 5DGXA 1J7KA 1KIMA 2WWYA 2XTZA 3RJPA 2ZE8A 3K9LA 4BLOA 3FMIA 2ZM5A 5LEJA 5TJJA 3EYIA 1UADA 4HX7A 4LLLA 1VHTA 2L3DA 1PDNC 1LJ9A 2HDCA 3KW6A 1WDTA 2C95A 4W5WA 1TMKA 2BDTA 1OR7A 1GITA 1LNWA 3RC8A 1KO4A 1P2SA 1U98A 3H2YA 4FWHA 1ZYRF 2JT1A 4NB5A 1HUQA 1PP8F 3Q85A 3TUJC 3BC1A 2DB3A 3CRW1 1GUAA 2GCOA 4ZCMA 1UFQA 4MUAA 3IRQA 5HVQC 3W6PA 2O8DB 1AZSC 4ASNA 1FX7A 3N2EA 3IIKA 4URVR 4HATA 2O0JA 1TW3A 1Y63A 2IW3A 5J40A 2HDNB 3OV8A 3TKLA 3EZ2A 4MDEA 4DCUA 3VKHA 5K5RA 4B73A 2VC1A 1W49A 4OHZA 2FE3A 1DG1G 1E79D 4JS0A 1IN6A 3G3ZA 3F6VA 1N6LA 4D0GA 3EPJA 1S1MA 1CF7B 4IKEA 3ICQB 5JI6A 2QPTA 5GVSA 4EJOA 4G5GA 4OI0A 2BYVE 1WQ2A 2E7XA 3ZVMA 3KEOA 1RRCA 3F22A 3LW7A 3CM0A 1FW6A 1KSHA 1ZUIA 2KJQA 3U5ZB 4NYJQ 4AYTA 4C0AC 1Z0KA 4Z1MA 3BDDA 4LG0B 3VHXA 2K7LA 5KNDA 3QUSA 1XGMA 1JJVA 3HYRA 2QE7A 4OQMA 2FSIA 3IUYA 4V0LA 721PA 2XZLA 2M1BA 1WKMA 3VLFB 2G7UA 4ZZLA 1HYQA 2OLKA 2R7DA 4LHZA 1PVOA 3EA0A 5J4KA 3E3VA 4OIPF 1XEWX 2IYRA 3WG9A 2QMEA 4LYHA 4M8NE 5TMPA 2GXQA 2WAYA 1XD9A 3IIMA 2QBYA 2ADUA 2CJWA 5JVTA 3CUQA 4MYCA 1DAIA 2GWRA 4TL7A 5FOXA 1PV4A 1VCIA 3DEFA 4Q1FA 4LJAA 4TLAA 2KBEA 3HPRA 4PR0A 1ANKA 1BIFA 2JDIA 4DKXA 5KNCA 4I09A 3BRWD 5D6FA 1OIWA 5FL7A 4YFKF 3E5QA 2QM8A 5DCMA 1FNMA 2CVHA 2H18A 1E98A 1P9RA 2ZKZA 1U8ZA 1D2NA 3GLHE 5L3RA 4JVMA 3CF2A 4L16A 2IL1A 4PQRA 1CU1A 1U94A 2PCLA 1BN5A 1J75A 4RFSA 1E0KA 4IDHA 2YWHA 5IT3A 2GJKA 3JVUA 3QKRB 3SR0A 5BXQC 4HUTA 4PPGA 2ZFWA 2E1CA 2V6JA 2XOKD 3AF2A 4DEYA 2JLYA 1I5ZA 4MNUA 1KQ9A 1SVIA 3T1TA 2FPKA 3WTTC 2W0SA 1FMJA 1XN7A 4JKYA 4A4DA 2WMOB 4JLPA 1Z6RA 3ERED 2ZI7A 1E9CA 4U00A 4PO1A 4WXPA 2PMDA 3GEHA 4BEJA 1T38A 4PPFA 4YDHB 3V8KA 1FQKA 2GETA 1FFHA 3Q3JB 1SAXA 1U90A 2NPIA 3EWSA 5DV5A 4N1AA 3S1AB 1KMHA 1BMFA 2IRFG 3GFLA 4DT1A 3K1NA 1QG4A 2X2EA 3TMKA 1NMYA 2FX3A 1GL6A 4Q4ZF 2CSOA 2AXLA 2NQ2C 4LLNA 3KUDA 5LHHA 1JAIA 2ZR7A 1ZLJA 2A6EF 2VSFA 4KIGA 3ZMZA 1ZAOA 3ZPLA 3GJ7A 2R65A 3M8EA 5E8IA 3HR8A 2ZU6A 3IWZA 1M1YE 2B0LA 5B57C 1KOFA 4AWXB 3CPJB 2KJCA 4PC2A 4XVRA 5HLIA 5JSZB 1AGPA 4Q19A 4G9YA 1FX0A 1G18A 4B2PA 3FYHA 5JFRA 3QP6A 1OH8A 1E1QA 1T3HA 3QG5A 2IA0A 3RIRA 4Q1DA 1H9GA 1XXHE 1OXUA 2BOVA 5CVVA 3O2PE 1GVNB 3AVQA 1AJEA 2NYXA 4V0NA 5FLXZ 2G77B 3B60A 3VKGA 4ZH4F 1E9FA 2I3BA 3THXB 4O5VA 2IPQX 1XCVA 1NKSA 5HPYB 1ZM9A 4DCSA 4BFSA 3LX5A 4JYBA 2ERXA 1MO6A 1Q1HA 1E69A 4LV6A 5JBQA 1IXCA 3LBHA 4EJTA 3W8NA 1K79A 821PA 2PBIA 4HA8A 2EA2A 1KKLA 2ZMEA 3GEEA 5D5VB 1P9WA 3NDBB 2QGZA 4EUNA 1LS6A 2X77A 2BHRA 1N0WA 4QFMA 4S2EA 1LVAA 1MD0A 1QG2A 1XRJA 1KI4A 1R23A 1FPMA 4QHSA 4WOPA 2JLXA 3V4GA 1SXJE 4O0MA 2NZ8A 2QPOA 3MWYW 3ASZA 4NCJA 2BCJQ 2EFWA 4MA4A 3MRSA 3SFZA 1QNTA 2MMCA 3NWJA 1IAWA 3U7FB 2FU5C 4Q5IA 5EEHA 1CJTC 1WBDA 2VN2A 2E7WA 5BPIA 3M9AA 3U2RA 3QOPA 3E1SA 4KVGA 2V9VA 4DNCA 4WXDA 5DYMA 4JVSB 5H1YA 1COWA 1TNDA 1ZD1A 4BFZA 4I0AA 4XLNF 4I02A 2PBRA 1SMTA 1Q3HA 4GOXA 4DCNA 2FV8A 3C16C 2XIGA 4F38A 3AKDA 4PAOA 1FQJA 3WE3A 4EJVA 1NMXA 1O57A 1JR3A 3HU3A 2QG6A 1AK2A 2SHKA 4S05A 1SD7A 1WWXA 2X0LA 2OV2A 3CX7A 3QVVA 3W6NA 4B34A 4ZI2A 1E3MA 1QHNA 3CONA 2M30A 3DO6A 4KBFA 2JGNA 3BBPA 5EXPA 2DFNA 4DC9A 4M2LA 4M1SA 3W90A 1P4XA 1N6KA 2NTYC 4PX9A 4GYGA 2NO9A 3CNNA 2IYSA 4N3NA 4OQLA 2ZVPX 2W6JA 3K8YA 3H84A 1UBEA 1JR3D 3QKTA 2IUUA 3HSEA 2KB0A 3ZDQA 1YU9A 4POAA 5FGMA 4YLGA 4XWKA 1EH7A 4B8XA 3L0OA 1W0JD 4Q9LA 1NSTA 1FYLA 1BMFD 2GESA 1UEJA 5KK1A 3WTVC 2VHJA 3OAAA 3CX8A 3ZZ0A 1MO3A 5CITA 3DMDA 1KI2A 3WE2A 3ASYA 4II7A 4QJ5A 1LY1A 1G19A 4B44A 4LJ4A 3CR8A 4M21A 4HOBA 4GZMA 2QQ0A 1G16A 2H27A 3LWFA 4FHTA 5IK2D 2BBWA 4MGZR 3DF8A 4FWGA 1B4AA 1XGSA 2DK5A 2GEVA 3DKPA 3NBZC 1R7RA 3F8FA 3W3AA 4DZZA 3NEJA 1FPQA 1CLUA 3FMPB 4BLTA 4DIEA 3THYA 2O8XA 4KSBA 5HZHA 3D6TB 1SD6A 5FOUA 1BKDR 1Q12A 3NBXX 1KU3A 2QM3A 2DY1A 4M0LA 1CEEA 2QRNA 4NYJR 5SZKB 1NJGA 4KDPA 2ZI6A 5E20A 2E87A 3IPXA 4TT3D 3GO5A 5BOXA 5JWOA 2FF7A 2C9OA 3WY9A 3BD9A 4BFXA 4IVPA 1W2GA 4HB4A 5HS9A 1C1KA 1FBSA 4XVQA 4Y17A 1LS1A 5L8VA 3MJRA 2ZMEB 1OIXA 1K5GA 2WTUA 2OUKA 1PLJA 4G7ZF 4IXMA 4LRTA 2EFCB 3PENA 4CF7A 3MUFA 4FMCF 1S3SA 4U0VA 4LWZA 3TAHA 1EFUA 1JEEA 3MJHA 1L4YA 4IHSA 3NBYC 4RCZA 3WXMA 4LY6A 4DCVA 5KTYA 1E1RA 1Q1EA 2GILA 5L3QB 2NMVA 2H6CA 3ZMTA 1SVSA 1D3YA 1K78B 4G8XA 3H0KA 1KDRA 1ZLKA 2ZE7A 2ZJZA 1XD2B 3RSLA 1U2RA 1AGRA 3AUXA 1S6LA 1SHKA 5ILUA 1YS7A 3ULQB 3Q9SA 5L3GA 1WA5A 2ZRPA 4Q66C 2FA9A 2Q9AA 4X8LA 1KI7A 3EPLA 1J70A 2GBLA 3BB1A 2IS2A 4HDOB 4C0KA 3B02A 3C4JA 2IWHA 4I0BA 3FWEA 3I72A 1FP7A 3ZH9B 1HW1A 3D3QA 2F7SA 3PEUA 1G8FA 2H1LA 3DPUA 1F4KA 1UDWA 2NO0A 2O03A 2UVQA 3GJ4A 2QYOA 3H92A 2VH5R 2GCOB 1LTQA 4FINA 5FFZA 1Q1QA 3BJIC 2VONA 1Z3IX 3GVAA 3R4KA 1XDUA 2RKHA 1HY3A 2C9YA 2FZLA 2YYZA 2FEZA 3TSOA 3QKRA 5M04A 3U44B 1VG1A 2X2FA 3BB3A 3ZGXA 1XDBA 2BEJA 2R6FA 3K0CC 2VBXA 4A5NA 1FLIA 2PMKA 2A5DA 2OO7A 3QEJA 5GJWC 2L02A 1GSIA 2CLSA 3DKVA 4RZXA 4XTRA 4YXWD 5KDOA 2IYYA 4HF2A 2W58A 5JJIA 3O8BA 5BQ5A 1JALA 5AR1A 2QNRA 2HQNA 2IVMA 4M1OA 4HB3A 4P55A 4O3MA 4DB2A 4EQQA 4Y15A 5KDDA 2V7QD 4BFUA 2W6JD 1XMIA 2DWOA 4A6PA 3VHLB 5SZIA 1RFLA 1T6SA 2ZPTX 2QROA 3QVUA 4WZ6A 4DLXA 2JZYA 4MRVA 4JLJA 1SFXA 4L5BA 1LNZA 2WTEA 3MWMA 3IRRA 1PUJA 1F2TA 4FX4A 3KE2A 5DEQA 4CICA 2BVNA 2E1RA 3A1SA 3BE4A 4U5XA 3UG7A 4LGMA 1RRPA 3L2CA 4NBSA 4PPNA 1D9ZA 4HLUA 3PG5A 2QI9C 3LAPA 1P2TA 3THWA 3R9WA 2R44A 2NPFA 2J87A 2IYQA 3CZPA 1JPNA 2OZ6A 4RB1A 1AN0A 2YOFA 3TVDA 3CUQB 3AAFA 4GNKA 3O8CA 4RGRA 3WTSC 4LD5A 3KJGA 5IHPA 3WGIA 1CF4A 2VP5A 4XOIA 4D0PA 1IN8A 3RABA 5J4LA 4RY2A 1Z08A 4Q4HB 3CUQC 1P61B 5JLJA 4A0RA 4BRUA 2MLKA 2ZYVX 3A37A 4XRFA 3P4YA 3GW2A 1YO5C 3FGNA 3DV8A 1XD7A 4LBVA 3PEVA 2Z5FA 4Q4AB 4WK8F 1SD4A 2DYKA 1PUEE 3F8BA 2VHUA 3NHBA 2XNDD 1U3EM 1KNQA 2GJAA 2JIZA 3I3SR 2AN9A 4DLUA 5FBWB 5KOYA 1JPJA 4NU0A 2HR3A 2WIAA 5AJZA 4A6XA 2ZRNA 1TTYA 1MKMA 5FFXA 3BPXA 1SULA 2DBBA 4WZBE 1Z9CA 1EH6A 1HKTA 1X3UA 1FY7A 4OMZA 5FUVA 2KBFA 1HKQA 3GLXA 3T5XA 1KGSA 5DHFA 4LJ6A 1DARA 1ODFA 3FXQA 4K81B 3QY0A 5AIQA 2G9WA 2UXXA 4DHEA 3L43A 2PZEA 2WPDD 1N6RA 2CW0F 1IXRC 2FPLA 4DEXA 1M7HA 2R62A 2Q0OA 5HTKA 4RSGA 2PJRA 4QNMA 3ZMVA 5E17F 3WGGA 1ETUA 3K9NA 5CB6A 2BJVA 4V0ME 5DUKA 4L18B 2GK7A 4ON0A 1QDEA 4W5JA 2XASA 1OYWA 3C18A 1VMAA 3H3ZA 3O47A 3SZTA 4YMTA 5KSOA 2JLRA 3K70B 2IJLA 4IXAA 3IDQA 2GK6A 1K6MA 2MSDB 2XJ9A 4NPHA 5JFGA 3GPLA 2EV6A 4QLCU 1FP1D 3EPKA 3TQNA 3DEUA 1G3RA 3G5UA 1N6NA 1E4VA 1U9IC 2DR3A 4QBFA 1R0ZA 4TTPA 4NCIA 4O25A 1N25A 2DT5A 1QVRA 3HRTA 4BZXA 3ZIAD 1G1MA 1XX6A 4E09A 1OB2A 1YZTA 2RHDA 1G17A 4LBZA 4KVAA 3WBJA 2IYUA 2RGCA 3BORA 2YU3A 3ND9A 4OINF 4OJKA 1TF2A 2RAPA 5AUNB 1ZN2A 3E6MA 1XMVA 2CNWD 4QGHA 4DLYA 3G0HA 1RZ4A 4NHJA 3BFVA 3SBDA 2VP4A 5DUIA 1JAHA 2R6CA 1M8PA 5KDLA 5LHGA 5HDNA 4KNYA 4BQAA 5J4VA 4GT1A 2D45A 1E2JA 1ZINA 4NH0A 2HS5A 1DPRA 5CVIA 1DTSA 1GKIA 1XMKA 1AA9A 2IXEA 4PANA 4B3CA 3M0EA 1KY2A 1TUEA 4QKQA 1ZNZA 5AWFC 2CE7A 4FWDA 4DSOA 3LH5A 1M34E 4JVLA 3T5DA 1LVGA 2BKEA 1HQCA 4NCHA 2VRWA 3IIJA 3D8BA 4GP6A 2B7CA 4OK3A 1P2UA 1I4LD 1R5HA 4IPAA 1G4UR 2BBTA 4WBSA 1DP7P 2FRHA 4URWR 3B1VA 3BFKA 3A6PC 2DPDA 2FJUA 4JBYA 5ICEA 5CM9C 2V54A 2DFTA 1A7JA 2OESA 5HOOA 1R2QA 4GRAA 5EE0A 2F1JA 4LYAA 5FPSA 4Q00A 2CLCX 2DWZB 1XZQA 1JB1A 2O0KA 4Y0VA 2PEXA 2PMHA 5A5GA 1EGAA 1I27A 4RAYA 2ZS7A 2GEDA 3U2QA 1QBJA 3R61A 4PZJA 3P7NA 2R2AA 3AQ4A 4IJMA 2Y75A 2PI0A 4UXHA 4L0YB 5BPDA 1HKSA 1QZYA 1K5DA 4Q21A 4DVGA 3M7GA 4M1WA 3X1ZA 5KHOC 4MGYR 2I4IA 4P9UA 2ZRHA 3WMFA 4RD3A 1W5TA 3ROUA 4EJUA 3ZN0A 3B1ZA 2XAHA 1ZM2A 4KIFA 2ZO4A 2JDID 4NTZA 3O6BB 4RFSB 5E7IA 4HF0A 2ZREA 4CVNA 4G01B 4R98A 2OSBA 1KU2A 5LBQA 3BXZA 5L3SB 2R6GA 2CCKA 3KL4A 3LLMA 1G3YA 1W46A 2CHQA 3NBFA 1JR6A 4ZPXA 2EWNA 1TBXA 2CBZA 3DOFA 4CEHB 4NL4H 2FFHA 5D3MA 3AVYA 4X8OA 3AV0B 2J9RA 1CULC 1ZIPA 2J1LA 2PMUA 3DPLC 4LJZF 2Q3FA 1UCRA 3X1WA 1HW2A 4DSTA 3KKPA 4TN1A 1FYKA 1OXXK 1KQ0A 1U6GA 3AUYA 4IOJA 2AFIE 4GPTA 1P72A 4JZKA 3SJZA 1S4QA 4ABYA 4YONB 1HBXG 4D4JA 4HAYA 2O5VA 1XD2A 2JPBA 2Z4RA 3TO9A 1GNRA 1NI3A 3L8ZA 3UG6A 2CMKA 4GO1A 3EIHA 4IEIA 2JLSA 3WYAA 1UB9A 4YMUA 3WTZA 1OH6A 3BWGA 1KZGB 1KU7A 2VA8A 4ZCLA 1Z6AA 2GJ8A 4OQNA 2EU8A 1R5GA 3ZD7A 1WMSA 3KXLA 4P3YA 2JTVA 3TDZC 2Z3YA 2NAZA 2H09A 4RS8A 2WM9B 2OEPA 2XX3A 3AVPA 3AJIB 6Q21A 3EX7C 2ZRDA 4LCBA 4EPTA 1FTNA 3NVAA 2ZS8A 5BYKA 3TOBA 4KU4A 3ZQ6A 2HV8A 3VR4A 4D6PA 3W6OA 2QAJA 2QAGA 2CHVA 2WIBA 3HRUA 3K0CA 4FN5A 2J45A 1OV4A 2EK5A 4E70A 4KFRA 4Q03A 1TX4B 4CHUA 3C41J 4KCGA 3F3YA 4P31A 4AG5A 1DAGA 1II0A 2GKSA 3FXRA 2GVZC 3ADCA 4A15A 2BKUA 3RS4A 4KLZA 3ZP5A 4TTRA 1E9AA 2H17A 1NF3A 2HEIA 2BEOA 4DLWA 1T0FA 2G3YA 2WJJA 3MAAC 3U6BA 2XZOA 3PJRA 4CEHA 1KI6B 4NP6A 3CWZA 1E0SA 1LEAA 1D5CA 2OAQ1 3GJ3A 5CLSA 3AH8A 1IM2A 5FLXK 3E6DA 2RGBA 5KO2A 2OBMA 2IEZA 3ECCA 3WTXC 3RKWA 3HIFA 4XIGS 3PUVA 3T15A 3WP1B 4A8JC 3HTUA 3FHOA 4ERNA 3PUYA 2J5XA 1UBFA 5HLHA 5FOSA 4HUQB 5FTJA 4CO8A 3HOTA 2YPRA 1A4RA 1QGPA 2BMFA 3IWFA 3I8XA 1QHXA 2YZ2A 2GAOA 4C4PA 2PQ8A 5FOTA 2EFQA 2F1IA 3Q72A 2XTNA 3MZHA 1E2MA 3O8DA 4DB4A 3LRPA 1SQ5A 3RS5A 2PJPA 4UJ5A 2RN7A 1LFDB 2P6UA 2RGGA 1XP8A 1O3SA 1I4DD 3ZQJA 1CR1A 3QIAA 1SVMA 1YHNA 5J8CA 2QENA 3OEHD 3F5FA 5G3ZA 2ZRIA 2ZR9A 4JVNA 4BFYA 4LC1A 4R1HA 4Q4AA 5DN6A 3TBKA 4AKGA 3ZYCA 1V3FA 3L8YA 2RGVA 1U0JA 3UKDA 4GOKA 1IN5A 1VCOA 3UXMA 1XWIA 1DBSA 4CGZA 2O8EB 4B32A 2CCGA 2VT2A 2FG5A 5F6FA 2VT3A 5GJVC 1R58A 4UNPA 2NZJA 3WRXC 2Z99A 1G7RA 3W3ZB 2PLFA 2PEYA 2GZAA 3RAPR 3VQTA 1BOFA 1W47A 3M8FA 2HXYA 3I5UA 2K4JA 3LFUA 4ZYHA 1OYYA 4BUJA 2HXSA 1YVDA 4JBAA 2BCGY 2AL7A 2YOHA 2XTMA 2EFHB 2H57A 4Q5SF 4Q7KA 1NBME 5E1WA 3NHAA 4B3BA 3SOPA 2QMOA 2VP0A 2ZRMA 3QPWA 2ORWA 1ZM4A 4P9FA 2GXSA 2Q6TA 2AD1A 3KQKA 1QHHB 5CM8B 4F92B 3KETA 4CYDA 4M1YA 5DI3A 3EG5A 4OK5A 2BMDA 4RD2A 4LK1F 4D0NA 4G7OF 5CYVA 2DAOA 2FFQA 5F2EA 2FSFA 3EDPA 4OKSA 1A1VA 4JT4A 1R8QA 2OT3B 4LHWA 4ZDIA 4AIIA 2ZJ8A 3M1EA 3W5JA 4XLPF 1ZM3A 1HXDA 2XRNA 1SKQA 4ESFA 2NIPA 1ZVQA 2VBWA 2QAGB 3TR0A 5J4YA 1EFRA 3DHWC 3GJ6A 3R6SA 3TKYA 1ZRDA 1Z0FA 3EC1A 1Z6GA 1T4GA 4QGGA 2IT0A 2ATXA 4NYMQ 2G88A 1KJYA 2HEOA 4M6XA 1KI9A 1NN0A 1KQ8A 3T34A 2JLZA 1BC8C 1UHWA 3VB2A 1CKEA 1PZNA 4JSYA 4G0NA 3L7WA 4WWCA 1MOZA 3QRFF 4Y0AA 4ZO4A 4EGZA 2GF0A 1KDPA 1YLFA 2V1XA 1VYTA 3TJZA 3BJOA 2KRFA 1BI2A 4M71A 4GOJA 3KZZA 1C4OA 2DU9A 1NG1A 1W44A 1Z06A 1T3LA 2FFBA 3CPHA 2F9MA 5G41A 5CDFA 4TT3A 1SD5A 3IHUA 4O2LA 5JCZA 3AM1A 2V7QA 2VTKA 4UNOA 1M74A 1VYVA 1CJUC 521PA 1KI3A 2ZIAA 4QBGB 5JZVA 3I5YA 5LLQA 2O8CA 4CW7A 4B33A 1SXJD 4I81A 3CH4B 1IN7A 2OCYC 5BMZA 3V7RA 1GWNA 4TLBA 3BB4A 3R60A 2F3TA 3CTAA 3E70C 3GFPA 2ZBKA 4DXAA 1W36C 1UPTA 2GZHA 1XDSA 1N6HA 1U5TB 4TYPA 4C30A 3P32A 4UV9A 4NYIQ 5JCPA 3G82C 3ZMDA 3QXXA 3CW2A 5J4HA 1FNNA 1SVLA 4TYQA 1S3GA 3FKQA 3RRYA 5LB4A 3U3KA 1NLYA 4JQFA 1XJCA 5GVRA 1VCNA 4HBLA 5AIPA 1G8HA 1NIJA 3MEXA 1Z0AA 4PZLA 1N6OA 2CVFA 1J2XA 3GFOA 2Y8EA 3I73A 1KMHB 4A9AA 4B35A 4CZZA 4WX9A 4MKFA 1OPXA 2EV5A 4BNCA 1QHSA 2KSQA 3TK1A 5GJBA 2O8BA 2D2WA 3PXGA 4XSZF 2C77A 4Q4LA 3UWOA 3UIEA 2NG1A 5D3MB 1N2CE 2QL6A 3T12A 3DOEA 4LJ9A 1IF1A 4ETSA 3GLFB 1RJ9B 3TUZC 3DMNA 4JYCA 2IYXA 4HAVA 5IF9A 2HT1A 3WNBA 1VIYA 2QU8A 2RGDA 4WF2A 1HSTA 1CIPA 5ANRB 1WRBA 3GLIA 1SMYF 1R22A 3K1JA 4JN6A 3CZQA 4KFUA 4W7SA 2ZYUX 2GWHA 1HSJA 4XH9B 4M9XA 4YC7A 2Z4SA 4HSEA 5FI0B 4LGWA 2CL6X 1JXMA 2ZNZA 2MBFA 4K46A 3H3UA 3KFXA 2VOOA 2G1JA 3TE6A 4G5OA 1YS6A 4I99A 1G5PA 5FB2A 4P5OA 2R6AA 3T1OA 4A82A 2UKDA 4IFBA 3RI4A 4L8GA 3J80K 4A2PA 4KBGA 4LBWA 3GF2A 1H9TA 3N70A 2KIMA 3HYIA 4A2QA 5AUOB 4S04A 3PVSA 2OD5A 1BOAA 4EJSA 4ZIRA 3VAAA 5LD2B 1P60A 3VNVA 4WZAE 1F5NA 2RV8A 2W2XA 4UVBA 5E7MA 2EA4A 2D74A 3FKSA 1RE0A 3HYTA 1YFHA 3U7GA 4TSFA 1R5OA 4TZ0A 3WHKA 1G8YA 2WSSA 2QTVB 4RJLA 1RYFA 1GKUB 2KWIA 5E3HA 1Q0UA 5C4MA 2X19A 1VG8A 2BJWA 2C98A 1TNSA 2RGXA 4HDVA 1S8NA 4BQSA 3SZRA 1VECA 2GRJA 4L9WA 1XCBA 3T8RA 1NKTA 4LPSA 3LAJA 4UKDA 2FU4A 4DRZA 4U02A 4W5HA 2V79A 5FI1B 2XITA 3AF4A 4MH0R 4N9HA 4EM1A 1P4AA 3K53A 2CFXA 4H9GA 4ZDWA 1E9EA 2Q21A 2A68F 1XTKA 2ORIA 4JLBA 1NBMA 1A2KC 4OBEA 5ED4A 4PPQA 3R7WB 2GXAA 3GZ6A 1YQAA 4TMXA 1REPC 2CL7X 3EIQA 1K7AA 3W9YA 2TDXA 2BGCA 3K09A 2FFAA 3UMRA 1P92A 2VC0A 1J2JA 1E2IA 3EXAA 4UNNA 2AWNA 3N2IA 3HWSA 3LSTA 1O3RA 4LRWA 2HT6A 1TNTA 2R6DA 1NN3A 4US1R 1Z28A 3ZMSA 4R79A 2QGNA 4V0MA 3QXCA 2P5KA 3FM5A 3V9PA 2QTHA 2VSXA 3L2OB 2J0QA 2HTJA 3BOSA 2XROA 1BYUA 3LQQA 1DG3A 1Z05A 1MO5A 5EQTA 1NIPA 3OE7A 3K69A 4A6EA 1T98A 1R6BX 2QQBA 3ELKA 2P8TA 4IOKA 5DN6D 8OHMA 1Z6YA 3LLUA 3HU2A 3FTQA 1BC7C 3U9GA 1UJ2A 2G0TA 2QAGC 1Z1DA 2G7HA 1KI1A 3A36A 2G83A 2VP6A 1OXSC 3RWOA 3KQLA 1GXQA 4FI3C 3C7KA 1XD8A 5FBLB 2L54A 3KTAB 2GQQA 2LWIA 3PUXA 2LF7A 4MITA 4HZFA 2H8KA 3Q7PA 3L0IB 3BH6A 3GCGA 4B75A 2Q8KA 1W0JA 1U8AA 2YNMA 2RVCA 3MZYA 2HWVA 2K27A 5ILVA 2I1VB 5H20A 2AS5F 3B13B 4RVCA 4G1UC 3V8LA 2ODWA 3SNHA 1KKMA 5JSZA 4PHGA 5D5XB 3QBTA 4Q7MB 1G5TA 2QQAA 1A04A 2HLDD 4D80A 2JRTA 3ML6A 2B21A 2FSWA 2O0YA 3REOA 5K8UA 4UXIA 2IK8A 2C8VA 1QRAA 6PAXA 3BERA 3BY6A 3QENA 5AJWA 1W4RA 3NXSA 1GAJA 1TQMA 3IILA 1DE0A 1W36B 1HE1C 1J8MF 3RSOA 5B58C 2H6BA 1ZBDA 2JPCA 4KFTA 5AJYA 3P9CA 4L9NA 1G21E 2ECKA 2B7BA 4DCTA 1JE8A 2WZQA 1YZKA 2WKRA 4EJSC 1E17A 1FBUA 3JW4A 5DSZA 1ZD8A 4JSTA 1E4YA 3IBGA 1L4UA 4LYJA 2ZJ2A 5BWMA 1BYIA 1ZG3A 5AONA 1IRGA 3ZS9A 1V43A 3KXIA 3CLVA 3CLOA 2WC2A 5DISB 1ODDA 1U8YA 3WMEA 5K5QA 5G53C 1ZD9A 3MQ0A 1PLLA 1NVVQ 4KHZA 1NN5A 2ZANA 2CNWA 2E9SA 4L5IA 2HYDA 4LK2A 4I1VA 3UATA 621PA 4TLEA 4KMUX 4XSXF 1X1SA 2IUTA 4F4IA 1Z7UA 3ZN1A 3AKCA 5HS7A 1XTSA 2ERYA 2FGJA 5E95A 4AIJA 4MTEA 1MRSA 1UKVY 2P5SA 5A2QZ 2Z6VA 5EE1A 3D0SA 3JAMK 2ANBA 2F3RA 2P3SA 3EZ6A 1XU4A 2JATA 1F1ZA 2YHSA 5JHHB 2BWJA 2VP2A 4TWZA 1OYIA 4US2R 3K09C 4F4JA 2DTRA 1LF0A 1MV5A 3F8NA 1CP2A 3F0TA 2FPMA 4LB5A 4HDCA 4DLVA 4EV0A 3K0SA 3I59A 3IQXA 3CUOA 2W00A 5FPKA 1B23P 3SQWA 4MQ9F 1JEDA 3ADKA 1MZBA 2OILA 3LV8A 4JJZA 2OA4A 1YQTA 2QSZA 4M6YA 2A7QA 2F55A 4LJYA 2ZSFA 4KYWA 2H5EA 3PV0A 2BBOA 1T5IA 5CYPA 2FMLA 4PGHA 3R9XA 4D4KA 2E1NA 2FF4A 1KO5A 2Q3MA 5DD4A 1E2QA 1DUXC 4RGSA 1QF9A 2HF9A 4G5SA 2OU2A 3KP4A 3Q9VA 5LHIA 3LO5A 1F5TA 4Z8YA 1FYMA 4JL8A 3I4LA 4JL5A 1KNXA 5D8LB 3AP3A 4NDZA 1W36D 4QM6A 4RGXA 1YIOA 4FMBB 4MYUA 4M9QA 4OYHA 1GXPA 2J0UB 2ONKA 2COMA 2DBYA 3HRSA 3NRVA 1T9HA 4KI0A 1G8PA 4OQFA 3RLFA 2XV4S 3BFXA 5B30A 2IS6A 1TW2A 2V6IA 3TQCA 4ZDKA 3FPAA 2QMUA 5CIWA 4IF4A 3TR5A 3S1AA 4GSYA 4C3ZA 5E8GA 2YWGA 1J59A 1SKYB 1XEWY 4RZ2A 5AJVB 4A12A 2QP9X 3MFKA 2G6BA 4KXFB 4TYNA 4BFVA 4B43A 2YC2C 1DS6A 1US8A 4HLUC 3DM9B 4WXHA 4FT8A 2ZRLA 3SYKA 3SU8A 3LA7A 1JECA 1JI0A 3F72A 3I53A 2ZCWA 1GG2A 4X8HA 4AY2A 3GLHA 4HEJA 1COWD 3M6AA 1ZP6A 2J0VA 1DAMA 3EZ7A 3FZVA 5HCNA 1NG9A 3VNUA 2J7PD 1C9KA 3THYB 2P6RA 1E1RD 3KJEA 4A1FA 3GEIA 2VPPA 3K1MA 3WODF 2ZYWX 4AKEA 1EFCA 1H8HD 2ZI5A 1E2NA 2ZRKA 2EFPA 4ESHA 2OE2A 2ISZA 4JBWA 1EWRA 1B9MA 3IPYA 3B2EA 3FKSD 1KSGA 2QZ4A 3QPVA 1FBQA 4IDNA 4LZZA 1J8YF 3P4XA 3EZFA 2ODNA 3EWAA 1ZYUA 1K6OA 1AM4D 1E2LA 2BV3A 4EQ6B 1T0HB 4NZYA 1MKYA 3I71A 3RKXA 3WTUC 5D4SA 1LB2A 1GKYA 1V5WA 3KB2A 4E03A 4EFLA 3SHFA 4YMWA 4HW0A 2F1RA 2HGCA 4AIKA 2ZQ5A 1T0JB 3ZZUA 4KODA 5L3FA 1YRBA 2FA5A 4B3DA 3U44A 2D4HA 1E2XA 2M45A 1ZC4A 1XB4A 4PHTA 3GLGA 2JJ2A 3SBEA 3WNCA 2WWFA 3TNFA 3KZYA 1PJRA 4OI4A 4A92A 1G64A 3EA5A 5HR5A 2F5EA 5IT9Z 3QKSB 4TMKA 1TQIA 2F5FA 2W84A 2XKPA 1E2DA 1TQ6A 3QI2A 1L8QA 2ZTSA 1DAEA 4MDFA 1TUIA 3RC3A 1H8EA 1F60A 4TL6A 5K8IA 1A82A 1OXVA 4KIBA 5A2QK 2CG4A 5LB2A 2N46A 1AQYA 5KPDA 4HX8A 4F93B 5HS8A 4RZUA 1KSFX 3LA3A 4WAUA 3U6KA 1RIOH 3BOQA 3NQOA 2IXFA 1XPOA 1WCV1 2W25A 2JLUA 5F9FA 2IXGA 5HZKA 3FFBA 4NHOA 4AK9A 3ISPA 1YE8A 1ZG1A 2FBKA 1DAHA 3U7EB 3FWYA 4IRGA 3AVWA 2BV6A 1S9DA 5FO5A 4U7BA 2RQPA 2W24A 4LYFA 4RD1A 3FX3A 4ACAA 3O8RA 2XSZD 1SHZA 2FQ3A 3L0SA 3CO6C 1FUKA 1MO4A 4LX0A 1IJEA 4FIDA 5C1BA 2OLJA 3A1WA 2ESHA 1S29A 1HW5A 2YX4A 4HDQB 1CR0A 4PZZA 5FUXA 3QF7A 2ZJAA 1P7CA 3B1XA 2JJ2D 3B85A 3KB1A 2WJGA 1FSEA 4JMPA 4QC2A 2VQSA 1S0UA 4WXRA 1E32A 2C5LA 3ECHA 3IKVA 2AK3A 2ZNYA 1D5VA 2REXB 3LNCA 4CEIA 2PFBA 5TVKA 3GLGE 5L3EA 1YR6A 2AR7A 1BJAA 2QSYA 4JJKA 3K0FA 1X8KA 2IYVA 1ZNWA 4Q02A 4DLZA 5DHAA 4BFWA 4ENNA 4D4LA 4BLRA 4L9TA 1Q20A 1S1CA 5DI9A 2KIFA 3B1WA 1KYWA 1T39A 1NY6A 4QHTA 3Q9LA 1F3OA 1D8JA 2XB2A 3TO6A 4BZPA 4CYMA 2DPUA 3HP1A 1KK2A 4MRSA 1JNYA 1UM8A 1XEXB 4ZKDA 2GEUA 3P9IA 3KZ1E 3DKWA 2EYUA 3VTKA 3AGQA 2F43B 2W83A 4TTQA 4PO8A 4BAYA 2WMNB 3PFIA 3SQXA 1WP9A 1NNEA 1VIAA 3MMPA 1A2BA 2MLGA 4ENJA 4A0FA 2EVWX 4IRUB 2H7VA 1MJBA 1H8HA 4FXPA 1XXHB 1USTA 1TF7A 2Z9OA 2EV0A 2XSZA 4TMZA 4ZYGA 3A1VA 3V4RA 2FOLA 2W85A 4QNRA 2NO7A 2ODBA 3CDHA 3BZ6A 4A3VB 1ON2A 4LLGF 1R00A 2IA1A 4A2UA 1FC3A 2NGRA 2GA1A 4IFEA 3LBNA 4S35A 3VR5A 4F7WA 3R8CA 1NLZA 2P7VB 4IOLA 4GMXA 4HX4A 3SYNA 3SJAA 2A5YB 1XTJA 3TIFA 1NL3A 3U3JA 1G3IA 3IBYA 2ZJYA 2O3FA 1SFUA 4EMSA 3IKJA 1P6XA 4KYIB 4AIHA 1NY5A 2GXBA 2A5GA 3NEYA 3ZLJA 1R5NA 1Z29A 3SHWA 1XFAA 3ZMUA 3E5HA 4XD7A 4BE7B 4IRHA 1UAAA 3RPQA 3RRMA 3E6CC 5CJ2A 5DYIA 3PQKA 2MH2A 1K8RA 1UKYA 3CKLA 4B09A 4EJWA 3I54A 4OU0A 3ZQ7A 3SZPA 1YZUA 3MSXA 3QE0A 2ZAMA 1EFHA 2LKPA 1XMSA 1ZW6A 2GF9A 3OIVA 1XCPA 5TRDA 3BPVA 1XMAA 1AS2A 3CB4A 2PLYA 421PA 1BI0A 2ZROA 5AUPB 3EW9A 5ICFA 4ZYDA 4RAZA 1KAOA 2XAGA 3GEZA 2C78A 3GFTA 3LW8A 2MC3A 2J3EA 3I5XA 2A2ZA 1AS3A 1XCGB 2IHYA 2OQRA 3AF0A 2LKDA 2QPAA 3RPUA 1SXJB 5A0FA 4Z51A 4A8JB 4C7OB 1SKYE 4CEJA 2VEDA 4TL9A 5H68A 2YJTD 2QBYB 2WKPA 3CH5A 4V0OA 4A2WA 3EZ9A 5EE3A 3K70C 1NBMD 3W5IA 3KP5A 1DEKA 3RYTC 3TSZA 1AKYA 3IC7A 1Q57A 4YIFA 1KZ7B 2P2LA 1CR2A 5E18F 1N6PA 5L3DA 4BH9A 1CRPA 3RYPA 2OHFA 4MHGA 1G3UA 1KHTA 2ZETA 4AC9A 1US8B 2CDNA 2QM7A 3LBIA 1HT1E 1D8KA 3BJAA 4L9JA 1II8A 4N0DA 2K4BA 4BASA 3OZXA 3FMSA 2ZI3A 3O3KA 5LGTA 3PCRB 2QT0A 5B2ZA 1YYVA 1YR9A 2RGAA 1NVMA 1E99A 4YMVA 3QP5A 5J8FA 1E9RA 2P5VA 2GVDC 2C04A 2C96A 5CK5A 3P9KA 2Q3HA 3RRNA 4JLNA 3SJCA 2DFIA 1T5LA 5F64A 5ILSA 1AOYA 3KXKA 1L3LA 1Z6TA 3KCCA 2L0XA 4MRPA 2FN4A 2O8DA 2AK2A 4LG0A 1E2EA 2ZRAA 2VIIA 5FPHA 3AVVA 5L3QA 2V3CC 3A58B 4CXFA 2VLIA 3GZ5A 1JXOA 5BN4A 3VFZA 2GZDA 3X2SA 3K0AB 1O7FA 4PHFA 2DQRA 2QUFA 5CIQA 5H6RA 5FD6A 1I1SA 1W4CA 1ZJ6A 3WTYC 4GYIA 2HJVA 2OCPA 2R9VA 3QF4B 3V4FA 3W8RA 2F2EA 1T8UA 4HLYA 1RRFA 3MLEA 4Z2YA 4EFMA 3EAQA 2GJSA 2OZUA 4HB0A 1BS1A 4DQ2A 3VR1A 3NC0C 2LSOA 1RKBA 3L0PA 2YX7A 1S8FA 4NONA 3E5UA 2KRKA 1H65A 1XTIA 4B74A 1JJ7A 4C0QC 2Y48A 2J7KA 3QF4A 4V02A 4ZV4A 5BS6A 4EDHA 3RNLA 1S7OA 4G6DA 4HAXA 1GHCA 1B6AA 1ZM7A 4TV7A 3OESA 4DWJA 5JHUA 4RD4A 1SFEA 2RNJA 3T0YA 3P20A 5DI3B 1DPUA 5KPJA 4GITA 1UDXA 2G9NA 4LRSA 1YZLA 4EKDA 3VR2A 1E0AA 4A5MA 1FZPB 1AS0A 1AZTA 1ZHFA 1WXQA 1P62B 2GCPA 5J5CA 4K2EA 2STWA 2GNOA 1QZXA 5AUQA 2HTSA 1D9XA 4LJ8A 3UWKA 3MD0A 4DSNA 1KO8A 2ZAOA 2WV0A 4LMYA 4QJ4A 3KEQA 4NCKA 4IDOA 4Q9IA 1NP6A 2WJHA 1X3SA 2YWFA 4E5UA 3Q5EA 5LD2C 4JLKA 3Q5DA 2CWEA 2V1DA 3TGPA 2EJRA 5TARA 3TUIC 2J0SA 1V4RA 3HSFA 2GHIA 4XTCS 2ZJBA 2HOEA 1KU9A 3J81Z 1I4TD 5TXGA 3HU1A 4LSGA 1XGNA 4I1UA 2KJBA 2JEOA 4IHQA 3SXYA 4OHWA 2BIFA 4URUR 1XPRA 3PR1A 2IYWA 5BN3A 4A0XA 4TL8A 3GJ8A 1T2KA 2GIVA 5JWRA 4Q01A 4PQYA 3ABTA 2ZSEA 2WWWA 3AP2A 3AP1A 4QOSA 4Q1CA 2JLVA 5JWHA 3MAJA 1QHGA 2AX4A 4AG6A 1I2DA 2WJVA 3V8JA 3LXXA 2EFNA 2Y0MA 3BGWA 1NRJB 3QAHA 2Q9BA 1EFTA 1RVDA 3K9TA 4NYMR 4C0SA 4UNRA 3FMRA 2DVWB 1P2FA 1GL7A 2AKAB 2OBNA 4OOIA 1TQ2A 4FWIB 2GA8A 3IGFA 5D8KB 2ZI4A 1R1VA 4FCWA 3CR7A 5H70A 4BLSA 4FMDB 3H4MA 1DOAA 1F9NA 4HUQA 4ARZB 4M9ZA 2YV5A 2ZU0C 3VOEA 4B47A 1VG0B 3JSPA 4BHPA 1BO6A 4P32A 4IOMA 5D4RA 4D82A 2AWOA 2DZOB 3HJNA 4CRWB 1YW8A 3AGPA 2JA1A 1ZU5A 3KP2A 4PSAA 2D06A 4EIWA 4AD9A 1E2FA 3KP6A 1Y3AA 5BYJA 4A0HA 3TOAA 4GL2A 2LNBA 3C5HA 2IF2A 4KFCA 2HKXA 3GUDA 2CJWB 5C4GB 1FP6A 2FH5B 4L0ZB 1HH4A 2IYTA 1U0HC 1OFIA 1NJFA 3GLFE 3PUZA 2ZRJA 2P65A 2ZE6A 4XVUA 3FMFA 2M8EA 5K1YA 1XF9A 3LA6A 2P7CB 2IA5A 4P4UA 3CNOA 2BBYA 3LVRE 4PC3A 2NS0A 5FR1A 5FPTA 4HLQB 3WP0A 1GVJA 5JJLA 1OPCA 4LJ7A 1KJZA 3U3OA 1CJKC 2VO1A 2CE2X 3CRMA 1XTRA 3NH6A 5LRSA 4MYHA 1T3SA 1E1QD 4P4SB 3U3RA 5A4JA 5DNYB 4HV6A 3K0AA 3VMFA 2QLZA 1TQDA 1VTNC 4C2TA 4RZ3A 3ND8A 1ZCBA 3FVQA 1NVVR 4B3FX 3UPUA 4KLNA 2OQGA 1XEXA 4M73A 1RIFA 2EW1A 2ELHA 3C7JA 1SGWA 2OCBA 4FCTA 2R8RA 2GA2A 2YWEA 2PL3A 2WJYA 3A1TA 4DT1B 1KY3A 4IJAA 2F5DA 2LDUA 3F8MA 3OIWA 3BP8A 4QHYA 3KKMA 2LKCA 1BBYA 1Q44A 3DDCA 1KYZA 3U60B 2OFWA 3P26A 3A4LA 2DHRA 2MA3A 2VBYA 4JIMA 5JECA 2NO1A 5CJ9A 3WGHA 2QY9A 1LV7A 4Q18A 4C2UA 4LPKA 1MABB 3IO5A 4FMCB 4DUGA 2WKQA 2ETHA 4BHBA 1KMQA 3AKEA 3FHCB 1OKKA 5EE5B 1MR3F 2RGNC 1Y0UA 1HTWA 4KFSA 4L4UA 4UJ3A 5HCIA 3U4QB 3I32A 5HE8A 3THWB 5JRJA 2C99A 2ZSDA 1P73A 2GAUA 1F2UA 1N5IA 2XZPA 4HZUA 4NKRA 4PQFA 4XWOA 1GRNA 4C0HA 3SJBA 2D7DA 3WMGA 4Y13A 5LGNA 2WSSD 3MWKA 3FDIA 3BK7A 2YINC 3PITA 3NIBA 1O3YA 2JIZD 4M4SA 4EM2A 4GGGA 3A1UA 2W2VA 4URXR 2L4MA 4EM0B 2HQRA 3N97A 1CXZA 5CVJA 3N4MA 2BM1A 4OHVA 4KMFA 2FZ4A 1GM5A 3TLXA 3RKYA 1IN4A 1HQYE 1SXJA 4Z8XA 3BROA 3GWZA 3COAC 1DVRA 1G6HA 3LWNA 4HZIA 5FTMA 5HDKA 5KSPA 2OFOA 3D7MA 2ZXUA 1IBRA 4ENMA 1VCMA 1E96A 4ZCIA 1G9XA 3K70D 2OCAA 1KO7A 4AKIA 4MKHA 2IWRA 3K2ZA 4F7ZA 3TDUC 2J5OA 3OEED 3MCZA 4B3XA 1KA8A 1FWZA 3GLHB 2Q2EA 3E6BA 2OFXA 4M1MA 3A4NA 5C2JB 2C9CA 2ZE5A 1TL7C 4B6FA 5JS7A 2W0MA 4H0EA 1ZUHA 2N42A 2V6CA 3EIEA 4I4LA 1Z5ZA 1P2VA 1J90A 3C5CA 1R0YA 3CPEA 3ETLA 3R0JA 2HYGD 4OIOF 1TPZA 1X8JA 4KO8A 4KAXA 4MRNA 4QWQA 1E6CA 3IKTA 3OFNA 3PEYA 4TQUS 4Q1BA 2O52A 2XVCA 3AVXA 5BW8A 1O3QA 3SE0A 1ZRCA 1KAGA 4C9BA 5D3QA 2IC5A 4CT5A 4WIAA 3VEPA 1BIAA 1ELOA 1VTKA 1S2MA 4RB2C 2RC4A 3TW4A 3AEZA 3L00A 4Q7LA 1KK1A 1Q21A 3VR3A 4JBXA 4H1UA 2XEXA 2XXAA 2DK8A 3IEVA 4EVIA 4OL0A 1QHYA 4QBHA 3CBQA 5L3CA 3ZIAA 1IXSB 5KUTA 1EWQA 3BWDD 4MUBA 2YVUA 4DIDA 3VFDA 4CEIB 5JEDA 1Z47A 5C18A 1DELA 3T06B 1NVXQ 2WAXA 1R5BA 1CF7A 2IP2A 3WU0A 2ZJOA 4GBMA 3HTSB 3I1FA 5F3WB 3QPHA 2ANCA 4M53A 2NNNA 4R2HA 2ZUBA 4JL6A 3ECOA 4QRHA 3U1DA 1MDMB 4YQFA 1FL9A 4WW0A 4XWAA 3CF6R 5FUWA 4U7DA 1N0UA 1XTQA 2XOKA 3GD7A 4OIQF 3T1BA 3K0FB 3RS3A 2HZTA 2REOA 4MGKR 5C46F 1DADA 3B78A 4TQAA 1IW7F 2PX3A 3VR6A 3AVUA 4MTDA 2XUBA 1TF5A 4M1TA 3X1DA 4HV5A 4G6QA 4Z54A 5LRRA 5EP1A 3QU6A 1AWCA 1RYHA 1TADA 1KO1A 1JXSA 1YRAA 1IOZA 2Q9CA 2VHTA 2WPDA 4P33A 4PGGA 4A0YA 5E4FA 1R0WA 4NQWA 4PC7A 1FOEB 2UXNA 3H86A 3AF1A 1IY1A 2PN6A 1LB1B 2FXAA 1KTVA 1WE2A 4MYTA 4PAQA 5L3VA 2A3RA 4RD6A 1IONA 4IW3B 5BN5A 2ATVA 2L4AA 1R0XA 2HFHA 221PA 2J0UA 5TB5A 1G291 2V4ZA 3RANA 3Q7QA 1SZPA 2C03A 2ZS9A 1E2GA 4AWXA 4XJXA 3ZVRA 4DLTA 3GP8A 2PZGA 1J0RA 2A5JA 3DM5A 3IHLA 1CJMA 1TAGA 1P3JA 3EUHA 3QXSA 3T5GA 3BH7A 4QJ3A 1XSDA 1CJVC 2QVOA 3ABUA 1UF9A 4BLPA 2A5FA 3LDAA 3C14C 1S96A 1GP2A 1N3BA 1IRFA 1D2EA 3R0AA 4LHYA 1YZNA 3HOSA 3IO3A 5EP4A 1L0OC 3C3WA 1PLKA 1USSA 5DLQC 1Z0IA 3E2IA 3Q8XB 4LOAA 4UXJA 1IY2A 5HDGA 3ZVLA 1Z83A 2UZIR 5EXXA 4EFNA 4LI0A 5FPYA 3RRZA 1YZGA 3VU9B 4NCNA 4Q47A 1DAFA 1KSJA 4YIIA 1N5KA 1R1UA 1MRNA 2FE4A 3QKSA 4QXAA 5SZHB 3ICEA 2V1UA 3HHHA 4CDGA 5BQTA 1G8GA 3I8SA 1ESMA 4HYEA 4PZYA 4YXWA 2OZEA 2FGKA 5E7JA 4U0YA 1L2TA 2VL7A 1BI3A 3LQRA 2M5WA 1XPUA 4QG7A 1TEXA 2CLDX 3GLIB 3SQNA 2PT5A 1EESA 1ZCAA 1RRGA 2W2TA 2L01A 1E0JA 4FX0A 3KJIA 5CLQA 5FBQB 1YKSA 2QWWA 2DPXA 3FB4A 1F2TB 4MRRA 4JKIA 2N1BA 1R7JA 2QMHA 3CRVA 3KFVA 5G3YA 1U81A 4WVFA 1KDTA 5FL7D 1M2OB 2VF7A 2RH5A 3CRQA 3F8CA 5DYGA 1OB5A 1KJWA 1OFTA 3B7GA 1N0VC 4A8JA 4C7OA 2D62A 2QP3A 3B6EA 1OT3A 1QZZA 1QBKC 1JBKA 2QTFA 3B5JA 1N6IA 3TAUA 4R71A 4FCVA 1IJFA 1G3WA 4UVCA 1UBGA 3TGNA 4IRIA 4F91B
chains in the Genus database with same CATH superfamily
3I9FA 3NG1A 1YULA 3F7TA 1FZTA 1TEVA 1R9NA 4NFYA 3CQZJ 1EK2A 1T0BA 3HSRA 5ALFA 3THGA 1R4NA 2E3JA 4CETA 1DAKA 1DWOA 3NAQA 3EJ6A 3WKCA 2P69A 3HCPA 4W8HA 2IQ5A 4WK4B 3P71T 3Q3VA 1T2UA 3JVEA 2QKMB 2REBA 1F4PA 5E3MA 5F9HA 2E37A 2A67A 1BE1A 2R00C 2BM8A 4IMIB 2QORA 4PRLA 3NR2A 3RHFA 1JFSA 4YJGB 1XZIA 2G0NA 1ZK1A 2D1VA 3EZXA 1EBUA 1GPUA 2CXPA 1FS6A 2WD9A 4MROA 1QQIA 2DFLA 3E7LA 4B5KA 3N87A 4BV8A 3PNYA 4ND8A 3AUTA 1JQJC 1G5HA 1RQXA 3L4KA 1T2VA 3TIIA 5J2UF 1HORA 1WVGA 1MGTA 2IEGA 1ZH5A 2NU6B 3BG6A 3ESQA 1E7SA 4GFDA 2K02A 2P1DA 2JSCA 4XB2A 1VG9B 4B76A 5KOJA 5F08A 2VDVE 2L7HA 3A9RA 4BC0A 5FOVA 2ZUDA 3E3MA 1EXNA 2X3FA 2VBZA 3L49A 1GRQA 2WWRA 1TCUA 2QXYA 2P5TB 1D2CA 3IVXA 1HT2E 3E9RA 1MAWA 3PVCA 2ZITA 4TX1A 3RZDJ 3ZXSA 1CUYA 4L3WA 2F48A 4ZGGA 1Z3XA 4P0TA 3WHCA 1D3AA 3QIVA 3SMQA 4UDOA 1HT3A 3PPXA 3GPDG 3H2JA 3TGWA 4BGDA 4MFDA 1QJCA 1F48A 5HUHA 4Z4CA 1NOJA 2O61A 5AVJA 2ADMA 5K8LA 1SB8A 4R40A 3N8IA 2FWBA 2A61A 3TSWA 3AB3A 1LRKA 1VQ9I 4CM9D 3FUWA 3BS4A 3K7AJ 2DC1A 4Y1GA 2J3MA 2NRAC 4HY3A 1FFSA 3PHLA 2PNJA 1NQWA 4JBGA 1ONOA 1I4OA 3F5SA 3GAMA 1C0IA 2WY8Q 3L28A 1JQLB 4ILEA 1G3QA 4ZK6A 3QFTA 3ROGA 5FBRB 1TLFA 3S44A 4IXNA 1UFMA 4B4VA 2X41A 4R3DA 5DX1A 5LDDC 1B2LA 3JQ8A 4UCXA 1SK9A 3DE3X 4D5FA 1YKFA 3P8ZA 1NSYA 4DBLC 4AUNA 3OYFA 4DSUA 3EEQA 1KVTA 4I5FA 3CS3A 5IVPA 2X8AA 4RLFA 2HYIC 2P4WA 2XGGA 2E5LB 4G7HF 1QIMA 4MP3A 3F9RA 5EKTA 4DDWA 1SCDA 5DTEA 3CUYA 2WIFA 4P16A 1RI4A 3V4PB 3B8HA 3QOFA 4MEXF 1AKTA 1MMDA 1QTRA 1XLTC 3GYHX 3U17A 2AF3C 4JXXA 1J8DA 5EIWA 3IKLA 3ZVNA 4F8JA 3I9OA 1EX6A 1D2MA 2WSCF 2VRCA 1Z7LA 1RLOA 3N5CA 4HAMA 1KQNA 4G5RA 2POCA 3VU8A 1SBCA 1RKQA 5CX4A 4AKSA 1R0KA 2WOJA 1ECFA 1SVOA 2EIJH 4IQGA 4ZYEA 1T0FC 3SZUA 3COVA 1CFZA 4P2BA 4N0PA 3EC2A 2XT0A 1C9DB 1EFLA 1Q7TA 3BTIA 3ZKWA 5IASA 3THXA 4HNSA 1HURA 3TW8A 2JKVA 3I4MJ 2X5NA 2DO7A 3GLTA 2Q49A 3W1VA 1UWLA 4L9VA 2J32A 2BZTA 2PL5A 5AKXA 1YVPA 4N8EA 1O94A 2F5OA 3HPQA 1T9CA 3A8TA 3KBOA 2Y9ZA 1U7PA 4OAYA 1QZ3A 3EHEA 5KINB 4EGCB 2W2NA 4TXJA 1JKRC 4JYZA 2AEJA 1GTVA 3VPRA 2IUSA 1M83A 3KAPA 1QTQA 3H9GA 1GILA 2R18A 1ZMUA 2OC9A 2BMVA 4JGGA 5LJLA 5ALVA 1USUA 2DPYA 5L45A 3AYXB 2WYHA 4P7GA 3KT0A 2RARA 3M6IA 3TDNA 1VQMI 1OKKD 4OX9B 1R6RA 3CNEA 2D7EA 2YVQA 5T41A 4YFNF 1XEFA 4R8HA 2IU6A 2ACJA 2WICA 2XTZA 1WDTA 2LIPA 3DYBA 2CF6A 4B0OA 1LNWA 4PNPA 1PQPA 4NB5A 2JT1A 1LBEA 3EFHA 1NNUC 1OA1A 4G25A 3CMAI 3W6PA 4KE8A 4FFBA 1D2GA 3QX3A 4D0GA 3IMCA 4YRCA 2X0FA 4TT8A 4C7MA 4HHEA 1B74A 5KNDA 5GIPE 1H93A 2G7UA 5TPWB 4LYHA 2Y1EA 4W5NA 2CJWA 3V4LA 1DAIA 4D3XA 1BIFA 1VPEA 2C2YA 2JN6A 1L1RA 5HKBA 5K2MA 2ZKZA 4NUBA 5M5WJ 1X70A 4Z0PA 3IAS2 2A9JA 1SXGA 1YL7A 3JWEA 1LLCA 1YI8A 8MHTA 2AQKA 3A2MA 2O2YA 3V9AA 1NQ5A 4XKVA 2PMDA 2X9GA 5DV5A 2ONCA 4N1AA 4YCBA 1BMFA 1FF9A 2I7XA 3AG1H 3CEAA 4R3WA 4KIGA 1A5ZA 2VAWA 5JSZB 2C9MA 1RI3A 1VGQA 3O2PE 4JUDX 2NYXA 4V0NA 5FLXZ 1P80A 5HPYB 4PJMA 1DBWA 5ELLA 4YJFB 4EJTA 1A9RA 2ZMEA 1M8JA 1YJXA 3REQA 5FXMA 4RDIA 3LTEA 2W1OA 4DV0M 4BNJA 1FPMA 3TXAA 4F9FA 2DT6A 2M7AA 1WBDA 5DSTA 1PYOA 4EYSA 2PRZA 3BTVA 3D3WB 1U8CB 4WVLA 3JZDA 1QF6A 1NMXA 3HU3A 2SHKA 2X0LA 3QVVA 1EQUA 2Z98A 1EUQA 1T10A 4J0EA 4IBOA 4A5OA 5EMJA 3QKTA 4LF9M 3R0VA 3P0RA 4J2HA 2ZDHA 3WKDA 2Z9CA 3C2BA 1EB9A 4HMPA 3V55A 4GZMA 2XODA 4CL0A 4FGKA 3QHQA 1XPJA 4PSDA 3RIYA 3LT2A 4GVPA 3V1LA 3IPXA 5E6SB 4Q39A 2G9ZA 4LF4M 2MW8A 3B2QA 1C1KA 2JHAA 1PV1A 3OPXA 2PRKA 1NJSA 4DIFA 2HCRA 3KSXA 2IV3A 2GB4A 4LRTA 1I10A 1SOMA 1S3SA 5KX5B 3GELA 3QUAA 2HQSA 4B08A 2HSEA 1YS7A 3ZW9A 4TZTA 1ITZA 4PAGA 4I0BA 3N2ZB 2ZUEA 3PEUA 4E4YA 4AMYA 4FYXA 1SPXA 3QEJA 1WUHS 2PMKA 2OP1A 3RT9A 1QVWA 3MHPA 4NCXA 3X43A 2P0AA 1XMIA 4A6PA 2CWDA 1VLMA 5FRDA 1OWNA 2Q1UA 1X7YB 5DBOA 1L5NA 4WEQA 4BP8A 1O2DA 4FX4A 5LMUM 3L9WA 2WD7A 2IZ0A 3L2CA 2W2OA 2M5ZA 3LAPA 3GTOJ 3FDZB 3IAEA 3RTBA 3CUKA 2C84A 2ZYVX 2KZVA 3CR3C 3FGNA 4A91A 2PKXA 3HNPA 1TGVA 4DLUA 5FBWB 2JIZA 3I3SR 1XN1A 4KZKA 3NZEA 2HDOA 1M2JA 4A6XA 2VTDA 3PC7A 1G2HA 3GRVA 4B3SB 2KBFA 1ZMOA 5KNCD 1G1AA 3A9CA 2CW0F 4ZFNA 1H66A 4DM4A 4GI1A 1ETHA 2EJSA 3DEUA 4LOIA 1JEQA 1U9IC 3NJRA 5DNUA 1PKEA 3F47A 4NCIA 4BNDA 2XZTA 4DAEA 1W4ZA 3ZIAD 4G8BA 4PS0A 2PLNA 3I52A 2IYUA 1TF2A 3R7AA 1THGA 3WLIA 4D9BA 3HEAA 1M8PA 4HD8A 1R3UA 1FOXA 1TYZA 3VU1A 4YJHA 3WC4A 1E1KA 4QUBA 3T5DA 1Q11A 2EINH 2Y1LA 4GE3A 1ZVJA 4XE5A 1G4UR 1WJ7A 3ND5A 1S3FA 4JBYA 4PCZA 2V26A 4NOLA 4CLOB 1R2QA 1JB1A 4Y1RB 5A5GA 2E1PA 4FYYA 1NBWB 3BE6A 2DHQA 3ZU6A 3KJQA 4NBUA 3FNEA 4D45A 2BGRA 2MD0A 4NTZA 5E7IA 4U2GA 5B7QA 3NO4A 4GHWA 3C1OA 3OX1A 2J9RA 3IMGA 3PFNA 1SBNE 3BGVA 4YJHB 5BNGA 4QTXA 1NI3A 2VI5A 3PGXA 3UG6A 4LVOA 3GP3A 5DWQA 5I4CA 3OD5A 2DX7A 4RS8A 3IBTA 1ULBA 3QU5A 1VKHA 3TOBA 3DMFA 5EKXA 3W6OA 2EHDA 2B94A 4HBZA 2O2SA 2P7HA 3M4NA 4QVIA 2ZJ4A 5K3FA 1D1CA 5CMLA 3PJRA 4LITA 5CLSA 3EIXA 4D9FA 1CP3A 3RKWA 3TEFA 2EXXA 3L6CA 3M82A 5FOSA 1X38A 4U4AA 4C3OB 4EHIA 3QFCA 3AIOA 2JVHA 5KTKA 5MF6A 2F3PA 2IHZA 3RS5A 3H11A 1U1FA 2BZGA 1XP8A 5JNSA 3JYHA 3M89A 4JB8A 3UXMA 1TGYA 1I5OA 5GJVC 2Q9UA 1SHLA 2E55A 4IYJA 4EHKA 2PFKA 1QV9A 1ZD4A 2PMEA 2EFHB 4YWJA 3ZDYB 3VTAA 2JGRA 1ATIA 2AD1A 2LGJA 4LVCA 1NUTA 1O0CA 5IX8A 5C5IA 2BI7A 3GDOA 3A9WA 3S5JA 2Q6KA 5JAIA 3TR0A 4JELA 1ID8A 3NU1A 4NYMQ 5LVAA 1NN0A 2NAPA 4WWCA 4A26A 1KBZA 3H3VK 2IFTA 4X6YA 4BL0B 1LBIA 4ZC8A 2SNIE 3KS9A 1L5LA 3GQ3A 1SXJD 2ZLBA 3CF6E 3ZE1B 3HK2A 1U5TB 2Y1CA 4NYIQ 4TYQA 1XJCA 5LZ7A 3KKZA 1G8HA 1PUXA 2FG6C 2H54A 5ABPA 4EZBA 2QZZA 2DWCA 4XSZF 4ZTJA 1DIHA 3IE1A 3T0FA 5D84A 1DXQA 5KMGA 5K0TA 3KU1A 5GM2A 1WGXA 1YQEA 4NATA 3ZCRA 5JC1A 2IH5A 2CL6X 4Z3DA 2VAXA 3OYDA 4IIHA 3TEJA 4YRVA 5IH3A 3ZWYA 4Y9SA 3SS7X 4U6NA 3RF6A 4EA8A 4GG1A 3H17A 1ETYA 3A4IA 3DEZA 5HJ7A 4ZDLA 2NUAB 1TNSA 5HZGA 3T5PA 3G49A 3TTVA 4GH5A 1ZCFA 1VZ0A 4ZO9A 3FWKA 2ENWA 1NT4A 4B3MM 1O9BA 4IFIA 4V3CA 5AW3A 2TMYA 4DCGA 2Q3JA 4BKQA 1THZA 3JQGB 4CMEA 2O0LA 4R79A 2B4QA 4I36A 5CFNA 2J3KA 4YV1A 4HPJB 3R76A 3CZMA 4I5EA 1JUSA 2XWJI 1BC7C 2ME0A 1NVBA 2QD4A 4HK4A 2L54A 2TRTA 2XVMA 1QCDA 3RVNA 2OHXA 1NBAA 1IUKA 2F90A 1K75A 5K8CA 1MU0A 2HD4A 3U13A 2D5AA 2Z9BA 5EIFA 4E7KA 3W1EA 1K82A 3SX4A 2IEKA 4DRXA 3GF4A 2H6BA 1GYPA 2DSTA 3TYXA 1K97A 1YZKA 1JLKA 1HDCA 1QDTA 3MSCA 4DABA 2CW8A 4CDNA 1AE1A 4IHJF 2Q1TA 2Q2WA 3BKWA 4F2HA 1SC6A 3ZTWA 4LQDA 5TIIA 2PBLA 3I2YX 8CATA 1D0IA 2COUA 5E3LA 5DM6F 1X1SA 2PL9A 4OAPA 3M3HA 4ZHSA 4KH0A 4AIJA 4ZXFA 4RDCA 1MC1A 3FWHA 1QTIA 1S8AA 4US2R 2FPMA 2FQ4A 3NIGB 3P9XA 5DNDA 3SQWA 3MTBA 1U2QA 1Y8AA 1CUJA 2E1NA 3CVJA 4FK8A 2FUNB 1QF9A 5C5DA 1CJBA 4MYUA 4QFCA 4UZEA 1G8PA 3UAWA 1RQ2A 4ZDKA 3TR5A 1MBFA 2HMSA 1J59A 2AG5A 2HIMA 4BFVA 3PK0A 4IGFA 4X8HA 3GLHA 3M6AA 3I55I 3VNUA 3BMNB 3GEIA 2FVXA 1DL5A 3L0YA 5DU2A 1XRLA 3X1MA 1Z5GA 2C94A 1B9MA 4EO7A 2XVAA 2E21A 3L93A 3C3XA 4YUAA 3FSJX 4P0QB 4Y6PA 1JMVA 2HGCA 2V0GA 2X5KO 4ML3A 2WT8A 3EA5A 3Q9NA 3STTA 2ZSUA 1F60A 4DLKA 1A82A 1JGGA 5GZ3A 1DAPA 1JEYA 2R2GA 4NG5A 3ER6A 3C7CB 1S9DA 4IIJB 3QVSA 2ZZMA 3NT2A 1PEAA 4RMHA 4FIDA 3FRIA 1CR0A 1GTSA 2PKCA 4N6NA 1YUMA 3ECHA 3TWLA 3LNCA 4FFDA 1QIKA 2ZTUA 3WICA 5KQLA 4GAEA 4UHJA 4B7AA 2KXEA 3VH3A 1GSAA 3MVEA 3RK1A 3VTKA 4MV1A 1G38A 2WMNB 2B1IA 4IRUB 4CYCB 1XXHB 5AXCA 2HIGA 4X60A 3PR3A 1M6EX 2Q8NA 1DBVO 3LBNA 3N8DA 1NLZA 1NONA 4GMXA 4ZU1X 1V1MA 1R5NA 1I7SB 2DWNA 4JCCA 3Q0EA 1PR6A 3W4IA 5DM60 1WSDA 4OU0A 3EUEA 2B83A 4BO2A 5TRDA 4ZMRA 2WM3A 3UJDA 4OUDA 3BZKA 5EGOA 1KU6A 2LKDA 1D04A 2Q2QA 2NYUA 1Y89A 1HZZA 2A58A 2F3UA 1YFZA 5EHQA 4DA0A 1WHCA 5EQJB 1DEKA 1VL1A 2M32A 1Q7CA 3U1VA 3JQAA 3WHBA 2O1EA 2HSDA 5JVGF 5A3RA 1X7XB 4A3CJ 4JB2A 2PU5A 4TMYA 1GVNA 3SXUA 2P5VA 2JCXA 2DFIA 2PX5A 3EJWA 2Y1FA 4KR9A 3BIOA 4OGKA 3R3YA 1R71A 4X45A 3CC4I 2DQRA 1WTCA 5GM1A 1GY8A 2FEWB 3EAQA 3QMWA 2WA1A 2BR3A 4NONA 4FHCA 1XTIA 1H65A 3X1KA 2PYIA 3RJTA 1DDOA 1TE2A 5LA6F 3ZU2A 1WCYA 4D5GA 1CF2O 5G4KB 3DAOA 1UCFA 2STWA 4HNUA 4QQNA 3GAZA 2WV0A 3DBVO 4MW7A 4RTSA 2CWEA 1N2ZA 1Z4QA 1I4TD 4LSGA 3GG9A 1SKAA 1Z4IA 1S2NA 4TL8A 1T2KA 4H3HB 4PQYA 2ZWAA 2LR8A 1TECE 2GPAA 3MAJA 4PLGA 4EHDA 3LWZA 3OM0A 3G2OA 2COBA 1TOAA 5ADUS 4HUQA 3V42A 4GYJA 3HKEA 3EPRA 3B2NA 4AX4A 5F27A 3W5HA 3Q7TA 4V2IA 5BQ3A 3GUDA 2JC3A 1M1NB 3CXUA 3KQOA 3DEKA 4S1OA 1F0KA 5H02A 2JIPA 1SBZA 3QX7A 4PC3A 5FR1A 4M88A 1OPCA 1TQHA 4ZRMA 3ODGA 3F73A 4BMZA 4C6RA 1LRJA 4GWGA 2HZBA 2HYJA 3P94A 3TLJA 3BTCA 2I65A 2FZGA 2XPWA 3RIXA 5KYNA 3WGQA 5HIMA 4IHWA 4UEOA 4O4LA 3VDQA 2RGNC 4UJ3A 2C99A 3OPMA 3MPOA 5ALMA 2QSHX 2L7KA 3B53X 2R7LA 1PGJA 4EM2A 3A1UA 2HXGA 2L4MA 4HUJA 1CXZA 4U8HA 4XFDA 4Z8XA 1G8XA 1G6HA 2BZSA 4MCHA 1IU9A 4ZCIA 2GRAA 1QYDA 5FORA 4AKIA 3UJBA 2EJWA 2QMQA 4B3XA 2Z2ZA 5JS7A 4KX3A 2FUCA 3LCJA 2BP7B 2EW8A 4ILKA 4E0BA 2NTEA 3STWA 5D3QA 2YS9A 2VJAA 1T6XA 1AVTA 2OTLI 2R86A 4HTFA 4MR8B 5E3OA 5IPFA 2NZWA 1R5BA 4B4OA 4YQZA 1WKVA 5A4IS 4RE6A 1VB3A 2I62A 4XVHA 2YN0A 5LMCA 4XAQA 1IW7F 5LQNA 4EHNA 4G0PA 2VHTA 1ONNA 1KOJA 2UXNA 1IY1A 4BLVA 4ZN6A 2Q4BA 2BRUC 4PCLA 2O8VA 2JA2A 3BQMB 3QXSA 5JJCA 4AMUA 1XSDA 1L8OA 1JLHA 3AU9A 1D2EA 4KPFC 3E2IA 4LSZA 2PUCA 3RYCB 4A3LJ 1R6VA