3PUWA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 105
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puwA01
3CPFA 3VR4A 3ZDQA 3S14H 2PMDA 4X6AH 2JATA 4QC2A 4D6PA 5KPDA 1FUUA 5AUQA 1GUSA 821PA 1YHBA 4B32A 2WAQG 2YOHA 1RRFA 2GXUA 2I1QA 1S4QA 3TIFA 1J5EQ 3SDZA 2A5DA 3I5XA 1Z6AA 1QZHA 1A4RA 2J0VA 2PI2E 1XEWY 2REOA 4X8LA 5DLQC 1S9DA 1JJCB 2JLUA 3L43A 4IDHA 4US2R 4H0LC 5M3FH 2A1AA 4JI6L 5HE8A 3KKPA 3AKCA 4QJ3A 4YHHQ 4E5UA 4MKGA 2K75A 4H02A 2PT5A 1G16A 4Y0VA 4F7WA 4GN4B 5JS7A 4UPAA 3AKYA 3E1SA 2CE7A 4FMDF 3I2ZA 2CCKA 1KIMA 2O0HA 1T9HA 3CBQA 3IILA 2YC2C 4FMDB 5FR2A 2OXRA 3V9PA 2OZEA 3C7KA 1G17A 1UJ2A 4PQYA 4ARZA 1WMSA 4HLUC 1Z0FA 1HNZQ 1RJ9B 1JR6A 2YZ2A 1FQJA 1HV8A 1IN5A 4A8JB 3CNNA 2AKAB 1GHJA 5AJVB 3WYAA 1NE3A 3FOZA 4NYJR 2ZUCA 1A1VA 1M7BA 2JA6H 5C3EH 4P31A 2WSSA 1E9BA 1AK2A 3EC2A 2JA5H 2AFHE 2G6BA 4OQFA 3GFTA 4WBSA 3H86A 4ASUA 3T35A 2ZXUA 1E1RA 1ASZA 1N9WA 2HIVA 2IX1A 1QBKC 3P1JA 4OWWB 2BBSA 2GNOA 5DI9A 3TMKA 4PZ8A 2J87A 3AKDA 4W9MC 3DKVA 3SFZA 2H18A 2QM8A 1LY1A 3CPHA 1SR3A 3BZKA 3F3YA 4OK6A 4ZKEA 2Z4RA 3OZXA 1F60A 1C9OA 3UDFA 1AS2A 2Y0SE 1X3GA 2WHXA 4P73A 2H7VA 1IY2A 3VAAA 3CO5A 3FTQA 4B73A 2JDIA 1H9KA 1KY3A 1ZCBA 5EUQB 2I5LX 2ANCA 1JNYA 2J7PD 3CUEF 2O8FB 2QE7D 2VHQA 3ZVRA 1CSPA 2IS4A 2PZEA 2EU8A 2ZE5A 3HOWH 3IHWA 3LQRA 3L0IB 1VQCA 4A3JG 3KF8B 2WICA 4LUOA 4A93G 4B3GA 1PHJA 1ZMXA 3THWA 2H16A 2ZRGA 3QF7A 1NJGA 1E96A 2OV2A 2ZROA 4KFTA 4M0LA 4ZDIA 4DR4Q 3BRWD 1YNJC 3E9HA 2DWQA 2CL7X 4Q1AA 4OYHA 4GDFA 1HNWL 3CH4B 4Q00A 4OX9Q 1C9KA 4AH6A 1LW7A 3FPPA 3AF1A 3AEVA 2FH5B 2QQEA 3GEIA 2WWHA 4JI0L 1CRPA 1GVNB 3C8UA 1SMYC 3GCGA 1G8HA 4K46A 3RYTC 1SLJA 2OXCA 3K0XA 3VX4A 3K7UC 3LNNA 3EPKA 3C5HA 5FPKA 4A3IG 2VNUD 1YVCA 3W5JA 4CF7A 1CSQA 1GKIA 3EAQA 4Q1BA 1Z83A 2UXBL 2DFLA 4M53A 5E3HA 1CULC 4Y0AA 4DCSA 3K70B 2GXSA 3ONWA 1E2EA 2NOAA 2GVAA 4EPVA 2XAUA 3BWDD 3KDFB 2C77A 2CXXA 4DK1A 4D0GA 4HYYA 3T5GA 4EPWA 1GSIA 1NKSA 3KF6B 121PA 2J45A 1Q21A 1GUOA 4WJ3M 2QPAA 4GLAC 4D25A 4BBRH 1FX0A 4MYUA 3BH7A 3QSYA 2AN9A 1NMFA 4MDEA 1NBMD 1YR6A 1E69A 3O8BA 3EZ6A 5G3YA 4C0SA 1DXMA 5CITA 4QFMA 1VDZA 3ERSX 3ZS9A 1IBMQ 4JOIC 1YR7A 3KOJA 3EZ2A 4GOPB 3FMPB 3DO6A 1IL2A 2GF9A 1J6QA 3KJIA 3MXUA 4LF8L 2FN4A 2OFOA 3L0PA 2ZS8A 4A0GA 3LX8A 4IQZA 4KKSA 1VG9B 1ZAKA 2QAJA 4MGZR 3TBKA 5GADl 2Q6TA 2IT1A 1MKHA 1V5WA 2F6RA 4Q66C 4UXIA 2QF7A 4JSYA 4EKDA 2PLFA 3A8IE 2Z6KA 3J80c 4CGZA 1SE8A 2I1VB 1IOZA 3IBGA 1UFQA 3WP0A 4RCNA 4FMCF 1JXMA 2GZHA 4JCVE 2ZTDA 4XD7D 4DUZL 421PA 1ZM3A 4MKFA 1AN0A 1IXSB 3TW8B 1E98A 1GKUB 2HXSA 2A2ZA 3I8XA 3I7FA 5F3WB 3U4QA 3M3YH 3PIOA 3G71A 4K0KL 1Q90A 1X1SA 3B85A 3DKPA 3F8TA 4LYAA 3PQCA 1M7GA 2ZJ8A 5JFGA 1YEZA 3BG3A 1IY0A 1KI3A 2ZR0A 4G7HC 1QHXA 4TT3A 1Q22A 4C2UA 2RB4A 3A0JA 3LBIA 3B6EA 4A3IH 4H13C 1NY5A 4R4IA 2QGNA 5DI3A 3RS0A 4DRZA 2YU9H 2B29A 1PZNA 2GVBA 5AR1A 3B1ZA 4KVGA 1RRCA 4PTLA 1KO4A 4V0OA 3TSOA 4YQFA 2ZM6Q 1JEDA 5ELNA 4KMUC 2ZRNA 2Z6KC 1E99A 4OHXA 1ZM2A 3CIOA 1BVSA 3T5DA 1EWHA 5EE1A 5LMNW 1HNXQ 2ZRJA 2A68D 3QJYA 1KI1A 2G83A 2PQAB 3H3VI 1B8AA 4JI1Q 5BWMA 3R8CA 1H95A 1H9SB 4DV1Q 2A30A 4M8NE 4DNTB 3ZIAA 2NVQH 4LC1A 2ODNA 2FGJA 3HKZG 2GHIA 1DO2A 3Q7QA 3Q5DA 2PMKA 3I72A 1CKOA 5FI0B 2BH2A 2GILA 5C4XH 1HA3A 3HOXG 3AV0B 3OESA 1ZIOA 2ZUBA 5TY0A 5A4JA 2GWHA 3TZUA 1LS1A 3AKEA 4NYIR 4DV2L 2WB1G 4QGFA 4TLEA 2XB2A 4DR2L 2H5XA 4UP9A 2MSEB 1R2QA 4KFSA 3KX2A 2OFWA 4Q19A 1Z7TA 2ZJYA 4JZKA 4OQXA 5KDDA 2I3BA 4QHTA 5LD2B 2CK3A 5KSYA 1I2DA 4JI0Q 1I5FA 1G291 4A4IA 2UUCL 3H15A 3IIMA 1FP7A 3V4RA 3PGZA 2HLDD 1R8QA 2F7SA 1GUNA 2XTZA 3SU8A 3L2OB 1YR8A 2MO0A 2CCZA 4BZQA 3ZIAD 1KO8A 2PEZA 1TPZA 3ZS8A 4ZV4A 2VEDA 3KFXA 2CLSA 2X77A 3FHWA 4A3CG 1IBRA 3CW2A 1TWAH 4HI0E 2ZE8A 4KKTA 2PQAA 3UE0A 3ZVNA 1GITA 3EXAA 2IW3A 2Z0MA 2BV3A 1U5KA 1RJ9A 4R7ZA 4RG1A 2PEYA 1Q8KA 1VQ7A 5K36H 4DKAC 1M34E 3DXJC 2RGGA 1T8TA 2ZJBA 3GJ8A 4GP6A 4F4IA 3F5FA 5M5XH 8OHMA 4DK6C 5M5YH 3QE0A 4DR5Q 4FDBA 4P3YA 3RRNA 5FTJA 4BUJA 3DM5A 1GIAA 4OX9L 1COWD 1NMZA 2AKYA 5K8LA 2VP6A 3AQQA 1R9TH 3P4XA 5KNBA 3RLNA 3WYGA 4ME3A 4BASA 4Z51A 5JEDA 1CBUA 3HU2A 1CRQA 1R0WA 4NH0A 1FPMA 3AFQA 4OONA 1SHKA 1TL7C 2REBA 4L9WA 4LJ5A 3GFOA 5E7MA 3TK1A 4YWLA 1VKJA 2BIFA 3VKGA 4B3SL 1I4TD 1RFLA 4HJAA 3FMIA 3NH6A 1JECA 2FFBA 1DGSA 1G8FA 1XX6A 1VQKA 2ZR7A 4XWOA 1D8TA 5EP4A 3FGNA 2WWXA 2F43B 5A5GA 2B8WA 4LRWA 2EFDB 2WWIA 5AJXA 1HE1C 1NVXQ 3TQFA 2IS2A 1OXXK 4AIIA 4O0AA 1P60A 5KPJA 5CYOA 3R7WA 2NN6H 4GZYC 3SJBA 3W6NA 2D74A 3NC1C 3O8DA 1XD8A 4B3SQ 3I4MG 1W44A 1VG8A 1XF9A 2NGRA 4I99A 4PHTA 5BN3A 4II7A 2C95A 4Z54A 5EP3A 4KLNA 4IDPA 4XOIA 3SJAA 2RGBA 1S40A 3GFPA 5IYBG 2RHSB 2QMEA 3HYRA 5HTKA 4B3MQ 4HUQA 3U58A 1PH3A 4NTZA 3T15A 4HDQB 4BLRA 4C7OB 3EPJA 1WB9A 1E2IA 1YJNA 3ADCA 2KHJA 4AYXA 1A2KC 4TL6A 2Q0HA 3KKMA 1ZKOA 1NN0A 2NZ8A 3QG5A 5TMPA 1I94Q 1VYTA 4DVGA 1QHYA 1BS1A 3KLWA 1E2ZA 4LJ8A 5GAGC 1E24A 4JK1C 1JT8A 1UEIA 4BBSH 2JCSA 2PX3A 1VQ4A 4L5BA 3WNCA 2GEUA 2V8OA 1HJPA 3K0SA 1US8B 2IYYA 1YZGA 4QL3A 1H9RA 4MYCA 2JLSA 1G5RA 1JPNA 3A1WA 2IHFA 4AYBG 2VL6A 3UDGA 1S3GA 2ZAMA 3AP2A 3BH6A 1BMFD 1GL6A 3GJ7A 3GLHB 3C5CA 1LTLA 1E1RD 1MV5A 3DHWC 3R9IA 4EJSA 1CLUA 2C9CA 1OXTA 2ZSBA 4HB2A 2OBMA 1TUEA 5G41A 4D4LA 1Q1EA 5M04A 1N6NA 4PPGA 1P62B 4NCJA 4CEHA 1EQQA 4E09A 1EWQA 2QPTA 3T61A 4P4SB 4MTNA 1Q81C 4URZR 5DN6D 3ZH9B 1KYIA 4LJ9A 1E9EA 3SC3A 2KI5A 2GJ9A 3G5UA 5DGXA 1G1MA 4C0LA 3OIYA 3CCRA 5LB4A 1YE8A 2B8FA 2AUKA 3RLOA 1NN5A 3AUYA 3B82A 2XNSA 1N8RC 3HOVH 1C1YA 2FF7A 2QY9A 4KYIB 4PO9A 1IN4A 1WI5A 4FCWA 1HNZL 4KHZA 4ESHA 1G7SA 4FMCB 1QHSA 1E4VA 1E6CA 2JGNA 3VNUA 4HIDA 2EFEB 4QKQA 3WHLA 4RD3A 3B9QA 3HPQA 4I7ZC 3AM1A 2F3IA 3GDEA 3QVUA 1W4BA 3CR7A 5LMNL 2OLKA 2WJYA 3THXB 4AI6A 1UEJA 4Q02A 5JCPA 3U7FB 3GTOH 1KO5A 2OAQ1 1N5IA 2FXQA 2QA4A 1DADA 4LUVA 3GTMH 4FD2A 1ETUA 2CQOA 1HTPA 3F2BA 2NO6A 1HEIA 4LYFA 4URYR 1RIPA 5B57C 4KN7C 2ZJQA 2EYQA 2ZSDA 3CPWA 4MUBA 4PHFA 1VCNA 1E9AA 3VMFA 2V6JA 2YTYA 3T53B 1ZC4A 4XWAA 4EQ6A 5B58C 2P2LA 2W0MA 2ZU6A 1L8QA 2DWPA 4MRPA 4Q9IA 5LB2A 4DR6Q 4JOIA 2PZGA 2OCEA 4DR2Q 3FHOA 3KYHC 1LV7A 4Y7NH 1L7VC 4JI5Q 1R7RA 2X19A 3AVOA 5DHFA 5C4XG 4P72A 1J70A 2ZRCA 4Z1MD 3IPYA 1EFHA 1FX0B 1NVVR 4DSNA 4TWZA 3T1YL 1HTWA 2Q2HA 2BKUA 2GJ8A 3B1YA 4JLVA 4XVRA 5CIWA 3RRYA 4EFMA 2GA8A 2IX3A 3I4OA 4LUCA 4G5SA 4XIGS 3K70D 3CP0A 1EESA 4D0NA 1NBWA 4DR6L 2IYRA 4JJKA 4A3LH 2C9YA 1CP2A 4DSOA 5JSZB 4JV5Q 1Y1WH 1D5CA 1K9MC 4IOAA 5F9HA 2JDID 1E2DA 3NXSA 1II9A 1KI2A 2AHOB 2CHGA 1EFRA 3CF6R 3Q3JB 4IDOA 2OFXA 3RS5A 3GO5A 4IPHA 3T1YQ 1ZIPA 4DCVA 5IRCD 4C0BA 1YU9A 1DS6A 3MEFA 2RKOA 4URXR 2A69C 1ZNXA 1JPJA 1K5DA 3AVQA 4NE2A 4W7SA 3H0GH 1RKBA 4BA2I 5ELOA 1U8ZA 1GVPA 2R6CA 2WSMA 1Y3AA 1SULA 3F1ZA 3AEZA 2HCJB 3AVPA 3C4JA 4O25A 4RZUA 2UXBQ 4B34A 1IW7D 1BKDR 5EE5B 4YXWD 4XJXA 1UM8A 2FE4A 1OYWA 6Q21A 1NP6A 4LJ7A 1S72A 1RRPA 2BBTA 2OE2A 4P4SA 4P32A 2B6HA 1Y63A 2B7BA 3QKRB 4YMVA 2JA6G 3RSOA 3T12A 3PUYA 3SGIA 2JA1A 1NTGA 1JEEA 1R10A 4A0FA 3AVUA 4CDGA 3B1WA 1EFUA 4KO8A 2AL7A 2OLJA 3WMEA 1XXHE 1KAWA 2JLZA 4AKGA 2ZITA 4TN1A 2IYWA 4OO1I 2QM7A 3IO5A 3E9IA 4L5RC 1HURA 3ZQ6A 3ZZ0A 2XGJA 2ZRDA 4A0HA 1VMAA 3B1VA 3AGPA 1VQDA 3NELA 3ECCA 3Q8XB 4DLYA 2ES2A 3BDOA 1CJMA 2JLRA 3PO2H 1PLLA 1HT1E 4FCVA 2AD1A 4LWZA 2OCBA 4JLNA 4B6FA 1DAHA 4JYAQ 2GJKA 2OAP1 1AM4D 2FZLA 4PSAA 5FUXA 3PXGA 1D2MA 2DHRA 5JHHB 1KO7A 2YWEA 2OUKA 3M4QA 2QTVB 4YDHB 4J15A 2EVBA 4DB4A 1V43A 1SRUA 1UDWA 4U00A 3A6PC 3KDFA 4HAXA 5AUOB 3GTQH 3W5OA 4BZXA 1A5TA 1H9MA 3B5JA 1RPZA 3W9YA 1M2OB 1SZPA 1VHLA 2RGDA 2LXJA 4PPQA 1N5LA 2PT7A 1Z0DA 1B23P 5AJWA 2V1XA 5LMUL 2QRZA 3DPUA 4OHZA 2IWRA 2NO1A 2Z83A 4ILEA 3IEVA 5H68A 3RC8A 4U5XA 1T5LA 4DV3Q 5FBQB 2I5HA 1COWA 4K0KQ 4WZAE 5C0XJ 2QE7A 2QORA 4G5RA 1GFIA 3K8AA 1E2HA 4M9SA 4C0HA 2JJQA 4L5TA 4JI4Q 1N6PA 1Q3TA 2HUPA 3BB4A 4NZYA 3IO3A 1EYGA 1KAGA 3JAMi 2DGYA 1EWIA 1E1QD 4RFVA 5CDFE 4OXPA 4IVPA 1AS0A 2OQ0A 3KXKA 2RGCA 3LLUA 2VHTA 3K7AH 1G3MA 4DV3L 4EIWA 1Z63A 1PV4A 3HOYH 1XD9A 2Q3MA 2Q9CA 4L15A 3TSWA 4EPRA 4I1OA 2Q3HA 1EQRA 2UVQA 2UUBQ 1TUIA 2ZVQX 1CS4C 4C0JA 4W5JA 2O8DA 3GTPH 4DXAA 1QHNA 4M4SA 4D81A 4YWKA 4LGMA 3BU2A 3MWLA 2AWNA 2Q2TA 1OHHD 4JL6A 4PAMA 3CLVA 4TMKA 2C5LA 1E2NA 1K5GA 2WJIA 2RHQB 3LQQA 5HY6A 3KQHA 5FLMH 4WAUA 2R93H 5JMTA 2F1RA 1G3IA 2QENA 4JLKA 3S24A 4A8JC 1F2UB 2L15A 1R8SA 2EWVA 3RNLA 1TMKA 1U0JA 4HJ9A 4JL8A 5IYBH 4JBKA 1EFRD 4HR7B 3M7NA 5IE8A 4DR3Q 1CKNA 1E2WA 3CRW1 2Q9BA 3QKRA 3VTKA 4R4TA 4FI3C 5IWAL 1XNJA 2HHHL 3TVDA 3AYHB 5GROA 4DCTA 2ZJPA 2YWFA 3GJ3A 1H8HA 4L9SA 1ZRHA 4TMZA 4ERNA 4LBWA 1XMOL 4ACAA 3O8RA 3VKHA 4JV5L 4QY7A 3GLHE 4IW3B 2E5LL 1AZTA 1ZU4A 1X1RA 2VIIA 2JJ2D 3EIEA 4BLTA 4MKHA 2V4DA 4B3TQ 3MSXA 5IYCH 5L3RA 1A0IA 1T8UA 5FUVA 4EFLA 2BJWA 3A1TA 2FJUA 1DPFA 1E3PA 3REGA 4DT1A 5AWFC 4ESVA 2A6ED 1U0LA 4JLBA 4DB2A 2AFIE 4KLKA 3U61B 1LUZA 3NEMA 1M74A 5FPSA 2W2VA 1N6HA 2ZI9A 4IRUB 4EX5A 2DYKA 4JIMA 4F4JA 1XTDA 2ZUDA 3QOFA 2HV8A 2ZS9A 4TT3D 1G21E 2XJ9A 4R71A 5EZ6B 3OOCA 2NTYC 1XD2A 5JHGB 4A92A 3KXLA 1BH2A 5C2JB 2ZI3A 3VX3A 3U3RA 4JI7Q 3U3MA 2GXQA 4L5SA 3JZMA 4Q03A 1LYLA 4V0MA 1OFTA 1P3JA 2RH5A 4A3BG 1SXJB 2YYZA 2BBOA 2P5SA 2RHDA 4XVUA 3EBEA 3KFUA 1VQEA 3I4NG 1VQBA 1SVKA 2QP9X 1UDXA 3N5CA 1W4RA 2BKEA 4R9UC 3I4NH 2WMNB 2BDTA 2IYSA 1XNQQ 4JYAL 3OEEA 5KYKA 1VIAA 1HUQA 1KJYA 2O5JC 1NLFA 3KB1A 4B71A 1Y8OB 1W4AA 2HIXA 3CCEA 1VQAA 1HR0L 2FA9A 2QZ4A 4R2IA 5DO9A 5GJWC 4CEJB 2FFHA 2HYDA 3U60B 5J5CA 2W83A 4FXPA 2J1LA 3W8RA 4G7ZC 1X8JA 2JXMB 2F1IA 2FSIA 1FTSA 1T0HB 3HOVG 3CF2A 3K53A 1SKYE 4HLDA 2Z4SA 3GTKH 1UE6A 3HOXH 1OLOA 1YNNC 1TNDA 4FCTA 4IOKA 3D0FA 2DWOA 4DV4L 1Z6TA 4PPFA 4WXRA 4G5QA 4BBSG 1MO4A 3Q85A 4TL9A 2ZYWX 1M90C 4TSFD 1OV4A 2NVXH 4WXPA 2OTJA 4ZCMA 3U4ZA 4PC1A 1E2PA 1YKSA 3BFKA 4N3NA 4TYQA 4OHYA 1HZCA 2VSFA 4DLZA 2ATXA 3LNCA 3JZAA 3A5UA 2JK8A 2VL7A 1QZGA 1XPUA 4URVR 5EE9A 2PLRA 2K7VA 4TYNA 2E75C 5CM8B 3A7AB 1IW7C 3MJRA 4JS0A 3FYHA 1IXZA 1Q82C 1OIWA 1PH8A 1P73A 4KHPL 4PC7A 4N0DA 4Z8XA 2BOVA 3I4MH 4C0AC 3U6BA 1TF5A 2OQKA 2EW1A 2IYQA 4PSVA 1VTKA 5AUNB 4DK3C 1NJIC 3Q8DA 2ZSAA 1XMIA 1IQPA 2QAGB 1AQYA 2JIZD 4TTPA 3A7LA 1T5IA 1IZ6A 3JVVA 2CEAA 3S2DH 2W2TA 5IP9H 1G18A 1SXJD 3CCJA 4KHPQ 4A2PA 4A0RA 1KJWA 1YVDA 2X2EA 2WJVA 1X65A 1XNRQ 2RGAA 2KBNA 1KGDA 2XTIA 4LPSA 4ZDWA 4QXAA 4GL2A 5EZ5A 4LF9L 1E2MA 1U98A 4HATA 3G4SA 4JI4L 1M6NA 2GETA 4IOJA 2VYFA 4C3ZA 1G5TA 4A3DG 1NLZA 2CJWA 3T1QA 1KKLA 2QROA 4DR3L 1Z08A 4GLVB 3DL0A 4I1SA 2ZJOA 5KSPA 4RD2A 1NMGA 3OFND 1KI7A 1N2CE 2FV8A 2EFCB 3FKSD 2KBFA 4H44C 3PO3H 4IOMA 3EIQA 1TWGH 2EJFC 3HOYG 3CRKC 2ZRFA 3NBXX 3TNFA 3OE7A 2FU5C 2ZI5A 3EPLA 4A3MH 1I3QH 4LF5L 1MO6A 1R0XA 1UBGA 4AYTA 1W2GA 1E22A 4XTCS 4DDVA 2YOFA 1KSHA 1N34Q 1RVDA 3IQXA 3K0CA 1HH4A 2PJZA 2ZSEA 4IOCA 4Q48A 4A2QA 2CBZA 2JIZA 5LMNQ 2QA5A 4JI6Q 3FMFA 2ZU0C 4Q5IA 3PSIA 3S17H 1FYCA 2IYZA 3CONA 3THWB 4CIDA 2F43A 2R7ZG 4PQRA 2HT1A 4BRWA 2Q9AA 4JI8Q 1JI0A 4CEIB 1Z28A 2JLVA 4LWCA 1YJWA 3K0FB 2O52A 2OCAA 4NYMR 1PFSA 5EXSA 2OCYC 5JRZA 4HAUA 2AXNA 4NXNL 1YIJA 1IBLL 5BXQC 2V7QA 2J7KA 5DISB 4BBRG 4DR7Q 3DZ8A 4FMBB 4D4MA 4Q9LA 2QQ0A 3HOUG 2VQFL 1KNXA 4JI3L 1ZD1A 1PH4A 2F3RA 2GZDA 2WMOB 1CJTC 2HHHQ 1F2TB 2BA0A 3O8CA 3GLIB 2GVDC 2CJWB 1MRNA 1Z29A 2LMCB 1U9IC 2PH1A 2DCUA 2KCTA 1FNNA 5LD2C 4LFAQ 4DLRA 3SYLA 3UWOA 3BAFA 1W49A 4JBJA 4X62L 3RS2A 5J47A 1UADA 3AVWA 2JA9A 3T34A 5C18A 2FX3A 5FBRB 3OEHA 3WNDA 1L2FA 2ZI7A 4X65L 3B8HA 2HEIA 4M1KA 3CCVA 4A3MG 2FPKA 3CCLA 4HLQB 5KUTA 2J0QA 1TKWB 5BW8A 1XMQQ 4R4QA 3G0HA 1YJ9A 3B1XA 4UY8C 1E2VA 1XEXB 4IPDA 4ZCIA 2AX4A 3CRLC 4TZ0A 1HQCA 5JEAG 1V9PA 2ZRHA 2VQSA 4NONA 3BFVA 3GJ5A 3TRFA 4LK1C 1OXVA 1OH7A 4R1JA 2YOGA 4IVQA 2R7DA 3DMDA 4BECA 4PMWA 2AD5A 3KLRA 2R8RA 5J3BA 1O87A 5EXXA 2GCOB 4A3JH 4MYTA 4JYBA 2V55B 4YMWA 2IBMA 1U8YA 1XTSA 2N46A 3MXNB 2O5IC 3VNVA 3NIBA 4MGKR 4GZMA 2OEPA 1X3FA 2QEXA 2RGXA 1CXZA 3NG1A 3QEOA 4IEEA 5J4KA 3B6YA 2MFIA 1G41A 3NEYA 3KUDA 3I4LA 1XNQL 4URWR 3HGBA 5H70A 3AVVA 1U81A 2GXAA 2F1HA 3BS4A 2NO7A 4LW1A 1OXSC 1RYHA 3W3ZB 3NHAA 4B3XA 2BEKA 1M8PA 2CDNA 3FWYA 2BDOA 4A3LG 1E2JA 1KKMA 4C30A 2BMEA 2K5VA 3K80C 4AIMA 3MMPA 5JWRA 3K9NA 1EX6A 2R6GA 2VP0A 3JVUA 1IBKQ 1ZD8A 3IKJA 3CNLA 4HB0A 2HF8A 4IO9A 5D3QA 5EE3A 3VR5A 4M1SA 4JI2L 1G7RA 1WP9A 3TEHB 3PIPA 1R6BX 4NXMQ 3SYKA 3VDYA 1B70B 1HY3A 3RWOA 1IJEA 1JB1A 3QKTA 1GKYA 4Q1DA 4AG5A 3R8FA 3M4YA 3A8KE 2FEMA 3FKIH 4QQBX 1VQ5A 2CFMA 3BD9A 4LNQA 4GP7A 1NMXA 3NH9A 4A4DA 4CEHB 1C0AA 4JI2Q 1FL9A 2CCJA 2V54A 3BH0A 1UBCA 1CR2A 1VYVA 2YKGA 1KXLA 1L0WA 4EAQA 5HGQA 5C0XI 2R62A 3STBC 2UKDA 1XTQA 2B92A 4LPKA 4MZ9A 2ZT9C 4TTRA 1KQSA 3MWYW 4L16A 4C2TA 4X66Q 1Y14B 1HPCA 3E0EA 2KWIA 2ERYA 2D2CC 2ORIA 4UP8A 4Y52H 3RS7A 4HDCA 3JC66 2KB0A 2ZI6A 2AWOA 3RR5A 3DLLA 1PA6A 4MNOA 3S1AA 1Y8PB 2I5MX 4LFCQ 1DAFA 1OHHA 221PA 4JKIA 3SNHA 1TQ2A 4BFWA 1Y8NB 2XJ4A 4IXMA 4DLWA 4BFSA 3EW9A 2ATVA 4NDZA 5BQ5A 5LDDC 4A3BH 3CPJB 1Y69U 2R92H 1TEVA 3GLGB 4RD6A 4Q4HA 2B63H 1NN3A 2TMKA 1T4GA 3TW4A 3UE1A 2AR7A 5P21A 3OHMA 4AKEA 3RABA 4MDFA 3UDIA 4DUZQ 2O8EB 2O5VA 4IDQA 2QN6A 1KMHB 1SKYB 1XZQA 3P32A 2QP4A 3K09A 4A3DH 1OFUX 2VP4A 5IK2D 5SZJA 2WKRA 2GEVA 1NIJA 4ZDKA 4S35A 3WRYC 1OH6A 4DR7L 3IIKA 2NMVA 3RZDH 2UXCQ 3AF0A 4DNIA 1GUAA 1P5ZB 1ZYUA 3CZQA 3TE6A 4BZPA 4DKXA 4QM7A 1OB2A 2W6JD 4DUYQ 4QGHA 5FR1A 2WJHA 3CMAA 2J5XA 4A76A 2UXDL 3DVLA 3H2YA 3KKNA 3ZQJA 3PVSA 1O7IA 5HZHA 4AWXA 5DE3A 4KBGA 5G3ZA 3FB4A 1S2MA 4A8JA 1HQMC 3X1XA 4E07A 3S1RH 2UXCL 1RZ3A 3K09C 1XD2B 4BFVA 1CKMA 1P61B 4TYPA 3ZZUA 1Q1BA 1K73C 4GNKA 3U5ZB 4Q4LA 1JR3E 4JLMA 5DLQE 3UANA 3TRZA 1J2JA 1MOZA 3TJZA 1IN7A 4X8OA 1W1WA 1ZD9A 3PG5A 3LDAA 1XMQL 2A69D 2QAGA 3U9SA 4BXXG 4JI1L 2D4HA 3N2IA 2ZTCA 4O0MA 4Q01A 4Q4AA 3SQWA 5GVRA 4MQBA 4BA1I 1PLJA 3BIFA 4EPXA 4YCUA 2WVJA 1CEEA 4KVAA 2F52A 1LABA 4HZUB 1G9XA 5CK5A 4AURA 1SROA 3HFZB 1KTVA 2BE5D 1W2BA 3M4OH 1KDTA 2IUTA 1JAIA 2QEQA 1SN8A 2R9VA 3H4MA 4FIDA 4S2EA 1GO3E 3WYFA 4G01B 3L0SA 5KOYA 1NVWQ 1PLKA 1P9NA 4HAVA 3F2CA 1NKTA 4BQSA 2XTNA 3X1WA 2XZLA 3VR6A 3EA0A 4K81B 5HR5A 4X65Q 3W3AA 3CMEA 3J7A5 3ADKA 3CM0A 4HZIA 4BLPA 2MSCB 2ZEJA 2V9PA 4RFSB 5GQOA 3HKZE 1VIYA 1NL3A 4B3RQ 3FKQA 1DEKA 2C2HA 2VSOA 4I4LA 5FH9A 2VHCA 3UG6A 1N6OA 3EX7C 5FOUA 1XRJA 1VHTA 3KQNA 4DR4L 4OO1H 1OFHA 5JRJA 3KJHA 4GNXA 5FTNA 3H3VH 4MRRA 4GPTA 1E79A 3FFBA 3TH5A 1P2TA 5F9FA 4PAQA 1PH5A 1EUJA 2E76C 2JEBI 4UJ5A 1DG1G 1KI8A 3DEFA 1FFHA 2W6IA 4PC2A 1UAAA 1II8B 2FDCA 2DB3A 5DHAA 1G51A 1WOCA 2RGEA 3PF4A 1PH7A 1RIFA 1X3SA 4FINA 1E2QA 3ASYA 2PJRA 4JC0A 1UKVY 1UKEA 2MMCA 1UKZA 3R9XA 2BMFA 5D3MB 3A8TA 5SZHB 1P8LA 4PC3A 4UJ3A 3KB2A 4M2LA 1Z22A 4DEXA 3A58B 4ZKDA 1JR3D 2EJGC 4A3CH 1TU2B 4MKIA 1Q1ZA 2B21A 1LB1B 2OWOA 1GRNA 2IY5B 1GNPA 4QBIA 3RRMA 3A74A 1WFQA 1CJUC 2C9OA 2HF9A 4ITRC 4E22A 4F92B 4M21A 4DC9A 2IF0A 2YWHA 3C16C 3HOZG 1ANKA 3NBHB 4TTQA 4BEBA 3LW8A 3REFA 3B2EA 2QGZA 1HZAA 3SBEA 3D4RA 4WW0A 1Z0IA 3LY5A 4AYWA 1FR3A 1TX4B 1YZNA 2D0PA 2H17A 1X3EA 4G3XA 2LSSA 2XNDD 5CJ2A 1Z6HA 4DAMA 4DK0A 4LF6Q 4F93B 4YMUA 3I32A 5KTYA 2ZRKA 2OESA 3GTLH 5M3MH 2W6ID 3FDIA 5LBIA 1XEFA 3CC4A 2WKQA 2ZRMA 1CJVC 1SVSA 3P27A 4V0ME 4XSHA 4KITB 3AVTA 3EG5A 3ADDA 2D7CA 3I8SA 3N6RA 1G6PA 2GVZC 2K5UA 3EZ9A 4LJ6A 3J81k 4MRSA 3HDTA 4TLAA 1G64A 3QUSA 3UPUA 1OJLA 5J4LA 1H8HD 4QJ4A 5A0FA 4POFA 4LF4Q 3KTAB 1XEWX 1J7KA 4DUYL 3K8YA 3Q5EA 3VR3A 1EFTA 4DDTA 3CC7A 4LF9Q 3I55A 2BEJA 4OHVA 1M7HA 1AH9A 3KKQA 4ZI3A 1M1KC 2Z0SA 1Z6YA 2BM0A 3K0FA 1J5EL 1IN6A 2JA8G 3K1JA 2NVTH 1E0SA 3UKDA 2Q21A 5KDOA 1KL9A 2GK6A 5IT5A 2JQOA 5EAYA 1E9SA 2BMDA 1II0A 2P6NA 1VYUA 1VG0B 2B63G 4EQ6B 2NO0A 2VS1A 1F2UA 1EG7A 2PNRC 5TXGA 3KQLA 1W3SA 1GL9B 2EJMA 3KUCA 1TTTA 3IBYA 4GOPA 1BYUA 1G8YA 4D80A 4IFDH 4NPSA 3OIWA 2NO9A 3NBYC 4QJ5A 5JWHA 4HEJA 3RLFA 4DCNA 3IDQA 4TKOB 1X8KA 4PFSA 1XMVA 1MH1A 4X8HA 5IY0A 2REXB 4LFBQ 3K9LA 3PEUA 1GWNA 5FI1B 1S8FA 5KSOA 5B64A 2QP3A 5GAHC 2BWJA 2A6EC 2P67A 2WWGA 4QBFA 3M85A 1KRSA 2VBCA 2YWGA 5L3SB 3S1QH 2VY3A 1Z0AA 3PEVA 3TR0A 1NLYA 2IYLD 1WF3A 1ODFA 3LA6A 1VQPA 4LZZA 4CZ2A 4LYJA 2ALYB 2VLIA 3TLXA 2WJGA 3MGCA 4NXNQ 4ON9A 1JJVA 2A5FA 1KK3A 3HKSA 3J81i 3QENA 1K8RA 1DARA 3LWNA 4JT2A 2VQFQ 4LFBL 1IHUA 1LTQA 1QVAA 2NVYH 5TVKA 5JS8A 5JZVA 2Z43A 4J0QA 1OB5A 2C03A 4DV0L 3PF5A 3DZDA 1K8OA 2WOJA 1H9JA 1U90A 1QDEA 1G8GA 1ZUIA 2EFGA 2E1RA 3BK7A 4N0EA 5TV2A 5E4FA 3CRMA 1JJ7A 4DIDA 2ZYUX 3LVRE 5DI3B 1F5NA 1NBME 3K81C 2Q2IA 2VP9A 1BBUA 1P6XA 4OWXB 3BGWA 3S15H 3ZJYA 2X1VA 1PUJA 3I3SR 1MT0A 2AK3A 3A5ZB 4PG3A 2IHEA 3UK6A 1HNXL 2WWYA 1EXMA 1OH5A 3C15C 3CX8A 1JAHA 4KKUA 3KKOA 1W46A 2R6DA 4BPBA 1US8A 5FJ8G 3G48A 4GKKQ 3NDPA 4XWKA 2H92A 3BE4A 1CIPA 2F1JA 1KSGA 3T1VA 4JI5L 4LHVA 4YDSA 1KAOA 2BVNA 2G88A 3S2HH 4A1FA 4Q9JA 4DR1Q 1G7TA 3C41J 4PZ7A 1AKEA 2FSFA 2VH5R 2ODBA 1B9NA 3KQUA 1YBYA 3U44B 2NPIA 2O8BA 2A5GA 2G77B 3HR8A 1WCMH 1SFOH 1BKBA 1A7JA 1J99A 3OW2A 3RZOH 3HOWG 2ZRLA 3GD7A 4DV2Q 1QVRA 4B76A 1YRAA 1VQ8A 3GLFE 4BGDA 3GQBA 2IK8A 1D9XA 3SN6A 4B43A 1TQ6A 2W2XA 3HJNA 4GBMA 1V1QA 1CJKC 2HLDA 1YZTA 4B3CA 3IPXA 3G82C 1Y1VG 3M9BA 1PH1A 2ZRIA 1DD2A 1C4OA 4Q1EA 4YXWA 1HH2P 1FMJA 1RRGA 2RHMA 5GVSA 1W36D 2EFHB 4OWTB 3AP1A 3NEJA 4PHGA 4RVCA 2B8TA 1TEXA 4GMDA 1KD1C 1PH6A 1OTCA 1I6HH 1HT2E 4R98A 3UXMA 1PYSB 4B74A 1E0AA 1HZ9A 4NCNA 2NQ2C 2LKDA 3CCSA 4DCUA 1OE0A 4EFNA 5BR8Q 5KDLA 1NY6A 4JMPA 1XCPA 4UNNA 3SHWA 3Q7PA 1T3LA 2GCNA 4Q4JA 1T0JB 2O8CB 1Z8FA 4V0KA 3CCMA 3EC1A 4MYHA 5FTLA 1IBML 4JBMA 2ZIAA 4DLUA 4TYYA 2G3YA 4Q47A 5L3SA 1Z5ZA 4R4OA 4AC9A 4B33A 4G0NA 4KU4A 2IEYA 3QKUA 5BR8L 3HOUH 1KK0A 3WXMA 2G0TA 3T1HQ 1QRAA 1ZP6A 3NBFA 4BY1H 3AUXA 2CVHA 1GAJA 5CYPA 3MG9A 3HU3A 4X66L 3VKWA 4LF6L 4DDUA 1GJXA 2WB1E 3QKSA 3SFVA 4L4UA 1E7ZA 1KZ7B 4G5GA 4L8JA 5JLJA 2GAOA 2QU8A 4H1VA 2E2JH 4WA7A 2IUUA 5G53C 4DSTA 2A68C 1KSFX 3WY9A 4JSTA 2VTKA 3AVYA 3WWVA 3BXZA 4V03A 3CAMA 4U02A 3X1ZA 4IJMA 4NYMQ 5FPHA 2GTPA 3TAHA 1TADA 2IYTA 1XEXA 2WAYA 5EXPA 1GTVA 4P74A 2IC5A 2PPBC 1Q3HA 3PITA 4NPHA 3WRXC 5F98A 3MWJA 4TQAA 4WOPA 1Q20A 3TAUA 4OQLA 1IONA 2C98A 2G1JA 4GNXB 5SZIA 3AP3A 2C96A 2IEZA 3KF6A 1P72A 1NG1A 1TWFH 2FPLA 3AQ4A 3PIRA 1MJEA 1H8ED 3I62A 4KN4C 3MUFA 1E2FA 4F91B 4A3GH 1HE8B 4IEIA 3DDCA 3VU9A 1WYDA 1TF7A 2FWRA 3IEUA 4C0KA 3PEYA 2UXDQ 1YZQA 3QNUA 4R2HA 1VQIA 4NKRA 5FL7D 4B75A 2Y8EA 1UE7A 3TUZC 4IFDG 3TREA 5EJEA 4A36A 1OIXA 3MJHA 3JAMc 4NCHA 1G4AE 4IJHA 1E4YA 1FTNA 4CRWB 3LFUA 3DOFA 4KCGA 4QHYA 2UUAL 3KJOA 4EDHA 3D31A 3OEHD 4QG7A 4P4TA 3WBJA 4DLXA 2XGTA 4HZUA 2XTMA 3OIVA 4CVNA 5FOTA 2JJ8A 1SVIA 2QNRA 1QHHA 3BC1A 4JLDA 4EJSB 1XMSA 1ONLA 2W0SA 2YC4C 1E2LA 1NVVQ 3UATA 3KXIA 1S1MA 3OTOL 3QF4B 1S96A 3SBDA 3W6PA 1NBMA 3WMFA 4B44A 2QMOA 1EOVA 1EGAA 2UUAQ 1VECA 2QAGC 4QNMA 2LCFA 3EPHA 3LX5A 1Q1QA 1N6RA 2ZRPA 3RSLA 3W5IA 1QUQA 5JEEA 4LJ4A 4PZYA 2FZ4A 3UMSA 1YZ6A 2FMXA 1K0RA 2QT0A 4LUZA 3NWJA 4KSBA 2GAAA 3BFXA 4KODA 4HJ7A 4LBYA 3TGPA 2F1MA 2ONJA 1FZQA 1G3RA 2BC9A 2XNDA 3W90A 3T06B 2KSQA 5FPTA 2GCOA 2QGQA 4A3KH 1CI3M 3U50C 1R0ZA 1W2HA 1O3YA 2RCNA 1NG9A 1AQUA 4YONB 4APVA 2ZRBA 4OI0A 4I81A 5M5WH 4RZ2A 3QIAA 4IHQA 5KO2A 4QNRA 1CF4A 4TLBA 1EFWA 2FNAA 4BY7H 2H5EA 2E2IH 3L82B 4JLPA 1XJVA 1ELOA 1ZCAA 4URUR 2LXKA 1UEBA 1YZKA 3LAWA 1KIXA 1JMCA 3PEWA 2FFQA 3OPOA 4MGIR 4DJTA 2K5HA 1RC8A 2LKCA 3PCRB 1YI2A 1FGUA 3TQCA 5AUPB 1E94E 3AF4A 1YJ5A 4NMMA 3EASA 1KO1A 2ZYTX 4D82A 1D8LA 2CKZB 3GTJH 4B3FX 3ZD7A 1CR4A 4L8GA 2EQBA 1E2KA 3R20A 2X2FA 1ZINA 3NDBB 2PX0A 2OSBA 2NZJA 1HNWQ 3IQWA 1BYIA 3QXXA 4P75A 1SKQA 2GBLC 2ORWA 1EFCA 3O47A 5IF9A 2O8DB 2R7FA 3CF5A 5AJ3L 2VO1A 3WP1B 1J90A 2HJVA 3K0CC 1KOFA 4QM6A 1A8VA 1HCZA 1KNQA 2IHYA 4GKJQ 1N33Q 1OIVA 3I56A 1U8AA 4KXFB 4ZI2A 1NY4A 3VU9B 3THYB 2XB4A 3I5YA 3NVAA 5DSZA 1TU3A 1WDTA 1ZNYA 5C46F 2VSXA 1N6KA 3KDSE 4TMVA 2CWAA 1T3SA 3LD9A 3ULJA 5M3MG 3N2EA 4LJAA 5JSZA 4OI1A 4ASUD 5C1BA 1ESNA 1N0WA 2EDGA 1N33L 4POGA 4UNSA 5C44H 2PI2A 3PO3G 1GRQA 2PNHA 1F3OA 1PJRA 2GEDA 4HLCA 1XTRA 4P33A 1OF1A 4FWIB 4JVSB 4TQ9A 2F4VQ 3UMFA 1N36L 3CRRA 3M1IA 4W5HA 1DVRA 1GILA 3RC3A 1II8A 4ACBA 3FHTA 4QJFA 4P0TA 1N32L 1VCMA 4TZ6A 3TVTA 1LVGA 4IKEA 1CR0A 4UNRA 2CK3D 4PAOA 1DAKA 1NIPA 4H9GA 1WBBA 4E03A 1ZJ6A 5FL7A 2O8BB 1D7QA 4OI4A 2EYUA 5C0XH 4MA4A 3GLGA 2BM1A 3EQLC 1KMHA 1XWIA 2PCLA 5JI3E 1H8EA 3RN2A 2J41A 4B3BA 3KJEA 4RD0A 1ZNZA 5J4HA 2XZOA 4LF8Q 4B3ML 1NRJB 1HR0W 3LV8A 3T1OA 4YY3Q 5A35A 4A6PA 1A6XA 1XFAA 4RZ3A 3VR1A 1I6VC 1W48A 3AVXA 3LBNA 3B9PA 3WMGA 5DNYB 2BBWA 3S1MH 2JLXA 1MIUA 4F4CA 1I94L 5JBQA 2NN6G 2R6AA 1XPOA 1J8YF 1BOFA 3U7EB 3GJ6A 3H0KA 1VQ9A 1S3SA 2H57A 5K8IA 4UXHA 2ZJZA 2VHUA 3EARA 4FW9A 2CHVA 4AK9A 2XOKA 1WRBA 3ULPA 3T1TA 1E1OA 4PANA 4BLOA 2PCFB 2N1BA 5K8UA 2CW0C 4JG2A 4A3EG 1Q57A 2EVWX 4YMSA 5BYKA 1ZVQA 3EZFA 1VQHA 2XZPA 1WBDA 1VQMA 5HPYB 2YNMA 4B2PA 3I73A 3A1UA 4Q1FA 1LF0A 3QG1A 2Z6VA 3TQYA 1UKYA 4GN3B 3SE0A 4ARZB 2N8NA 1P16A 1E9CA 5HKKA 1IXRC 3LXRA 3A4MA 3HPRA 4DLVA 2CWPA 1JB7A 2ZJRA 1P75A 4BFXA 1G6HA 3QXJA 1QHIA 3TUIC 3GLFB 4DV0Q 3ZYCA 2JJ2A 3RANA 3U4QB 2JLYA 3OAAA 3U4VA 1KI6A 5GJVC 1I4DD 2GJAA 4QGAA 2DPXA 4MITA 4JLAA 2IYUA 1DAEA 2VF8A 1F6BA 4GFDA 3MFYA 4RKEA 3U2QA 2ID0A 3NENA 4JI8L 4O2RA 2FEOA 1E3MA 5IP7H 1MJCA 1X54A 4YCWA 2UUBL 3EA5A 2B3GA 4JVLA 3AH8A 1VF7A 3PO2G 2QSZA 2WPDD 3W34A 5KNDA 1NI3A 4JBYA 2J0UB 4CEIA 4C2MH 4K8OA 2OM2A 2CCGA 1WE2A 3QXSA 3RRZA 2WPDA 1G8PA 4PXAA 1QG2A 3BJUA 4HIMA 1YZUA 2C8VA 3KL4A 5HCIA 5TDHA 4DWJA 4AKIA 4UNPA 2D2EA 1A82A 2FPMA 1TWCH 4HIKA 1UE5A 2JA8H 3J81j 2HDNB 4IPGA 4GKKL 2IXGA 1N6IA 2XEXA 4OHWA 3QY0A 3V4FA 5IHPA 3GPLA 3PJRA 4QL5A 3A1SA 1G20E 2E8GA 2JEAI 3NBZC 4P71A 1XB2A 3NKVA 4HJ8A 4LHZA 3SQXA 4HB4A 2ZE7A 4A93H 4X62Q 4ZCLA 2R44A 2MQHA 5IWAQ 1Z2AA 2KA7A 3WNBA 2OTLA 5CLQA 3QVVA 1KJZA 4ZPXA 2OT3B 1VQNA 3SI7A 3GP8A 1IYJB 1I2MA 1AA9A 1YITA 3AGQA 4GOJA 5C4GB 4DLSA 4U7DA 1NNEA 2CL6X 3ZJYC 2YTXA 2OO7A 3DM9B 5GJBA 2DY1A 3L8ZA 5JJIA 3IRBA 2WWWA 3FP9A 1TQ4A 2ZAOA 1E1QA 2VQEL 4TYWA 2N3SA 2O8CA 1A63A 2FOLA 1PYBA 1MO5A 2YINC 2NZHA 5C44G 1K8GA 2AHOA 3KFVA 3SOPA 2BH8A 1XTJA 5JWOA 5SZKB 2ONKA 4GLXA 3THOA 1SXJE 4TL7A 3ZD6A 4HB3A 2C35B 3ZVLA 1QVFA 4IPCA 3CH5A 3CWZA 3FKSA 1JR3A 4IDNA 2HT6A 4TL8A 2DNEA 3BZCA 2F55A 2V3CC 4TLCA 5AJ3Q 3PFIA 2WJJA 3HWSA 4EPYA 2UU9Q 1T3HA 5CB6A 3L7ZC 3K0AB 5HCNA 3QPUA 4DUGD 2BE5C 1LS6A 2JJ1A 1EK0A 3DOEA 4HDOB 2UZIR 1IY1A 2ASBA 2ZANA 4BFTA 4JT4A 4DBLC 3OF5A 1ONBA 4MRVA 5CIQA 1HYQA 1I4LD 1L4YA 3CNOA 4WZBE 1GOTA 2O8EA 1Q7YC 1TAGA 1XPRA 2ZRAA 4JBXA 5EUMA 2D3WA 1SXJC 4RD4A 1YHAA 1W5SA 4G1UC 2A6HC 2GBLA 5C4JH 1N25A 2CLDX 4RKFA 4AY2A 1G3QA 2V4ZA 2EWWA 2QL6A 2DNCA 1IBKL 2P65A 1ZYRC 2IX0A 1N32Q 1G3UA 2OBLA 3OYYA 4BLQA 5ANRB 2O8FA 2R2AA 3PUZA 1OPXA 1CR1A 3FMOB 2SHKA 3V00A 2Q3FA 1VQGA 2OG2A 4M9XA 3H1TA 1RL2A 3SJZA 1KI6B 2IYVA 4EQ5A 4WJ4A 1XXHB 2NG1A 4LV5B 2P5TB 4TLDA 3GLFA 1X86B 4LYHA 2ATWA 2XITA 4FN5A 4HAYA 3QXHA 1AJEA 4DAYB 2D5DA 4IFDI 3SJCA 2BHRA 2PZFA 1AE3A 1P2VA 4Q21A 1S0UA 4Q9KA 5B2ZA 1X6OA 2K5NA 1MABB 5BYJA 4EPTA 1T91A 2OILA 4PR0A 1GG2A 1Z47A 2R7ZH 1A62A 1Z0KA 2BJVA 1VCIA 4GI7A 4B2IA 5L3VA 1XU4A 2C04A 4Q9HA 2FFAA 3ZZTA 5HE9A 3N70A 4PZZA 1ZM4A 4LCBA 4GZLA 2QMHA 1DTSA 3K9GA 1R4AA 4NP6A 4C3HH 3QPVA 5FOWA 1GNRA 3H0GG 3PUWA 2E87A 1VQJA 3CRVA 2ANBA 4BXXH 3U44A 1Q44A 2I4IA 5AJYA 1F2TA 2A78A 3U3OA 3GLIA 3GLHA 4RJLA 1S1CA 4TMTA 4DT1B 1DO0A 3FPAA 2H1LA 1Y1WG 2K32A 1Z9FA 4X64Q 1VQFA 3R9WA 4LHYA 3OTOQ 1CTQA 3NTUA 4KAXA 1XNRL 5JECA 4DV1L 1KI4A 1TWHH 2ZYVX 3KZ1E 1HZBA 2P6UA 3HP1A 3P26A 2RMKA 1AS3A 2E5LQ 4HUQB 1GP2A 1KRTA 2KE5A 3D3QA 1SQ5A 1IBLQ 3K0AA 1NSTA 3OW7A 5HZKA 2DUDA 2ODWA 1ZM9A 4BFZA 4AYBE 2CLCX 4A75A 1K6MA 2RGNC 4FWTA 2E74C 1JE5A 1CKNB 3S16H 1VPLA 3PENA 1YR9A 1Z6GA 1R5NA 4JVNA 4N1AA 4P4UA 1SVOA 2NIPA 4LV6A 4IFEA 5KU1A 3ASZA 1KK1A 4PPNA 3OIUA 2IA5A 3VA7A 5FOXA 2A3RA 2CNWA 2J9RA 1X55A 3S1NH 1ZC3A 1K8AC 3RHFA 2VQEQ 1DAGA 3BORA 4LK2A 3CZPA 4UQOA 2VUMH 5AJZA 1U99A 3RVBA 3CKLA 1LACA 1GHKA 3CX7A 3LXXA 4ALPA 4XD7A 4RCYA 3SR0A 4DIEA 3X1DA 2FSHA 3GTGH 3HYTA 2P6RA 5JCZA 1KY2A 1MO3A 4V02A 2YJTD 1OH8A 1DAIA 2VA8A 2O0KA 4OQNA 1W4CA 1H9SA 1XTKA 4TMXA 1M1YE 1KDPA 4B3TL 2AUJD 1HQYE 2G0NA 4GRAA 5E7NA 4QGUA 4D2IA 3LH5A 4HAZA 1AZSC 4Q4JB 4DZZA 4JVMA 1QVCA 2KENA 2ZTEA 4DR5L 1P2SA 1I50H 1VG1A 2Z5FA 2K50A 3AF2A 4Q7JB 4GOPC 4OGQC 1GL7A 2FGKA 3LO5A 2WM9B 4RCZA 5CK4A 5IP7G 3RN5A 1GZSA 5K36G 1CU1A 4GT1A 4NYJQ 5EE0A 1LFDB 5FTKA 1PH9A 3IGFA 4GKJL 1KZGB 3EWSA 5C4MA 2JLQA 2C99A 1MR3F 3VHXA 4BLSA 1GKHA 1K3RA 4UP7A 4IJLA 4B2LA 4OO1G 5M3FG 1R0YA 2ERXA 2MMGA 4KJZA 1XZPA 5IP9G 3B60A 4JI7L 4D4JA 4DEYA 1WCV1 3ZLJA 3WHKA 5KHOC 4I1VA 4A9AA 3KQKA 1GUTA 4QOSA 2D7DA 4BY7G 1O78A 2B8GA 1NF3A 5GJCA 3CCUA 1GNQA 3STBD 2QTFA 3M6AA 3R7WB 4C9BA 4GN5A 2OHFA 1ASYA 4HIOA 2HYIC 1N36Q 2IHBA 2KHIA 1N5JA 4I1UA 1LNZA 4OJQA 2WIAA 4L5QA 1OSNA 3E2IA 1G4UR 1KMQA 5K8TA 4ZDJA 1O7LA 1HR0Q 3GJ0A 4LF7L 3S1AB 1X9NA 4A3FH 1ZM7A 1TF2A 1IYVA 2K14A 2X8AA 2V6IA 1EWRA 4G5OA 5IDVA 1EX7A 1QUQB 4BEJA 1FJGL 3U7GA 2KCCA 1W5TA 1OKKD 4LBZA 1GUGA 1L1OA 3CR8A 3K0EA 4BFYA 1SXJA 1NN1A 4RSGA 1LF5A 4PZ6A 4QHSA 4IVRA 4M1WA 2VPPA 4B6EA 2NN6I 5JEAH 1BBWA 1D9ZA 3BBPA 5FTMA 2F9LA 1KDRA 5FBWB 2FSGA 5GAEC 3TSZA 2DN8A 1Q0UA 2DFKB 3BB3A 4C0QC 1KHIA 1W47A 2IS6A 3GEEA 1FJGQ 2IWHA 1W36C 4OBEA 4F38A 4O2DA 5DYIA 2PL3A 3I92A 1P4SA 4Q4HB 5E7IA 4YCVA 4V0LA 3X1YA 1OXUA 3B78A 2R92G 2ZPTX 2J59A 1G7CA 1Q46A 5FFMA 3M4PA 1X6VA 2ZREA 5FLXc 5LMUQ 2YV5A 4NXML 3P4YA 1IM2A 2J0SA 1MABA 4GMXA 3NHBA 4X8MA 2A7QA 2JASA 1SHZA 2WBLC 2QSYA 1TQDA 2GRJA 4B47A 2JA5G 1FL0A 3SHFA 5J40A 4DV7Q 2WIBA 5G40A 5EP2A 3A37A 4Z8YA 2KJQA 2AXPA 1SGWA 2V7QD 4A2WA 4BFUA 1V8QA 5BN5A 2YHSA 1XJ0A 5GADC 1F48A 2WSSD 1P9WA 2AK2A 2ZQ5A 4A15A 3TUJC 1YQTA 4C7OA 4DHEA 2ZI4A 2J46A 4JBWA 3IUYA 3H94A 2G9NA 4DV7L 1IJFA 1Q86C 1MKYA 1Z0JA 4PHHA 3PV0A 1G5PA 4HSEA 3H84A 1AIPA 1H65A 2XSZA 4LV8B 4NCIA 721PA 4HJ5A 2F3TA 3LBHA 2WTUA 3QKSB 2BCGY 2RAPA 4Q7MB 3MD0A 4X64L 1AKYA 5IT9c 1K83H 1DCZA 4JI3Q 3MWKA 3ND9A 2RF4A 1OKKA 2A5JA 2ZS7A 3SZRA 1ZUNB 3KJPA 4D4KA 3VHLB 2N49A 3D8BA 3CB4A 3A1VA 1BO6A 3BOSA 4IXNA 2GDJA 3J80i 4PC6A 3MRSA 4LFAL 5CB8A 2BA1A 1WXQA 4JJZA 4Z1MA 1CFMA 1QZXA 5CJPA 2J3EA 1YRBA 4M1YA 5TB5A 2AMCB 5L3QB 3THXA 4QRHA 4QGGA 3F0TA 4PV1C 3P20A 1YHQA 2JA7G 2VP5A 1R5BA 3CPEA 5J4VA 3CC2A 4LDJA 2QRNA 1XMOQ 1VS0A 1SVLA 5IK2A 2QUZA 1DE0A 4NB3A 2EQSA 2GN5A 2RGNA 1UWVA 2PBRA 1FQKA 1CUKA 1UBFA 5TARA 1E0KA 3PR1A 1SVMA 3F2DA 3QXCA 1D6JA 2MO1A 1UPTA 1W0KA 4BRUA 5LPNA 4PZLA 4KLZA 4W5WA 4OK5A 3CQZH 1Z07A 4Q18A 1JQLB 4TQUS 4EUNA 1DELA 3ZVMA 3TS0A 1XDBA 3UDXA 1JQJC 4OJKA 3GLIE 1P9RA 1AE2A 5ELXA 1PMRA 4B35A 2ORVA 1G6OA 4IFDJ 2HJGA 4GOXA 1G19A 2N42A 1UF9A 1WCMG 2WP8J 4HLUA 4M1MA 1B9MA 4Q1CA 1XJQA 2WKPA 5CM9C 4LJYA 4EJSC 3Q72A 3ER0A 5D3MA 1SVWA 4LSGA 3HR7A 1QVGA 1NJFA 1XCGB 2GCPA 3EWAA 2R93G 1VQ6A 4O2LA 4LF7Q 2WV9A 1U2RA 4AKHA 3TKLA 3EIVA 3ZGXA 2UU9L 4D0LB 2ASEA 4LY6A 4O3MA 1RW4A 3SYNA 3VQTA 4Q7KA 4KV9A 3FE2A 2KBEA 2N78A 3CX6A 1X8LA 1CTMA 1Z2CA 4IFBA 4QBHA 2JA7H 1B7YB 4YC7A 4JYCA 4NYIQ 2OCPA 3CXCA 4IOLA 3WBKA 2ZJ2A 5FJ8H 4MH0R 3UWKA 3T56B 2GJSA 3E5HA 4HUTA 3GJ4A 4DV5Q 4YMTA 2ZE6A 3OEED 3NE5B 3RNUA 4M1TA 1T6NA 2MSDB 1T5EA 2D2FA 5J4YA 4ABYA 3HOZH 4TMWA 2WOOA 5H8WA 4CEJA 5IYDH 2W00A 4LC0A 4M22A 5HKKD 2Q8IB 3CRQA 4A6XA 2IXEA 3I61A 4GNXC 4DV4Q 5DH9A 4NCKA 3NC0C 2EXDA 1KHTA 4C4PA 4PQFA 2QI9C 3D6TB 3U3JA 1FW6A 521PA 4CT5A 4OI2A 1ZW6A 4XSGA 5FUYA 2DR3A 2QBYA 3GJXC 5CDFA 4BY1G 2WAQE 2ZSFA 3OE7D 2V1CC 1E9RA 1UBEA 5EP1A 4UNQA 5KNCA 2CL0X 2YTVA 1NSFA 1L2TA 3QBVA 4PO8A 4M1OA 2A5YB 3OFNA 2ECKA 2L5TA 3FHCB 3CF0A 1L1OB 3TS2A 1E2GA 3MCAA 4D26A 2IS1A 1GD7A 1OYYA 2D06A 1JBKA 2CHQA 2DBYA 2QPOA 2ZETA 2B7CA 3ETLA 4M9QA 1GDDA 3BERA 3WDNA 4LHXA 3FVQA 4RMFA 1JALA 2FG5A 1KC8C 5H1YA 1L1OC 1XBTA 4A3EH 1S3OA 1P7CA 1XTIA 4LOAA 3RS4A 3SEAA 4R4CA 4QBGB 2VP2A 2D62A 1FNMA 1N34L 5L3QA 1K8MA 2LWIA 3ND8A 3GMTA 1NVUQ 2DFNA 3W6OA 3T51B 3AB3A 1W36B 1C7YA 2QG6A 2R65A 1DBSA 2ZJ5A 1D2EA 5IYCG 2MNAA 1QF9A 3C14C 3BJIC 2UZ3A 3QQ5A 2VF7A 3B13B 1E9FA 1Q12A 1YNXA 2WFWA 2J7PA 5F2EA 1XJCA 3RS3A 2JLWA 1RE0A 2AKWB 2PCJA 3UIEA 2XSZD 2HXYA 2WAXA 3I1FA 1FUKA 2GESA 3SS8A 1XMJA 4C3IH 2J0UA 3IHLA 5L8VA 4RD1A 1E79D 4OK3A 5EQTA 3AB9A 4YHHL 4LF4L 1QG4A 1WQ1R 1PUIA 1Z06A 4XTRA 4POAA 3VR2A 5C0XG 4LF5Q 2NPFA 2F9MA 3EN2A 2IUSA 4OKSA 4A3FG 1VQLA 1YZLA 4OQMA 5H1SE 1ESMA 1IYUA 1X56A 3RDPA 3K70C 2QTHA 1DG3A 5FLMG 2NZOA 4KBFA 2XXAA 2ZM6L 2GKSA 3A4NA 3TR5A 2K33A 5FL3A 5FBLB 4CT4B 2CMKA 1KDOA 1OT3A 3PCOB 2KCMA 2R6FA 3J7ZC 1Y1VH 3LGJA 1N0VC 1QHGA 2GZAA 4MRNA 2L0XA 3LLMA 4G7OC 1U94A 2OBNA 1B0UA 2A8VA 3PUXA 1MRSA 4JLJA 1N6LA 4AQYL 1WA5A 1XP8A 3THYA 3DM3A 1FVIA 1TU4A 5JJLA 1PVOA 1N3BA 1VCOA 5DYGA 3X2SA 4KFRA 4M9ZA 4US1R 1U0HC 4A3GG 2IF2A 2ZJAA 1ZU5A 4CYMA 4YLGA 1AGPA 4NBSA 4PO1A 2PMZE 2VRWA 3U6KA 4B3RL 2YVUA 4A82A 5FOVA 4AQYQ 4Q4AB 4WIAA 5FPYA 5JI2E 3G6EA 3L0OA 1E1TA 2QMUA 1Z3IX 4ZIRA 3DMNA 2ZM5A 2A9KA 2QBYB 4CW7A 2JJ1D 1DOAA 3K9HA 4MUAA 3BB1A 4DUGA 2W6JA 1UE1A 1IN8A 2CE2X 4XH9B 3RAPR 1DAMA 2ZTSA 4H1UA 1YHNA 4RZXA 4LHWA 4LJZC 2XX3A 3Q9LA 2JE6I 3FKIG 1GM5A 2A6HD 1JJ2A 2DFTA 5JEAJ 4DLTA 2E2HH 2UUCQ 2A19A 5JJKA 4LX0A 1BIFA 1GRRA 3UMRA 1W7AA 5E7JA 3FMCA 3CW2C 4DV5L 3CCQA 1W0JA 2ZR9A 2H8KA 4US0R 1D2NA 2JAQA 4XVQA 621PA 1TXYA 1IXRA 3IFTA 5C3EG 4YWMA 1U9IA 2ZVPX 3W1GA 1A2BA 1NMYA 3GEHA 4B48A 4AG6A 5IYDG 1IAQA 4RFSA 1KSJA 1RYFA 1VF5C 1JJGA 3MLEA 3FFAA 5FOSA 3EIHA 3U7HB 1CKEA 2HCBA 4DDWA 3MAAC 1AGRA 5FBVB 2HQLA 2P0EA 1N0UA 3HU1A 4C3JH 3L2PA 2WZQA 3UG7A 3L8YA 4ZIRB 1OFIA 1R5OA 4A3KG 4LI0A 2IXFA 4RY2A 4DV6Q 3CD6A 2K52A 1J8MF 2IYXA 1ZBDA 5E95A 4DNRB 2VHJA 4PSKA 4DR1L 4JLOA 1ZNWA 5KSZA 2Q2UA 1QHHB 1FOEB 2GK7A 3LWUA 3E70C 4TSFA 1N5KA 3AF3A 3CWQA 1KI9A 1QJOA 1PH2A 3QF4A 2V1UA 1SMXA 1OW3B 3EZ7A 3AFPA 2BCJQ 3KJGA 5UKDA 3W1BA 1EIFA 1KK2A 1VQOA 4GSYA 4DV6L 2VUMG 3IIJA 4PX9A 3ADBA 5DN6A 4GOKA 2EIFA 4LBVA 5DIFA 4LFCL 4UXJA 4WZ6A 4KSCA 1WJJA 3PUVA 4DSUA 5AK0A 4TVAB 4BE7B 4BWYA 3T1HL 2K4KA 1E9DA 2E9SA 3ICQB 4NL4H 3VFDA 1FP6A 1XCMA 1JXOA 2F4VL 1ZUHA 4ZO4A 3U3KA 1E32A 4JL5A 2XXAB 3ULLA 4DPGA 1BMFA 2ODEA 1XXHA 3D7MA 3J81c 5BN4A 2C78A 4HAWA 3LVQE 5B30A 3QPWA 3QBTA 4KI0A 1L4UA 1P2UA 2BMJA 4V0NA 2WWFA 3OAAD 2IL1A 2I0QA 2JEOA 1E0JA 2CNWD 3A8JE 4Q7LA 3LRPA 2QT1A 4B3DA 2GF0A 1BDOA 2D0OA 3ICEA 2G1KA 1FMLA 3A36A 4KYUA 5FUWA 1W0KD 3M0EA 4NHOA 2CVFA 4NU0A 3B7GA 4WVFA 2VZAA 2W58A 3W8NA 4KFUA 1S9HA 4OL0A 1W0JD 3QI2A 2VW9A 5CLLA 1EIYB 2P3SA 3A4LA 2XOKD 3KTAA 4AD8A 3GLGE 4GS3A 4YY3L 1Z6XA 3LW7A 5EXTA 2O0JA 2Y0SG 4MGYR 3QEJA 4JKYA 4QIWE 3RWMB 4UKDA 1LM0A
chains in the Genus database with same CATH superfamily
3UTDA 5M3MB 3VR4A 2FPGA 3KZNA 3S14H 3DZIA 2JATA 3F46A 3ITNA 4HRYA 4J0DA 3FNQA 4QC2A 4D6PA 1GUSA 3ZZMA 1YHBA 4RAUC 4OQ4A 2YOHA 1IU9A 1M2WA 2I1QA 3OPYB 4PPYA 5IGGA 4R9RA 5AHXA 4YWJA 3EXFB 5KZMB 1QBGA 4IFIA 1XQXA 3MAJA 2PI2E 5DLQC 2REOA 4ILKA 4X8LA 1S9DA 1SCUB 3JQPA 2GO1A 4ZT2A 2JLUA 2X3YA 4QJ3A 2FKNA 3KKPA 1NXTA 4E5UA 2O6HA 2K75A 2PT5A 5JS7A 3WL5A 1SJHD 3K5IA 3E1SA 3NTLA 2H8GA 3I2ZA 2CCKA 1KIMA 2O0HA 1T9HA 3M83A 3N05A 3V9PA 4K9RA 2OXRA 4TSSA 4ZAIA 2IDZA 3C7KA 2JA6B 1G17A 4PQYA 2IV7A 3DAYA 1PR6A 4ARZA 3LP5A 5CB4B 1T4CB 3GVHA 3AY6A 1RJ9B 1H9CA 1WWKA 4IGAA 3UCFA 3C39A 4L76A 4M86A 1MMFB 3YASA 4WKNA 3CNNA 2AKAB 2QNBA 4WD3A 3WYAA 4JI8B 4TKUB 4F9EA 2JGMA 1XQYA 4JITA 3NP9A 1FTWA 4P31A 2WSSA 2ADFA 4DIKA 4YB8A 1TE2A 2N3ZA 3H86A 4NV0A 1KAQA 2G1PA 4Y18A 1HA6A 1JU9A 1N9WA 2HIVA 1QBKC 3BK2A 1Y5RA 3G1WA 1PJ3A 2GNOA 4HSGA 4D9HA 5A4FS 3TP7A 2BZ1A 3R3SA 3SK4A 2X9VA 5EQJB 3AKDA 4KQWA 3L0BA 5CXSA 2EEZA 1J33A 2H18A 1LY1A 3QU9A 1SR3A 2GZSA 1DX6A 2C9ZA 3BX1A 4HDSA 4M7PA 5J59A 5BWCA 1C9OA 2R8XA 4Z9CB 3CW8X 4P73A 4JGIA 2H7VA 4CNQA 3IAEA 3VAAA 1EGVB 1K4KA 3CO5A 5HGXA 4X62B 2RH4A 3A10A 5DOVA 1H9KA 1KY3A 4AUEA 5IWAB 2I5LX 3JYLA 2O8FB 2G4CA 3ENVA 2QE7D 2VHQA 2XPCA 4I9HA 4M7RA 3RJZA 4WX2B 3ZVRA 3ZCTA 1SELA 1JE4A 1Y8RA 2EU8A 2PZEA 3KSZO 1GU1A 1LTHR 4EHDA 3HOWH 3LQRA 5JTUA 3D8TA 3TLEA 4QWWA 3L8DA 2MR5A 4B7AA 1ISFA 3QF7A 2OD9A 4AJNA 2A0YA 5GOTA 1E96A 4M0LA 4B7XA 2OGZA 3BRWD 4DWVA 2WA1A 4C1NA 5DNUA 3E9HA 5B2FA 2CL7X 1FXUA 4PRZA 2VCHA 3H9GA 3SIXA 4ZVTA 4AH6A 2HPZA 2NWQA 3H04A 3FPPA 3ND5A 4RIIA 1RLJA 3LQFA 5HUHA 4OHJA 4A2CA 5I4IA 3AEVA 2B1GA 4F88A 3LUKA 4IWXA 4JI0L 1CRPA 2JAPA 3GCGA 3U4CA 2F0UA 1ECGA 2ZJ0A 2VXYA 1SLJA 4K46A 3K0XA 5DBEX 3VX4A 7MDHA 3K7UC 1QANA 3W4KA 1VSTA 1KDAA 3TD9A 5IAOA 2XE8A 1CQJB 1JYEA 4YH1A 1NT4A 5AJUA 4UAUA 1YVCA 4A3DB 1VRWA 3E9QA 3I09A 3TLYA 1CSQA 2VTVA 4GLOA 2HFJA 1P9OA 4UFNA 4D57A 4M53A 1T1JA 1QTIA 1H6AA 4Y0AA 1XKTA 2VG8A 4IUNA 5L6MB 2WSYB 1E2EA 3K70B 4AI6A 3H5VA 4EPVA 2XAUA 4ECEA 2C77A 2ROQA 2CXXA 4MX8A 4BL5A 4D0GA 4EPWA 4HGNA 1HRDA 1N8TA 3TMYA 2WTMA 1UFRA 1AB6A 1DCTA 4GLAC 1OJ7A 4D25A 3B6ZA 5ILOA 1Q5PA 2PT9A 1W30A 3UPDA 4MYUA 1KPHA 3BH7A 1U3GA 2HMUA 4MWTA 5BNZA 4A3EB 1MRZA 1OYOA 2AZDA 4FFNA 4YREA 2Q1YA 3D0RA 3WZMA 2HA6A 5IIFA 1SZDA 4J1SA 3A9RA 2J9ZB 3ERSX 3TMEA 4MPDA 3B8EA 3KZOA 4RPHA 1PV2A 3OWOA 3KOJA 3VI4B 2CMDA 1BNZA 4MYSA 2D1YA 3DO6A 2B99A 3AEXA 2GF9A 3KSRA 2VJQA 4RX1A 1TZ2A 1BROA 2X5XA 1JC7A 2P9EA 4JELA 2SOBA 1X2EA 2FPPA 3OZGA 1VG9B 3TBKA 3QU2A 1N2CB 2EY6A 1CFJA 2BCEA 4EKDA 2PLFA 4UHEA 4QRIA 4AUNA 4HGOA 3MS2A 3V7FA 5LL6P 1SKBA 2D8AA 9ATCA 2XWBB 2PWYA 2A1UA 4FMCF 4NZZA 5D6NA 4Z0HO 421PA 4DC1A 1MGOA 5JPCA 4S0XA 3TW8B 4HFMA 4WJLA 4ZCRA 2A2ZA 3CC8A 1C7QA 2Q7OE 2D5IA 5J4HA 1XZCA 1E1MA 3I7FA 3AHGA 4KN9S 3FVWA 4UNNA 5F3RA 3T5AA 2FRXA 1FFYA 1X1SA 2QYOA 3ESXA 4ZHQB 1XNQB 1FFCA 1T24A 4YPOA 3PQCA 3BHMA 4ANFA 5JFGA 1YEZA 4JC8A 3BG3A 1L4KA 3EJ6A 1PGNA 1F51E 4Z2YA 1XYVA 2J5KA 5CEEA 1KU6A 5K6AC 4H13C 5M3FB 4R4IA 1C0LA 2GN0A 2QGNA 4TWJA 2YQZA 1HC7A 3RS0A 3TVYA 4DRZA 5ADWA 1IUNA 2YU9H 1PZNA 5AR1A 2GVBA 2OHXA 2ZB4A 1VA5A 1S2LA 3RB8A 1KIFA 8AT1A 4GPD1 4BBZA 1NI4B 1RLTA 2ZRNA 4KDRA 5FCDA 4OHXA 4FWTA 3BDLA 3E53A 1U5BB 1ISIA 3TIXB 5JXIA 5EC8A 1BVSA 5LMNW 3IP1A 4HJXA 3OI7A 1DTEA 2FETA 4PLVA 1V1PA 2A68D 3QJYA 4MDFA 3BQNB 3WGUA 3EGCA 4RS3A 2PQAB 3H3VI 2B8JA 3I30X 2G72A 1TJNA 2E2JB 3AEYA 1U9RA 5DNVA 1I3MA 2ODNA 3MOIA 5KNDH 2GHIA 3M6UA 1DO2A 1Y4DE 3Q5DA 3Q7QA 5ARBA 5KNCH 3OJ0A 1TM4E 2PMKA 3I72A 3ZX4A 1NQVA 5FI0B 5C51B 1JG7A 2FQXA 3I53A 3HOYB 1H2FA 1TFUA 2ZWVA 3GMSA 3QU5A 4IZHA 3HOXG 2XEDA 1JLLB 4R9NA 4NKLA 4RA9A 3OESA 1UFVA 2E5FA 4UE2A 1YZFA 1T6YA 3IXMA 4HQNA 4JR2A 3TZBA 3U4HA 3AKEA 3V42A 5FWXB 2E4ZA 4DV2L 4QGFA 4K6OA 5C3WA 3PXDA 4UP9A 4DR2L 3TDKA 3ZI7A 2XB2A 4HX2A 4MV9A 5E2IA 4AZSA 3GTOB 1QWOA 2I3BA 2NM0A 5K1ZA 4C22A 4WLOA 2OYRA 3TQOA 1I2DA 1V48A 5TPZA 2RBEA 1CIJA 1G291 4A4IA 5B1SA 3CYFA 3V4RA 1R8QA 3BPSA 3GP7A 4OELB 2H63A 2SBTA 3IVRA 1M6VA 5A62A 2CCZA 3WFJA 2W4QA 3B7WA 3SJ7A 4BZQA 4ZV4A 1BR9A 3ZS8A 4KH1A 1YI1A 1V16A 3KFXA 5CCDA 4C20A 1B3AA 3EGIA 2IXAA 2ZE8A 4HI0E 5B58T 3UE0A 2PSDA 5ERGB 4EA7A 2IW3A 3OMGA 1VE3A 5K20A 1E3WA 1P2FA 2XYQA 3IS3A 1I4EB 5AVOA 3RK4A 1VQ7A 1IE3A 5K36H 2VC2B 3EE6A 4HFRA 4D3FA 4F4IA 3GJ8A 4E30A 1YS7A 1WPRA 3F5FA 2XDWA 3EDMA 4PCLA 3TBFA 1Y42X 3H5WA 1H93A 3DCIA 2VOJA 1ECCA 1NMZA 4AJIA 5ECDA 5TMBA 2A58A 3KAQA 3P4XA 1KMCA 1J7JA 5ALLA 1L5LA 2XTAA 4BWGB 2Z5VA 2HJWA 5JEDA 2I3AA 5HUQA 5IMBA 1CRQA 1KEPA 1R0WA 4U3JA 3H0GB 1TL7C 2REBA 1FSZA 4MUXA 4Q39A 5DM63 1N9KA 3GFOA 5HF9A 3S68A 4YWLA 1VKJA 2BIFA 3RO7A 5GIPE 1BQ4A 1WJGA 3NH6A 2F1OA 1JECA 2HLPA 2XUOA 3SHVA 1G8FA 2PVCA 4H4EA 3BHJA 3PQ3A 3CLUD 1D8TA 1LBEA 4H3VA 5EP4A 4B6SA 4C4TA 3MGGA 5IYZA 2B8WA 4LRWA 5IAJA 4CHTB 1QRDA 4IJKA 1QOQB 5AJXA 5DRYA 1ZH6A 2A9PA 3TQFA 1OXXK 1ZAYA 1G2OA 1P1KA 5KPJA 2Y0SB 1E66A 4NBRA 3R7WA 4X6UA 2BFFA 1I7QB 1MW8X 2QDLA 3E3LA 4JODA 1CQXA 1XD8A 4B3SQ 5TJ9A 3I4MG 2YU9B 1FDTA 1W44A 3QYJA 3G1TA 4K3UA 5BN3A 2GM5A 4II7A 4PHTA 4LE2A 5EP3A 1KFCB 1QO9A 3I83A 3HFGA 4ZYYA 1L5MA 3AHDA 4UU8A 4HC4A 3VNQA 2CZGA 5KWSA 4C7OB 5T4FA 1VJCA 5C7YA 2YZMA 2QGFA 3NBKA 1LTSD 1T25A 3QVWA 4CI9A 5FWXA 3D8GA 4F12A 1A2KC 5FEMA 1DIAA 2EKZA 4QYMA 3STVA 2AUTA 5JY1A 2IH2A 1ENZA 3QFRA 4EF4A 1VYTA 2WU3A 2H6EA 5F1PA 4UUNA 2YFKA 5IX8A 2AOTA 1BS1A 5ED0A 3KLWA 4HCSA 4D43A 4DSZA 3JW8A 1E24A 2R61A 1Q0HA 2DKFA 2XA1A 4JK1C 3EIXA 3V8VA 1UEIA 3WNCA 3ONAB 4E4TA 5LL6S 2YS7A 4L5BA 2ZUEA 2ZKLA 2QN8A 1SVNA 1ZL2A 1NR7A 3WL4A 1DTWA 1YZGA 2IYYA 1GPJA 4QL3A 1C1HA 1HSZA 2C1ZA 1JPNA 3A1WA 2IHFA 1SM4A 1U2GA 2AW3A 2ZAMA 1ATIA 3JV7A 2ATIA 1GL6A 1ZEQX 2A35A 2I4TA 2PSJA 4PO1A 4UATA 5DK6A 2GLUA 4XYBA 3WHPA 5DWDA 4N5NA 1MP0A 4D98A 4EG5A 4B6OA 4RKYA 3MJCA 2OBMA 5LBUA 1Q1EA 4D4LA 1JEOA 1P62B 2JI9A 1EWQA 4R51A 2TSSA 4P4SB 4ILWA 4XXEA 4INAA 4OJTA 3SC3A 1NBHA 1SO8A 4CQJA 5AVWA 1STOA 4C0LA 5BUCA 2H4HA 2PS3A 3M9WA 3HO8A 3T7DA 4CKEB 3DBRA 1I3OA 1YE8A 2AUKA 3RLOA 3RVLA 3U4IA 2XMQA 4F87A 3R3ZA 5IGEA 1Z7GA 3B82A 2J9YB 3Q88A 4HQOA 2C5CA 5K4GA 2QY9A 4Y2SA 5CBPB 4HDKA 2QLJA 4RPGA 2EPBA 3KYCB 1IEVA 3OPVA 3FSRA 1H4SA 2HW8A 1XP5A 1TK3A 1G7SA 4WCFA 1QHSA 1SIWA 1JW9B 1PGPA 3BGOS 1PJBA 2EFEB 3CEMA 3Q3HA 5JAVA 3RBXA 1KZ1A 3W2FA 3WHLA 2HA5A 3BL5A 4QKQA 3CZ4A 3HPQA 1TKBA 3MAQA 2BFPA 2XVSA 3GV3A 1V9CA 1Q1GA 2YNMD 3L92A 4BO6A 1JB3A 1W4BA 2OLKA 3ZJYA 2WJYA 2XWQA 4YCMA 4QMGA 4I36A 5T1IA 1V6SA 3BCSA 1SDFA 2ZYGA 3JQGB 3PE6A 3GZ4A 4UUQA 5F1YA 3B9BA 4LUVA 4FD2A 5HOEA 4UAIA 2XRYA 1HTPA 2W6OA 4WXYB 4LYFA 1I0IA 4ZK2A 5LNK1 1FNSA 3ACCA 3R0VA 4LY3A 1QE5A 1AKQA 2EYQA 2HHAA 2X6TA 4WXMA 2AFHB 2GFQA 4L5AA 1VCNA 2C0QA 2QQFA 3G85A 1JLHA 3NHSA 4F6CA 1RT9A 2I2BA 2O20A 5JH7B 2V6JA 4CR7A 4XWAA 3VJLA 3ZYZA 4EITA 3LJKA 4L4ZA 1TS4A 1YKFA 1GKKA 2ZU6A 1L8QA 3JVEA 1QDUA 3LWEA 2F8MA 5TIIA 5C31A 1Y7PA 1RRMA 3S9WA 2UDPA 4DR2Q 2CVOA 2VNSA 4V39A 3W8NA 3J7AC 4PHCA 3VJKA 5C4XG 4RF3A 1J70A 5KTNA 2A5HA 1GRCA 4TWZA 2Q2HA 3KHSA 3OLVA 3R5XA 3ZY4A 1DX9A 3BJRA 4OLJA 3NCHA 1T3GA 4ND2A 4H7PA 2KYRA 4D0NA 4DR6L 2Z4HA 4GE3A 4JJKA 5CG1A 3I9KA 1BEZA 4OXKA 1L6IA 2WT8A 4TXHA 3KWJA 1D2BA 4IOAA 3D1LA 2VJYA 1EH5A 1IULA 4DMGA 2AHOB 3KZXA 5IRCD 3DDWA 3T1YQ 2ID4A 2RKOA 4HMJA 1DS6A 5KYLA 3ENZA 2O2JA 3ZWYA 1JPJA 1K5DA 3GGCA 4LXUA 4G6ZA 3LKVA 1Z4NA 4NE2A 4W7SA 5GONA 4YQEA 3CUUA 2R6CA 1L7EA 1GVPA 1FW8A 3GVPA 3UBTA 5F2OA 4A26A 3PQ2A 1SJ9A 2HQEA 1IDN1 4B34A 4F84A 1JQ5A 1AMOA 2UXBQ 5DZSA 4YXWD 4HDMA 3SXPA 3TXXA 1I4RA 5BNTA 6AT1A 3ZBPA 1BCSB 1U3DA 4DBVO 4N3AA 4QDKA 1E20A 2PRKA 2B6HA 3AHFA 3HFRA 4MVJM 4YRPA 3UV3A 2WM3A 4BVKA 3RSOA 1VJ0A 2JA1A 5D65A 1NTGA 1JEEA 2BD0A 2FYTA 2PRZA 4WNIA 4A0FA 2HKIA 4JB3A 4YO8A 3D3RA 1FFEA 1U3FA 1UC9A 1JPUA 3B1WA 3VU3A 1LRKA 3WMEA 2BONA 1SEBD 1OR8A 3VNRA 4BMNA 4Z2AA 1LC3A 1P1BA 3T7AA 3BWCA 3VO2A 3HUUA 4AKGA 4OO1I 1SBZA 3A31A 1GGNA 3SR4A 3E9IA 3ZQ6A 1CF2O 1I5OA 2ZRDA 4A0HA 5A02A 3H09A 3CLRC 3B1VA 4REQB 3Q8XB 4LGYA 2ES2A 1CJMA 5HDQA 1F8YA 2WIDA 2Y3IA 2F0TA 3KTOA 1HT1E 4FCVA 3C3XA 4P5PA 1XLTC 3ZI4A 5I45A 1VM6A 5K3OA 3FIUA 4OGKA 4ZCPA 3ONNA 2JFVA 2GJKA 1BDMA 4IIYA 1QCDA 4I4TF 1BBXC 2XQJA 2FZLA 3K7AB 10MHA 1D2MA 2DHRA 3B3QA 4GVLA 4OAQA 5DTRA 2FMUA 2P6MA 2OUKA 2V7BA 2XGMA 2QTVB 3K73O 1JI3A 3P0HA 2EVBA 2XT9A 4BP8A 1CQFA 1RAFA 1T8PA 1UDWA 3QE2A 3KDFA 4PQEA 3PQIA 4HAXA 5D5PA 4Z3OA 3EF3A 4DU9A 4PCUA 2YXLA 5L7YA 1C8LA 2LXJA 2PKWA 1DBIA 2YS6A 1XDWA 1VE9A 2ORYA 4XLLA 3DPUA 1RKQA 2QRZA 4G8BA 3ZDDA 2QTNA 2IH4A 4DV3Q 3OWFA 2I5HA 1H9BA 4WZAE 4LDAA 3D8UA 2XVAA 3JD1A 1PTOF 3HVKA 3K8AA 3NTIA 1E2HA 1QIKA 1ZI8A 3IERA 1V41E 4L5TA 3BB4A 4M9SA 2O57A 4OBBA 3KP1A 2XWPA 5CGZA 2DGYA 3VSCA 4RFVA 2M9VA 1DDIA 4EJ0A 4OXPA 3GTLB 3LLCA 4R8NA 1I8TA 4UBJA 2CXNA 3RFUA 3KXKA 3LLUA 3GZTB 1G8SA 2A0WA 1V1OA 1W6RA 2BSQA 1M10A 1SCUA 1PV4A 1H94A 4DYDA 4EPRA 2IYNA 4K8RB 2IUYA 4CL8A 3D6CA 4ALMA 5ESDA 3NW9A 2UVQA 1TUIA 2DG2A 1JIVA 4O2BF 2NVWA 4PZPA 2G6TA 3TOCA 4YWKA 2PIDA 3PPWA 3HTXA 5CPFA 1OHHD 2O7VA 4JL6A 1V8BA 4TMKA 3ZTYA 4DAOA 2OR3A 4OP2A 3VNAA 5HY6A 2Q5IA 5FLMH 4M36A 3J81L 2Z30A 4QQNA 4NWIA 2QENA 3RBZA 2BEVB 4JLKA 3UHJA 2EWVA 1TMKA 1U0JA 5JW6A 5YASA 1KL7A 4HJ9A 3DLBA 5IYBH 3CKIB 3GLVA 4HR7B 5J9FA 5IE8A 1Z15A 1E2WA 5G1PA 1FVHA 2Q9BA 3MJSA 4BLWA 2EZ4A 3EGEA 4M3NA 3OJXA 3AYHB 3CW9A 1E77A 5GROA 3OU6A 4DCTA 2ZJPA 3TQIA 1PFMA 4LY9A 3K2BA 3CTPA 3L0CA 2JFPA 3VKHA 1KP2A 4MCAA 3QJGA 3USZA 4JV5L 2VQ3A 4IW3B 3WNVA 1C3EA 3QWHA 4BMOB 4CT0A 2YZGA 2WUFA 2RQXA 3KLBA 4BNYA 2Q5OA 1NVFA 4KWIA 2PGAA 4EYEA 1A0IA 1MVNA 4N47A 4BVBA 1C7RA 2OD2A 1SB9A 2BJWA 3A1TA 2JVKA 1CY7A 3LSYA 4V0QA 4KO1S 5ALOA 3REGA 3R2IA 3HXTA 4OAOA 1CW2B 3JQ7B 4H7BA 4U5QA 4ESVA 2GM3A 2DSTA 4YALA 4KNYA 5EIHA 4DB2A 1PR2A 1U0NA 3U61B 3P75A 4BBRB 2ZI9A 2B36A 3KCNA 4IO0A 4MEJA 3KJZA 5EXDA 1N92A 4MI3A 3RASA 4F4JA 2ZS9A 4QFCA 3UA4A 1BDJA 1J06A 1G21E 3WGJA 3WB0A 4C0XA 3HXQA 1W5AA 1XD2A 1CA6A 4LWQA 5JHGB 3CO0S 3DF7A 4HEA1 5C2JB 4RAQA 4JI7Q 2P75A 4RMJA 4A8TA 1K28A 2W2LD 5IVPA 2O7SA 3JXEA 2BBOA 3KSUA 2P5SA 1X1DA 3DWIA 5AW5A 1QJ4A 1KE1A 4OHBA 3H65A 3TS1A 4XVUA 4UDXX 4N6NA 1T1GA 4PLTA 4RHSA 2V7UA 1G5HA