3PUXA

Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 104
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puxA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puxA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puxA01
2BDOA 2ZJYA 4GNXA 2YWGA 4Q02A 4A93G 1TF2A 1E96A 3A8JE 1W46A 2NPIA 2VRWA 2GK7A 1EOVA 4NYMQ 3CMEA 4HLCA 821PA 3K0EA 3MXNB 4NZYA 5EP2A 1CF4A 4IDPA 3I3SR 3TZUA 1IY1A 3IO3A 1QHYA 4PR0A 3SJCA 4URZR 3KF6B 1UDXA 3CAMA 3C4JA 1QVFA 2ZT9C 2V7QA 1G3UA 4TTRA 4C3ZA 3D0FA 1FUKA 4EPYA 1E1QD 1FP7A 121PA 1B9MA 2PLRA 1X8KA 3D8BA 4C7OB 4OONA 2V8OA 3S24A 4LUCA 1N6HA 4K0KQ 1K8GA 2ZVQX 3N2IA 4Y0VA 3UATA 4AG5A 3ADCA 2EFDB 2IYYA 4IEEA 2E2HH 1TX4B 4DCTA 4GSYA 3O8BA 5AJWA 3AVOA 2O8CA 1OE0A 4PAMA 2FWRA 1H9SA 1L1OA 1HE8B 1S72A 1E0SA 1U81A 1VHTA 3W1BA 3RLNA 3P27A 3WRYC 3KKQA 1LF5A 4MH0R 4LJZC 4BA1I 3SJAA 1N25A 3T1HL 1YR8A 3CW2C 2AD1A 3RVBA 3U7HB 4KO8A 1SVKA 4DLSA 4ERNA 1Q44A 3AQQA 4MYCA 1V8QA 3HPQA 3V9PA 1NKTA 3A8IE 4A3FG 3U3OA 1F5NA 3CPEA 1NN5A 1UAAA 2ODEA 2J41A 3CB4A 1P4SA 3ZDQA 1A1VA 4AKHA 2K5UA 2XSZD 5JS7A 1W2GA 1B9NA 2ZI5A 1Q0UA 3FWYA 1U8YA 2B6HA 2JLQA 2P5SA 2F3IA 1TU2B 2L0XA 2NVYH 3RN2A 3C16C 3CRQA 2D2CC 2MSEB 1YHAA 1P9NA 4A3DH 1K9MC 1IM2A 3R20A 1M1YE 2ZEJA 5KOYA 1SVWA 2ORVA 3BC1A 4DCSA 3KJOA 4GOPC 4TLCA 1GKYA 3L2PA 5AUNB 2ZYVX 3VU9A 4UNNA 1CXZA 5FTJA 3ZH9B 3TS2A 4TLDA 5JCZA 2OLKA 1PHJA 4R4CA 2KE5A 2CLSA 1P72A 3A4LA 3A5UA 4BFXA 2C2HA 4RFSB 1S3GA 1D8LA 5CDFE 2E2IH 4KLNA 4EUNA 4YXWD 3ICEA 2GJ8A 4RD2A 2E8GA 1HUQA 5IYBH 2FV8A 4PO9A 2YC4C 1S96A 5J3BA 2CNWD 4EFNA 3AFPA 1Q46A 2GETA 2VP4A 4Q1DA 4WA7A 4JMPA 3NDPA 2CKZB 1E2DA 1HYQA 1KI6A 1TU3A 3A58B 4ZIRA 4JBKA 4LF5L 2VUMG 1R9TH 4JI2Q 3HOXG 2WWHA 2BV3A 4M8NE 5JSZA 3FDIA 4ITRC 4UP7A 1NG1A 4JI5Q 3CP0A 1Z7TA 2BWJA 1FOEB 2QGZA 2WSSA 3C41J 4OHWA 1QHHB 5CM8B 1UE1A 3PXGA 1Q8KA 2R7DA 4EPRA 3ECCA 2JLSA 2VY3A 1VQLA 5J4KA 3B5JA 4RCYA 2ZS9A 4DHEA 1SZPA 1YRAA 3QSYA 1GHJA 2BH2A 3ADKA 1E9FA 5FOUA 3RS3A 5B57C 3KXLA 4IVRA 4DCNA 2J0UB 2ZJ8A 1C1YA 4GKJQ 2R6CA 4BPBA 4X65L 3EPJA 4DV0Q 1GRNA 3QXXA 4FMCB 2MNAA 4XVRA 3QJYA 1E9SA 1HNWL 2JA5G 1NBME 4KFRA 4B74A 3S1RH 4JG2A 1AM4D 4QY7A 4I1UA 3RDPA 1SKYB 2F1MA 1E4YA 1Z6TA 3BGWA 2ZJ5A 1W3SA 5CJ2A 3U7GA 1E2IA 1WYDA 4MRNA 4AQYQ 5LB2A 3CCUA 2UUCQ 4FCVA 1E94E 3B6YA 2RAPA 4PG3A 5G3ZA 2EYUA 3ZS8A 2O8EB 4DLXA 2AWOA 3IGFA 4PZZA 1PMRA 5FPSA 3I8SA 5ELOA 3LX5A 4RJLA 2EXDA 5KPJA 3CIOA 4JJZA 4P0TA 4PAOA 3MSXA 3BORA 4NCKA 3CF6R 3B1WA 4DIDA 5EAYA 1QHHA 4YWMA 2CVFA 1EXMA 1QVAA 4U5XA 1KI3A 4OI0A 3SJBA 4L9WA 4BLQA 3LVQE 5C46F 2K7VA 3CH4B 3V4RA 2OEPA 4AIMA 3FKQA 3IRBA 1L2FA 1AZSC 4TT3A 2ODWA 5LMUQ 4EPWA 2BOVA 1VQ7A 2D06A 1TWFH 4C0LA 1K8OA 3AV0B 4FDBA 2XB4A 1Y8OB 3U50C 1KK3A 2UXBQ 2AX4A 1OXXK 1I50H 1JALA 1JJ7A 2ZPTX 4HI0E 2JK8A 3VR1A 1WMSA 4A3DG 2H57A 1CKOA 4DXAA 1QVGA 4PMWA 3DM5A 4NXNQ 4GT1A 3TLXA 5FBQB 3M4YA 3CR8A 1QRAA 2R6FA 2IT1A 2BKEA 3L43A 1OIWA 4GOKA 5L3VA 4QXAA 3EA5A 1LS1A 4P72A 4EPXA 3GLIE 1BDOA 4Z51A 4TMKA 3GTGH 3THYB 4M1OA 1XJQA 4PFSA 1OV4A 4F4JA 2FDCA 4HAVA 1EESA 2RGGA 5C4GB 4TMZA 3TJZA 2REBA 1AGRA 3P32A 2R92G 3TVTA 2IYSA 4BFZA 2NZJA 4A9AA 1I4TD 1HT2E 3HR7A 3WMEA 5CLLA 4NYIQ 4JVLA 4PHHA 2OCYC 3TVDA 3JVVA 2LKDA 2JEBI 4I4LA 1NMXA 1OFIA 1P61B 1PZNA 4NH0A 5GVSA 3AKYA 4S2EA 3TKLA 3HR8A 2CFMA 3HKSA 3U44A 2WAQE 1IBML 1QHIA 4LF4Q 2YJTD 1CR4A 5GQOA 3AGQA 4EFLA 4WIAA 1K83H 5F9FA 4XSGA 1CP2A 5JLJA 1SE8A 1KI6B 4ZIRB 1I6VC 1KSGA 1PFSA 3AEVA 1DOAA 2GCPA 2ONKA 4AYXA 1G41A 1N33L 2BCJQ 1CTMA 1Y1WH 1P60A 4B32A 2ZRGA 1IN7A 2ZTSA 4KHZA 3ETLA 4A3KG 4B71A 4KKSA 2ZJAA 4B3XA 5FUYA 2A30A 4LWCA 3R8FA 2J0QA 2WHXA 5GROA 1KC8C 3EPLA 3VAAA 2A8VA 2ANCA 2VBCA 1Z9FA 1SKQA 2W6IA 3LQRA 3H15A 1Z0KA 3HU3A 3T1OA 1HT1E 2X77A 3UG6A 3CCEA 2KHIA 4DV1Q 2VP2A 4LYFA 4DLZA 1HTWA 3EAQA 2NO9A 1GUNA 4LJ7A 1KY3A 3DM9B 3GEEA 4B3BA 1HQMC 4PQFA 3BZKA 3LBHA 1JB1A 1FPMA 2YTYA 3LA6A 3DVLA 1OB2A 4MKHA 1K8MA 1T5EA 1J8YF 4WXRA 2V6JA 1VQEA 2C98A 3PIRA 4Q9JA 4LWZA 2F1IA 5AJ3Q 2FX3A 4TMWA 1K8AC 5BN3A 2OTLA 1IBRA 3F3YA 4OWTB 4JCVE 3BRWD 1WQ1R 4M1WA 5JI3E 3TQCA 1E9BA 1Q1QA 1H9SB 1LM0A 1VQDA 2IYLD 3K1JA 2OV2A 2F9MA 3PR1A 1EIFA 3H0KA 1JPJA 1S1CA 2IC5A 1HZCA 1E69A 2B8TA 5HZHA 2JEOA 4DV0L 4UQOA 4A2QA 4XTCS 3EWAA 3WYFA 4OO1H 3JC66 5HCIA 1P73A 5BQ5A 3MAAC 3BS4A 4OQFA 1NSTA 1UPTA 3QXHA 2A78A 2GCNA 2UZIR 2Y0SG 2FGJA 4C2UA 1IBKL 1N0VC 2XEXA 2BMDA 1ZP6A 2IWHA 3SE0A 1KAWA 3NE5B 2E9SA 1NMGA 1XX6A 2IYTA 4IDOA 1YVDA 1GJXA 2Z5FA 2F55A 2YWHA 1SXJD 1HCZA 3MWJA 421PA 3Q7PA 4US0R 4XVUA 2JLXA 2W6JA 4PXAA 1QJOA 5K36H 1WCMG 4QJFA 1XEWX 2ZRFA 3A8KE 1ZNWA 1YZQA 2W2XA 4J15A 1ZRHA 5C3EG 2FEOA 2HCBA 4A4IA 1KDOA 4HIKA 4IFBA 3S1MH 1M90C 3RZOH 1E9CA 3V4FA 4E07A 4TQ9A 2YWFA 1NI3A 1A7JA 2Z0MA 4G5GA 1N2CE 5HR5A 4NXMQ 1HQYE 5EP4A 4LF8L 4HB3A 3EIHA 1HZAA 1M7HA 5L3RA 3OPOA 3QPWA 5GVRA 1W48A 1FYCA 4WJ3M 3K53A 3GO5A 2CDNA 3IKJA 3L0IB 5FBWB 4A3KH 1E2MA 3KJEA 3CCQA 1JMCA 4OI1A 3TK1A 1WBBA 2F43B 3A5ZB 1Y69U 1TWHH 2LWIA 2XNDD 4M1YA 1XCGB 2EYQA 3A8TA 4HB4A 1IONA 3UMRA 4EJSA 3OOCA 3PO3G 4DAYB 2N3SA 1JXOA 1MOZA 4NCJA 2VTKA 3GJ3A 4TMXA 1IAQA 4OQXA 1AIPA 2BMJA 1UBFA 3STBD 1VG1A 2AXNA 4FMBB 5KUTA 1CJKC 2BA1A 4C2MH 4X66L 4OWWB 3T1YQ 3U7EB 4HJ5A 4B3SL 1SVIA 3CONA 4OBEA 1S9HA 2IX3A 2IBMA 5J47A 3PUZA 3EPKA 4ACAA 3EARA 1KY2A 4C0JA 4N0EA 4JL5A 1VF5C 5FJ8G 2PI2A 1NLYA 2PMKA 4JI7Q 2WVJA 4AKGA 4ZCMA 3ZS9A 1E9EA 1M74A 2B21A 2GXQA 1CJMA 4R98A 2IEYA 5EUQB 3HOXH 2B7BA 2ECKA 3BAFA 1PLKA 2ZRLA 1A5TA 2IX1A 4QC2A 4BBSG 2NPFA 4C30A 4BY1H 2J7PD 3A6PC 4DV7Q 3OAAD 4BEBA 3OZXA 1Q1EA 5IYBG 3PCOB 5C4JH 4IDHA 1H8HA 3KLWA 5TARA 4KLKA 3Q85A 5D3QA 5AR1A 3ND9A 1R0YA 3B9PA 4EQ6B 4IVPA 4XWKA 621PA 1AQYA 4ZI3A 3FKIG 3C14C 1JNYA 721PA 3MMPA 5LD2C 5JEAG 1T3SA 1WF3A 3TH5A 4P3YA 1XU4A 2QY9A 3P4YA 2GAOA 4YHHQ 2OILA 1YU9A 4JLDA 3VA7A 4M0LA 4HLUC 4RCNA 1H95A 1YNJC 4P71A 3KX2A 1X3SA 1SXJA 2ZANA 3SHFA 1W36B 1PH2A 3EZ7A 2FFHA 1YITA 2FSGA 4URUR 5JBQA 4JYCA 5DN6A 3CCVA 4PO8A 2A5DA 4KHPL 3FMOB 3AVXA 5EE3A 4H1UA 1MABA 3K81C 1YR9A 1QVCA 3PVSA 1FNMA 3WMGA 2DHRA 2C96A 3FOZA 3ND8A 4KITB 5C0XJ 2HJGA 1GIAA 3U4ZA 3I5YA 4JYBA 4IQZA 1VQIA 2VP9A 3QXJA 4OXPA 1YZKA 1AJEA 3GJ6A 2EQBA 4LI0A 3HYTA 2PQAB 4A6XA 4M9QA 2G0TA 4NONA 2NGRA 4M1SA 1E9RA 1L7VC 1W0KA 3QIAA 1V5WA 1U9IA 2RGBA 4J0QA 2HIXA 3ZVRA 5CB6A 1VF7A 1HH2P 2K14A 2QAGB 5KDDA 4YQFA 3U4QB 1M8PA 2J0VA 4JI1Q 5SZKB 1KRTA 5BR8L 4HDQB 1Z6XA 3BJUA 2JA5H 4HUQA 3LLUA 3TR0A 5DO9A 3LBIA 4Z54A 2YWEA 2GCOB 4AIIA 1KO1A 1KAGA 2ZS8A 4DR5L 3BFVA 2Q21A 3AF3A 3K9HA 2NVTH 2FPMA 3OFND 4P33A 1W36D 2QL6A 4GNXC 3BG3A 1ETUA 3MD0A 4YWKA 3IPXA 3KZ1E 4JJKA 4KODA 3REGA 2KBFA 4RKEA 2R8RA 1K3RA 3SBDA 2EFHB 1X55A 4C3HH 1P9WA 1R10A 2TMKA 2A2ZA 4CT4B 2B63H 4QHTA 4Q4JB 4DZZA 1CR0A 1T5LA 2IHYA 4JOIC 5B30A 3DZDA 4PQYA 2AHOB 2A6HD 1FP6A 2EFCB 1LY1A 3CD6A 1Z08A 5LBIA 2PPBC 1KMQA 3F5FA 2V1CC 2PJRA 2OE2A 1Z0IA 5EZ5A 5K8IA 3FKSD 2EQSA 2NZOA 1DAKA 3IUYA 3EX7C 3SQXA 1XZQA 3RNLA 5CIQA 1E79D 3VMFA 2C9CA 1T8UA 3OIUA 5JWRA 2I3BA 2XXAA 1GHKA 2ZXUA 2HIVA 5HZKA 3JZMA 4PSKA 2D0OA 3GLGA 3GJ7A 4A3EH 4Q47A 1CRPA 4IOAA 1NVUQ 4QGGA 2G77B 3VKHA 1II0A 3F0TA 5E3HA 2O0KA 1KNQA 3BZCA 1U90A 1MV5A 2AFIE 1A2BA 3M3YH 4BBRH 4A3LG 1A4RA 1ZMXA 2ZI3A 4B43A 3GQBA 5JS8A 2JLYA 3EIQA 1S40A 1NBMA 4RCZA 1Y1VG 1TKWB 1J70A 1B70B 3T1VA 1T8TA 3A7LA 2KHJA 4Q19A 5K8UA 1KO4A 2A68C 4DR6L 2AK3A 2V7QD 4A1FA 4IXMA 1GRQA 2JLUA 1XTRA 1Z83A 1VG9B 3L0PA 4IRUB 4NBSA 4NE2A 4R7ZA 4ACBA 5L3SA 4IXNA 3K0CA 2DBYA 1NE3A 1MKHA 2CCZA 2KWIA 4P4SA 4JI3Q 3TR5A 3ULPA 3ZD7A 4EJSC 1K73C 1FJGL 1FJGQ 1EX6A 1EWRA 3SYLA 1VQNA 2IHEA 5K8TA 5KHOC 1IW7C 3T1HQ 2ZE6A 2Y0SE 1T0HB 3MLEA 3EBEA 3K0AB 4C0KA 1GVPA 2OCAA 4MYHA 1JE5A 2CWAA 1G21E 1UADA 1NL3A 1OXUA 3ONWA 4OQNA 2QTVB 3U61B 4HDOB 4ZKEA 1DBSA 3T1QA 3UDGA 5KSZA 2NQ2C 3TEHB 1HR0W 1V1QA 1XTKA 1XNJA 2QA5A 1DXMA 5K8LA 1W0KD 3LY5A 1Z2CA 5M3MG 4NMMA 2V3CC 3GD7A 2MMGA 4AKIA 5AUQA 3U3RA 1ZD9A 2BA0A 4NXNL 1FX0A 4M9XA 5FUXA 1EYGA 3CXCA 1Q3TA 1K6MA 1E2GA 1B0UA 2D7CA 2F52A 2B3GA 5G3YA 4DR3L 2EDGA 3EA0A 1E99A 1Z8FA 3GJ5A 2OCPA 1S1MA 4PC2A 1YBYA 2XTIA 1XMOL 2QRZA 3WHLA 4CYMA 1B23P 4DKXA 3LFUA 1OJLA 4GMDA 4NYMR 4X8OA 2GJAA 1CJTC 1N6KA 4A93H 2OBNA 2OFWA 3X1ZA 4B3RQ 2A69C 4F93B 4OK3A 3CNLA 4JLOA 4MRSA 2B63G 4H02A 5M5XH 3H94A 1KSHA 1VTKA 2ATXA 3TNFA 3SGIA 5GADl 2VQFQ 3U6BA 2VHTA 2P0EA 3UE0A 2JJ1A 3K7AH 4DB4A 2A68D 2QMUA 4JI8Q 2ZETA 3BH7A 1I94L 3QE0A 521PA 2C77A 2VEDA 4A3MH 2X19A 1XF9A 2ONJA 3P20A 1HNZL 2GJSA 3MGCA 2QBYA 2K50A 1A82A 4DSTA 2NZHA 2KCMA 4WVFA 3REFA 1SQ5A 4AYBG 3U6KA 3DLLA 1NG9A 1R2QA 2IEZA 4V0OA 1EQQA 2WM9B 2IYUA 1RL2A 4A3CH 2G1JA 1X8LA 2WWGA 4DR1L 4A0HA 3HKZE 5C1BA 3GTPH 2XITA 2XNSA 4GN5A 3G6EA 3GTLH 5FL3A 3HGBA 2DPXA 3HOWH 3G0HA 1PUIA 4BEJA 2EWVA 2IUTA 5E4FA 2NZ8A 4G5RA 2D62A 3KTAA 2FU5C 1KI8A 3CNOA 1I2MA 3IIKA 5IRCD 5LD2B 1QHGA 3VKWA 4X65Q 1GNPA 1NN1A 4DK1A 3K9GA 4XWOA 4JLKA 4DV3Q 1NN0A 3QKRA 4CEJB 2A6EC 2REOA 3LX8A 4DV2L 3B7GA 2E5LL 5JWOA 1HZBA 2CK3D 2V55B 3MCAA 2I5LX 2MSCB 4RVCA 1X1RA 1T3HA 2JATA 3VR2A 2K5HA 4HAWA 4ZCLA 3EZFA 1KZGB 4FINA 3B6EA 1A62A 3CZPA 1XMJA 1II9A 4B3TQ 5J4HA 3UKDA 3FFBA 1OIVA 4Q7MB 5A0FA 5KSYA 1N33Q 2A9KA 2ZE7A 3OIWA 3AP1A 1ELOA 4PSAA 4GP6A 1N6PA 2BC9A 3AVWA 2C5LA 3M7NA 3OYYA 2VH5R 4A3IH 1F2TB 1YZUA 1Q86C 2JLVA 3AKEA 3WXMA 3WYGA 2A5GA 2HHHQ 1JAIA 2R9VA 2KSQA 3UXMA 4JSTA 2LXJA 3SYKA 4AD8A 2WWIA 2B29A 3F2BA 2ZSFA 2Z4RA 1XCMA 1HNWQ 5CK4A 4JVMA 3ERSX 3LGJA 1PJRA 1SGWA 4C3JH 1RZ3A 3KFUA 2FA9A 2YOFA 4TSFA 1FL9A 3FP9A 3BDOA 2DCUA 4PPFA 4AKEA 1AH9A 1TWAH 3S1QH 4JV5L 1OKKA 4BLRA 4DR6Q 4TL7A 2JA1A 5KDOA 2QRNA 5KSPA 4QJ4A 5FBLB 3B9QA 1GKIA 1IOZA 4Q9IA 2IS1A 1DG3A 2JA7H 4L5RC 3RLFA 1S2MA 1TMKA 5IDVA 3ZQ6A 4FN5A 3PEWA 4YONB 1WFQA 3HYRA 4JI3L 1RRPA 3BERA 4QBHA 3GTMH 3RS2A 3SJZA 4AYWA 4BY7H 2YTXA 1JAHA 1KTVA 1UM8A 2ZJ2A 3RRMA 3OEHA 4A2PA 4YMWA 4HB2A 2JJQA 1DCZA 1XXHA 3PO2H 4GN4B 2BM1A 4KFTA 1E2WA 3BWDD 3GLIB 2ASBA 4JYAL 2NIPA 2AK2A 1X3EA 1HV8A 1L4YA 2GXSA 5HKKA 3GLHA 4W9MC 4TYPA 1AGPA 2K4KA 3PF4A 2V9PA 3DEFA 1KOFA 3BOSA 4ILEA 4PTLA 1CTQA 4EDHA 4IFEA 5IYDH 4QKQA 3HKZG 4Q4LA 1E9DA 1YIJA 3VR3A 2Q6TA 1H8ED 2FNAA 1P2TA 2ZJZA 4HYYA 4B3DA 4RFSA 1UDWA 2H18A 4AQYL 2JJ8A 4LJ9A 2R6DA 4MYTA 4BFVA 4LCBA 3U2QA 4GZYC 1EFWA 2O8FB 3UG7A 3C5CA 4BRUA 5AJYA 1ZCBA 2BEKA 3CWQA 2ZM6L 3SS8A 1CKMA 1SR3A 3IDQA 4B3CA 3GLGE 3EIVA 4HJAA 3BB3A 2J0SA 1IHUA 1T6NA 2IS4A 1Y14B 2DGYA 2OO7A 5K36G 2HXYA 4PPQA 5FLMH 4OWXB 3W5OA 2VYFA 4OQMA 2ZTCA 4P4TA 4TL9A 4PV1C 2BKUA 4JI1L 4OO1I 3KYHC 1O78A 4JL8A 3TAHA 4E09A 4TYYA 3L7ZC 1L2TA 1XTQA 2EFGA 5CB8A 4ALPA 1OXTA 1IBLQ 2XX3A 4H9GA 5DHFA 1UEJA 3UMSA 3C15C 3EPHA 1E3MA 1GZSA 3OEEA 3GTOH 2CJWA 4BXXH 2WJHA 4MQBA 4DLTA 2GJKA 1R0WA 4Q4AA 2GBLC 1NN3A 1ZU4A 4URYR 2NO1A 3EW9A 4WW0A 4ESHA 2A19A 1ZAKA 1CKNA 2ZSDA 4V0LA 4OO1G 1P2VA 3VHXA 3BIFA 3FPAA 4JI5L 3NELA 1KI1A 1YZNA 1HPCA 1VYTA 1W0JA 2GF0A 3O8DA 4B2LA 3K0FA 3EC1A 2CL6X 4JI0L 1FTSA 3B2EA 1GOTA 2O0JA 1JECA 3GEIA 1MT0A 4KCGA 2WB1E 1DTSA 1XPRA 2AXPA 2GWHA 4JL6A 2J9RA 3T5DA 4Q4AB 3H86A 3QG1A 4B3RL 1I6HH 2KJQA 3OEED 4BFSA 3B1XA 1E2LA 2DWOA 3M1IA 1FX0B 1PH5A 5D3MB 4YY3L 1XNRL 1BYUA 3L0OA 3CRVA 3Q5DA 1HNXL 2BBOA 2F7SA 2PEZA 2R7ZG 3S15H 2JASA 4A8JB 2RF4A 2A5YB 2PNRC 4U00A 3T15A 3VFDA 4LK1C 2GEVA 2QP9X 4BY7G 1KJWA 1G9XA 1JEEA 1E2KA 4A0GA 1MO6A 3PUWA 3OTOL 3U44B 1CR1A 3QY0A 4Q1AA 4QFMA 4A4DA 4B48A 1DO0A 2ZYWX 1IJEA 2K75A 2BH8A 4BGDA 3E2IA 5G41A 2EIFA 4A3JG 4GBMA 4Q4JA 3T06B 4IOLA 1PYBA 2PX3A 1OT3A 3EZ9A 5EE0A 1SVLA 1T3LA 4PPNA 4AURA 1VCIA 1H8EA 1Q12A 2RHMA 3RRYA 3Q9LA 1BIFA 2QM7A 2PLFA 3NHAA 3CCJA 3RRNA 1KIMA 3QXCA 1ZYUA 2HF9A 3BD9A 4M4SA 3GLFA 2J46A 4TT3D 1YNXA 1LFDB 4D26A 2O8CB 2P5TB 2UZ3A 5L3QA 3T1TA 1ZD1A 2ZR0A 1VQFA 4IOCA 3WRXC 5FBRB 1W4CA 2WP8J 4YWLA 1KI2A 5M3MH 4C7OA 2YOHA 2DFNA 2JJ2D 5HY6A 4XD7A 4G01B 5DI9A 4FWTA 5HE9A 3HOYG 4IFDJ 4JBJA 5JJLA 1G3QA 1B7YB 1YHQA 1P16A 1KNXA 1VECA 2CCKA 3CW2A 3KQNA 1JEDA 3VR5A 3WWVA 4LC0A 1Z5ZA 5B64A 2EJGC 3K70C 2QMOA 2ZRCA 1F2UA 2IYRA 2AKAB 3ASYA 4JLMA 4LUOA 3FMIA 3J80c 2H7VA 4LHVA 5EXSA 3GTJH 1E6CA 4GKKQ 1GP2A 1W5TA 2Q3MA 4Q1FA 4MNOA 4YC7A 1P8LA 4XTRA 1M7BA 4GNXB 2I0QA 1E1OA 2B92A 2VZAA 4IO9A 3K9LA 3OE7A 5DNYB 4L5SA 3PEYA 2CLCX 1XMIA 4A2WA 2JLZA 5AJZA 5J4YA 4ZDKA 1EFCA 4LJYA 1TQ6A 3E9IA 2HHHL 2Z43A 4Q7LA 4D0LB 1N34Q 3GP8A 4TVAB 4L9SA 1Q1ZA 1XMOQ 2JIZD 4JIMA 2DWQA 5BYJA 4IW3B 1YJNA 3H3VH 3M4PA 4NXML 3NDBB 2JA8H 1ZM9A 5E7NA 4URXR 1Z0JA 1Y1VH 1YEZA 1IXRC 1ZUHA 4Y0AA 5ELXA 4DK3C 1F2TA 1KDTA 1Z2AA 3HOWG 1XWIA 4LHYA 2AMCB 3J81c 2GILA 2ODBA 5CITA 1YKSA 2RHSB 3QKTA 1CJVC 1AE3A 1XJ0A 2H5EA 5J40A 4A3CG 3U3JA 1KJZA 4OHVA 5C0XI 3RRZA 4Q00A 3GMTA 4EFMA 3SYNA 4KAXA 3A1WA 4CEHB 4A3MG 3I4MG 1OSNA 3S17H 2ZI9A 3THXB 4CGZA 2UU9L 4DJTA 1FTNA 2HDNB 2IXGA 2WSMA 3B8HA 1PH9A 2DFTA 2IYZA 1E2VA 4X64L 2CK3A 2IYQA 2VF7A 2UUAQ 1ONLA 4GP7A 4ON9A 3B82A 4WBSA 1G8PA 2YYZA 3W6NA 1ASZA 4A36A 1FQJA 4BFTA 3A1TA 4GOJA 2YZ2A 1LW7A 3AQ4A 4Q9KA 3RC8A 5EXXA 4V02A 1AS2A 3C8UA 1O87A 4E03A 2FSIA 1J90A 2WBLC 2OAP1 1XRJA 4NL4H 4P73A 4LF9L 1YHNA 4GNKA 3U3KA 1IXSB 2NVQH 3CPWA 2D3WA 3DDCA 2IF2A 2WMNB 5FUWA 3WHKA 1Q81C 3AF2A 1HURA 1NVXQ 4LHZA 2ZRIA 3BH0A 1SXJC 4OJQA 3RS4A 4O0AA 3UK6A 3HPRA 5C4MA 2RB4A 1AZTA 1KO5A 2HLDA 5GJVC 4LF4L 1FGUA 1KXLA 1NVWQ 4I1SA 4KVGA 5TV2A 1S4QA 4MGZR 5FPYA 4D4KA 1HQCA 1US8A 4H0LC 1SMYC 4B3GA 2F4VL 3CF2A 2O8BA 4ESVA 1G7TA 4KU4A 4MGIR 4JSYA 3UDXA 3QF4B 3QKSB 1TXYA 1Z6AA 2WPDA 2UUAL 1UF9A 1DPFA 3BBPA 4PC1A 5HTKA 4DR4Q 1RC8A 5E7JA 4JYAQ 1WRBA 4POGA 3H2YA 1ZUNB 2FOLA 1S9DA 4XSHA 4B47A 3PIPA 3VR6A 3HOZH 3N5CA 5D3MA 3ER0A 4C0BA 4V0MA 2QP4A 4RZUA 5EJEA 4XWAA 1H8HD 2R7FA 1AS3A 3GTKH 2QI9C 3OHMA 2HYIC 3PG5A 4HJ9A 4IPHA 1U0HC 4GL2A 2ZI6A 3RS0A 4B2IA 1A2KC 2ORWA 2ANBA 3CBQA 4I81A 4BFYA 1E2QA 1XTIA 4LV5B 1D2NA 4ZPXA 4YMVA 1XFAA 2ZSBA 5A5GA 4BE7B 1KQSA 1G5PA 2WSSD 2FG5A 3KFVA 1X54A 3CPHA 3QVVA 1TADA 4X8MA 3MWYW 4HJ7A 4TN1A 3I72A 3NHBA 2F4VQ 3A36A 3TREA 1B8AA 4R4TA 4UY8C 4BA2I 1OHHD 1E0JA 1BO6A 3L82B 2GKSA 4URWR 3SEAA 2FPLA 1JJVA 3WDNA 3K70B 2K5NA 1E2EA 4MKGA 4UNRA 4JI7L 5BR8Q 2QPOA 4DT1B 3A1SA 3PENA 1OYYA 2CE2X 2J59A 3MXUA 5GAEC 4LBYA 3ZZTA 3FHWA 3C7KA 1VG8A 2O8EA 4B6EA 1F48A 1EGAA 3Q8XB 1MRNA 3NXSA 3RZDH 1DELA 4LRWA 3QF4A 4MGYR 3GJXC 2D7DA 1CSQA 1GD7A 3T34A 4BRWA 1G18A 1VQ6A 1G7SA 1VDZA 2EJMA 4R4OA 4BBSH 5C0XH 4JLPA 1E1RA 4LK2A 4MKIA 4ASUD 4A3FH 1M1KC 1COWD 2WB1G 1II8B 1VYVA 4HLDA 3KKNA 4TYWA 2WOJA 2BE5C 1XNQQ 2AD5A 2QG6A 4LHWA 1UWVA 1YR6A 5HE8A 2EWWA 1MRSA 4TMTA 1TQDA 1TPZA 3ULJA 1ZC3A 3P26A 1ZBDA 2F1HA 1Q22A 3LAWA 4GDFA 4FXPA 2HF8A 3ZVNA 2Q3FA 5A35A 1VQJA 4C0HA 4Q21A 2OCEA 3X1XA 2WWFA 4CZ2A 3I4LA 1XD2A 4X8HA 2ZI7A 4QNMA 2IY5B 5EP3A 4C4PA 1AKYA 2CHQA 4G7HC 1W0JD 1N9WA 2O5JC 4LF8Q 2D2EA 3K09C 1XPOA 1T5IA 3BH6A 2KBEA 3CC4A 1HA3A 4TLEA 1YJ5A 2QAGC 5FPHA 4G1UC 3JVUA 1NVVR 4CEIA 5CLQA 2UXCL 4G5QA 3NBYC 1QG4A 2PH1A 2YC2C 3CCLA 1G19A 2HYDA 3LVRE 4JV5Q 5FTNA 1JJGA 1Q57A 4LFCQ 2YV5A 5LMUL 3THWA 4IPGA 2FN4A 3AGPA 2NG1A 4LF5Q 4RZXA 2IUUA 4HUTA 5IP7H 2ZRPA 1R5OA 3NEMA 2K5VA 2AHOA 4R9UC 2QF7A 4FD2A 4JI6Q 3AFQA 3LXRA 4Z1MD 4G7ZC 1COWA 4LF7L 1JT8A 2ZJRA 2DFKB 2XZLA 3T12A 4JKYA 5DIFA 2WWYA 2KENA 3AEZA 3RWOA 5BWMA 3U3MA 4R2IA 1AKEA 1JQLB 3NEYA 1WI5A 1KMHB 1NTGA 2F1RA 3FGNA 5FOTA 4DNTB 1XJVA 5FOSA 2GZHA 1YZ6A 2GVBA 2GTPA 3N6RA 5JHHB 2PMZE 4JBWA 5JWHA 4IJHA 1XMQL 1W49A 2ZROA 2H1LA 4DDUA 5JHGB 1N36Q 3QQ5A 1Z6YA 1OIXA 3QEJA 1HTPA 2RCNA 5JEAH 2ZE8A 4LOAA 1NVVQ 1OH8A 1W2HA 3KL4A 2PZEA 1RJ9A 2QE7A 4HZUB 3A1UA 4M21A 1OW3B 4IHQA 4M53A 2VHJA 3NC0C 5JMTA 4TMVA 1NIJA 1U9IC 1UE5A 1OPXA 2J3EA 2R2AA 2V1XA 4R4IA 1GNRA 4JT2A 4RKFA 3UMFA 3I4NG 4LF7Q 4FIDA 2R93H 3DZ8A 3PEUA 4UP9A 3DKVA 3EXAA 1NSFA 2XOKA 1XBTA 5UKDA 1ESNA 1VQPA 1QUQB 1LABA 1R6BX 1ZUIA 4M22A 4DLYA 4L8JA 4UPAA 5TXGA 3UDFA 1TU4A 3HWSA 4DKAC 4ZDJA 1GKHA 1R8SA 1ASYA 3HOVG 4Q4HB 1OH5A 2VSXA 3PO2G 1YHBA 1CRQA 1OKKD 2G6BA 2JGNA 2YOGA 5IWAL 4PHGA 3RHFA 1L8QA 4KJZA 5C4XG 3FE2A 3FHCB 1GUOA 2XGTA 1E32A 3EQLC 1QHXA 1KSJA 4KI0A 1XTSA 3MUFA 4KYIB 2N42A 2WJVA 2BDTA 4LYAA 3R7WB 1FZQA 2DNEA 1II8A 2P6UA 5DGXA 1KSFX 2NO0A 5DE3A 4DLVA 4JI8L 5JEEA 4TZ0A 1GVNB 1ZD8A 2DUDA 4BASA 3O8CA 3CCMA 4Q03A 2HT1A 2QBYB 3ZZUA 2HT6A 4L5TA 2O8FA 2VPPA 1CS4C 4IJLA 3D31A 3CF0A 3OF5A 2W2VA 4OK6A 3I55A 5ANRB 2I5HA 5GAGC 2VSOA 3D6TB 4Q48A 1UE7A 3LQQA 4D4LA 1E24A 1YI2A 2F9LA 3H84A 3IILA 4JVNA 1DGSA 5DHAA 4DAMA 3QUSA 2NTYC 2QSZA 4DEXA 5BN4A 4NKRA 3I5XA 1Z63A 1PH1A 1KRSA 2NO7A 2GRJA 5C44H 1OYWA 1BYIA 4ABYA 2P6NA 4TQUS 1GG2A 4GI7A 3H3VI 4Y52H 4DV5L 1O3YA 2ZYTX 2ZTDA 4DWJA 1OLOA 5J4VA 4V0KA 1HEIA 1E98A 5AK0A 1H9JA 1IBLL 4LBWA 1W44A 5KPDA 2D2FA 3E9HA 5C3EH 1E2NA 2O8BB 4ME3A 2IYWA 2YINC 4D4JA 1OHHA 1T91A 1HE1C 2CNWA 4UJ5A 5C4XH 2CCGA 5E7IA 2VQSA 2GXUA 4IVQA 2BJVA 1RJ9B 4NYIR 1I94Q 2GEDA 3VQTA 1OF1A 4HEJA 2UKDA 4ZO4A 2ZM5A 1TUEA 2N1BA 2UUCL 2V4DA 2YNMA 5JZVA 3FMCA 4HIOA 4A3BG 3HOVH 1BMFA 2A5FA 1H65A 4M9ZA 4NU0A 1LTLA 5KTYA 2R92H 3MRSA 1HR0L 3KKPA 3VNUA 5IP9H 4LNQA 2UXDQ 1UEIA 2RHDA 3LV8A 4GFDA 1E1TA 2B8FA 4L16A 3TBKA 3UWOA 3G71A 3M4OH 3CNNA 2F43A 1V43A 4BWYA 4QGUA 1LF0A 3JAMc 4B3SQ 1KZ7B 3GJ4A 4QBFA 4O2DA 4QL3A 5KYKA 2WFWA 3LNCA 1Y8PB 4WXPA 2XTMA 2OFXA 1KK2A 3V00A 3A1VA 2JDIA 1RRFA 4JLBA 2C04A 3RC3A 4A92A 2FH5B 2O8DB 4DLWA 3UIEA 2Z0SA 2RH5A 5FLXc 2XTZA 2LXKA 1H9RA 1RIFA 2REXB 1XTDA 1KHIA 3I32A 1GUSA 3L8YA 4FMDF 4P4SB 3CRRA 2RKOA 4FCTA 4KXFB 2OESA 1VQ4A 1WBDA 3RAPR 2GVDC 2ZS7A 1EWIA 2CCJA 2PZFA 4RMFA 2BEJA 3E1SA 5JRJA 3F2DA 4LX0A 4QM7A 2EJFC 4RG1A 3BB1A 3D7MA 3MG9A 3WP1B 5KNDA 1D5CA 3ZZ0A 3SDZA 1N5KA 4KBGA 1FMJA 1ZJ6A 2RGCA 2IYVA 4ZDWA 3SBEA 1W4RA 5FI1B 4H1VA 4GN3B 3HU2A 1VCOA 2RGXA 2G3YA 5H68A 4AG6A 5FH9A 4GZLA 1XXHB 3TE6A 3GLIA 4Q9HA 3GLGB 4POAA 5EZ6B 4GOPB 2QROA 2AKWB 1E3PA 4GKJL 4NPSA 3DL0A 4OK5A 4QHSA 1RKBA 4G5OA 2F6RA 3I92A 5H1SE 1XMQQ 5J5CA 4B34A 1E0AA 1VCMA 1G51A 4PO1A 4DIEA 5LDDC 1OH6A 1GUGA 3Q5EA 1HY3A 1CFMA 3KLRA 5IF9A 2UXBL 1CSPA 1X6OA 2ID0A 3H4MA 4RD3A 1OFHA 2ASEA 4BLOA 5AUOB 1Z29A 3CX6A 2ERXA 3QXSA 4GLXA 1ZINA 4G3XA 1C9OA 2ZUBA 1P6XA 3AUYA 3K8AA 1KK0A 1EWQA 4KKUA 3KDFA 5BW8A 3U58A 2OBLA 4PAQA 1IN4A 5E95A 5FI0B 5FPTA 5G53C 2V54A 1F60A 2OCBA 3C5HA 3HP1A 4OX9L 2IW3A 3MEFA 1Z22A 2P2LA 4HAXA 4WAUA 4HAUA 2ZU0C 2NVXH 1YQTA 4Z1MA 3G48A 2AL7A 2OM2A 3QI2A 2VHUA 4F7WA 1GUAA 3MWKA 3K0SA 2IXEA 2GK6A 1S3OA 4DV4L 1DAHA 4DV4Q 2CL7X 2WKPA 4B6FA 5DI3B 4DV3L 2GA8A 2ZTEA 4M2LA 3NH6A 5JFGA 1JBKA 2MMCA 2QMHA 5GAHC 2QA4A 1N0UA 4KBFA 3SN6A 3WNDA 1H9MA 1SVSA 4M1KA 4QJ3A 4YCWA 4DK0A 4YDHB 3CX7A 1W47A 4Q1CA 3S1AA 2VSFA 1XEWY 4YDSA 1HJPA 5CJPA 4A0RA 1VPLA 1U5KA 1RVDA 3CRMA 3UDIA 1SXJE 3NTUA 1ZIPA 2AR7A 5IK2D 3QF7A 2HQLA 3GLHB 1UKVY 3AF0A 1VCNA 5EXTA 1E7ZA 4DNIA 2NO6A 2XJ4A 2E74C 4M1MA 1OFUX 1IY2A 3KTAB 3AH8A 1XD8A 1JR3E 2Z6KA 3ZYCA 1XDBA 4O0MA 4M9SA 2UUBL 4YMUA 1WOCA 4B3MQ 1KI4A 1M7GA 4C0AC 2QE7D 3EC2A 3QBVA 3NBXX 4DDWA 4MKFA 2J1LA 4NYJQ 2ZQ5A 4RD4A 1KJYA 3OTOQ 3TIFA 4UP8A 2IHFA 1PV4A 2EW1A 1W4AA 2PT5A 2QNRA 3AVQA 1D6JA 4JLVA 1X86B 2CVHA 3M6AA 5DLQC 2JAQA 3W90A 1G1MA 4POFA 1VQMA 4KSBA 1L4UA 4QBGB 1UKZA 2Y8EA 2AUJD 1EFRD 5KSOA 2RGDA 2CHVA 3FTQA 4RSGA 4F38A 1KDRA 1Z0DA 3PQCA 5KO2A 2IHBA 3SU8A 4TQAA 1SULA 1K5DA 2HUPA 4OX9Q 1XEXA 2PX0A 4JZKA 2MO0A 2ZR9A 1G5TA 2NOAA 1G17A 2QM8A 4TZ6A 1R7RA 3MJHA 4LY6A 4HAZA 1ZKOA 4PC7A 3ZVMA 2XGJA 4KVAA 1OXVA 1LB1B 2FSHA 2H92A 3GJ8A 3FMPB 4QL5A 4FMCF 4IDNA 1D7QA 5LMNQ 2WJJA 2OSBA 4UKDA 5AJVB 4BFWA 3KQUA 2YKGA 4NPHA 1BKDR 2W2TA 3LD9A 2W58A 2QQEA 3W9YA 3AM1A 1ANKA 2C99A 2H17A 2JE6I 4FWIB 3RSOA 3T61A 2P67A 2VW9A 2QTHA 1KYIA 4LBZA 3THWB 3MJRA 3K09A 4P4UA 4KMUC 3ICQB 2WICA 2QGNA 4L5BA 1J7KA 1E2HA 1IQPA 2YHSA 5DN6D 2Q2HA 4UXIA 3Q8DA 3IQXA 1E79A 3NBZC 2VUMH 2E76C 3M4QA 1MO5A 1TQ4A 2HXSA 1RPZA 4K8OA 3ZJYC 4Q9LA 5C0XG 2FEMA 3HDTA 3CRLC 2VS1A 1JQJC 1N5LA 4PHFA 3IEVA 1ZM7A 1VQHA 3PUVA 2C9OA 4GMXA 4V0ME 2L5TA 3IO5A 1J5EQ 4HATA 3SR0A 3GLFB 4QQBX 4F92B 1Z6GA 4DR2L 1U8AA 4DR2Q 2GESA 1NJIC 2PEYA 1E2ZA 1TTTA 1Z47A 2OUKA 2FFAA 1L0WA 5IY0A 4HAYA 4Z8XA 2ZRBA 2PI2E 2IWRA 2EFEB 4URVR 1CEEA 1ODFA 3VX4A 3FYHA 1ZM4A 4B2PA 4QGAA 4PX9A 3F2CA 1ZM2A 2J7PA 2LCFA 4QBIA 3HFZB 4V0NA 2OXRA 3DOFA 1ESMA 1F2UB 3GCGA 3KDSE 4NP6A 2C8VA 3R7WA 3FKIH 1C4OA 2OLJA 4MUBA 4JI6L 3LW7A 1XMSA 2LKCA 2GJ9A 4TTQA 4DUGA 4KN7C 4F4CA 4MRVA 4AY2A 4CEIB 4BZXA 1KL9A 1TWCH 3EG5A 4PHTA 3AKCA 1KGDA 4LZZA 4QJ5A 2ZM6Q 1W1WA 1XB2A 3CCSA 2BHRA 3FFAA 3TMKA 4ZCIA 2MFIA 4HSEA 3LXXA 4MDFA 3RS7A 4DR3Q 4GOXA 2DWPA 5IP9G 1UFQA 2PMDA 1G3RA 4Q4HA 4EIWA 1DAFA 1E9AA 2YVUA 4ARZA 4DR7L 2VIIA 2C03A 3M85A 1NMZA 3D4RA 1N36L 4OGQC 3IHWA 3CWZA 5DYIA 2QPAA 2FF7A 1G291 3QENA 1UKEA 3OEHD 3LWNA 3O8RA 3KB1A 2MSDB 4Q1BA 3SFVA 4L5QA 1VIYA 5KU1A 5J4LA 2EU8A 3THXA 2X2EA 3BK7A 4AH6A 1IBMQ 1FMLA 1G16A 1P3JA 2WAXA 4LHXA 3UWKA 5FTKA 1X65A 2BJWA 3ASZA 4HDCA 4LBVA 1XD9A 2ZRAA 3U4VA 2ZRNA 4IOKA 4UXJA 5KDLA 1QBKC 3LNNA 1VG0B 4XH9B 2NN6G 4LFAQ 1RYHA 1YZTA 1E0KA 3U60B 4BUJA 4WZAE 4P74A 3D3QA 5C44G 3X1DA 1IYVA 2JIZA 2WIAA 4D0GA 4APVA 3W3ZB 2A7QA 1BS1A 3RANA 4EKDA 2XSZA 4HB0A 4TSFD 4CIDA 1SFOH 3SQWA 3Q72A 2ZRMA 4B44A 4JLJA 5EE5B 4O3MA 1PLJA 4IDQA 2W6JD 1NNEA 1CIPA 4KSCA 3X1WA 4IFDG 5LPNA 1EIYB 3AVVA 2ZYUX 5TB5A 3FPPA 1VQCA 2UUBQ 1G6HA 3T35A 5FR2A 1MIUA 1C9KA 3KDFB 2HLDD 3E0EA 4KKTA 4HZIA 4JBYA 2JEAI 2JCSA 4LFBQ 3UANA 5IWAQ 1KIXA 1N5JA 3DMNA 1VQAA 5M04A 3PUXA 1GUTA 4MITA 3OAAA 1LTQA 4I1OA 2EVWX 4Y7NH 2XZPA 1WCMH 3I61A 1Q20A 3LW8A 4CW7A 1AA9A 1L1OC 1YE8A 2QT1A 5TMPA 1W2BA 3GJ0A 3DOEA 3CMAA 4NCNA 2QENA 3AF4A 4I99A 1PUJA 4G0NA 1X1SA 5IYCH 3IFTA 4OHXA 3ZLJA 1O7IA 2A3RA 3IIJA 1ZNZA 1BBUA 1DAEA 4YCVA 2BVNA 1DS6A 5H70A 3BJIC 3QBTA 3TQFA 1GTVA 1CUKA 2MO1A 4UNQA 1VKJA 1M34E 1KI7A 4F91B 3RYTC 1P2SA 4MUAA 2ZAOA 2ZJPA 3N70A 5CYOA 1VQOA 2ATWA 2QGQA 4JT4A 4DUYQ 2OFOA 4O2LA 1VS0A 4YXWA 4NCIA 5DSZA 2C95A 1R5BA 3RLOA 4BECA 5FPKA 2JXMB 2JA8G 4HZUA 3VR4A 4LC1A 5LMNW 1A63A 1F6BA 1PYSB 4KV9A 4FMDB 3X1YA 3SI7A 2R6AA 3KJHA 1US8B 2A1AA 4LFBL 3I56A 1X56A 2QEXA 1QHNA 5C2JB 2FJUA 2I1VB 4KFUA 4X6AH 2DB3A 2GZAA 2ZE5A 3PEVA 1IBKQ 1N6LA 3AVTA 2R44A 3HU1A 5GJBA 5HCNA 4P31A 3AVUA 2EVBA 5FOXA 2WJIA 3KUDA 2GVZC 3I2ZA 4HLUA 4A82A 3RR5A 2X1VA 1OB5A 1J99A 1EG7A 1QZGA 5FOVA 2I1QA 1G8YA 4C0QC 4OKSA 3PITA 4B75A 3QKUA 3TQYA 3P1JA 5BYKA 3UE1A 1JR3A 5EP1A 4RD1A 5JRZA 4X64Q 1KD1C 1DAMA 3NEJA 4FCWA 1G8HA 1VQ9A 4K81B 1N6OA 2G88A 3A7AB 5IK2A 3WBKA 5FL7A 4BZQA 2IA5A 3BXZA 3VX3A 1J5EL 2VF8A 2QP3A 4KYUA 1FW6A 4AK9A 1YJ9A 1X6VA 2E1RA 1MH1A 5IP7G 1SHKA 1QG2A 4UJ3A 5F2EA 4TYQA 3WYAA 1VQBA 1GKUB 3M0EA 1G4AE 1GL7A 2QAGA 4YCUA 1X3FA 1G8FA 4DC9A 3R9XA 2JA6H 1IY0A 4AC9A 3PGZA 3LLMA 3TRFA 4EPTA 1DARA 2E5LQ 5JEAJ 5HPYB 1TEXA 2SHKA 1WDTA 4XIGS 4XD7D 1SVOA 5DISB 3T5GA 3CLVA 1CKNB 1N6NA 3QEOA 4RFVA 4B33A 5C18A 1GO3E 4D2IA 4X62L 4X62Q 1XD2B 2VO1A 2G9NA 8OHMA 2VNUD 1JI0A 4N0DA 3SOPA 2VP5A 1J8MF 2J87A 5IHPA 2UXDL 2O52A 3S2DH 1PA6A 1F3OA 3SC3A 2XZOA 2WWWA 3VTKA 2IS2A 4C3IH 1VQKA 4G7OC 2WJYA 4DSNA 3W6PA 1Y8NB 3OFNA 2QEQA 3KQLA 1KI9A 4IKEA 2KI5A 4EPVA 1JR6A 1EFRA 4O2RA 1PH3A 3KF8B 4PC3A 1SKYE 1E2FA 1KHTA 1D2MA 2CE7A 4YLGA 2ZUDA 1U2RA 5F9HA 3CCRA 2Z83A 3QKSA 1IZ6A 4LPSA 1ZM3A 2NN6I 3AF1A 3B1YA 2V1UA 3LDAA 4MYUA 1QVRA 4DV7L 5DYGA 1EK0A 3AB9A 1TEVA 2G0NA 4LF9Q 3I4NH 3GEHA 4H13C 2OHFA 3RWMB 4I7ZC 1RW4A 5AWFC 2PQAA 2R6GA 2WAQG 5JI2E 2WMOB 2VL7A 1SLJA 2W6ID 3LWUA 4D80A 4OI2A 4DLRA 1PH7A 1R0ZA 2D74A 4P75A 3ZQJA 1VQ8A 2KA7A 1S3SA 3KKOA 3J7ZC 4LYHA 4DCVA 5CYPA 3PJRA 3W5IA 4B73A 1XTJA 3T51B 3K9NA 3OESA 3L8ZA 3I62A 1DVRA 4D25A 1UJ2A 1I5FA 3ULLA 1K8RA 2OBMA 4A76A 4WZBE 3N2EA 1VMAA 1IN8A 1X8JA 1JB7A 5EUMA 5L3QB 2IF0A 2OAQ1 2ZRHA 1Q7YC 2FZLA 2KB0A 3GFOA 2AN9A 2GBLA 3Q7QA 4A75A 4BQSA 3K0FB 3E5HA 2Q2IA 2GEUA 2CL0X 1JPNA 4GZMA 2Q2TA 1SN8A 5DH9A 4LV6A 3SZRA 2WPDD 4Z8YA 4NHOA 3WNBA 3TUIC 2GAAA 4DNRB 3W8NA 4TTPA 1P7CA 3G82C 3S1AB 3OIYA 6Q21A 1WE2A 1JR3D 2O5IC 1EQRA 4JI2L 1G20E 1ZCAA 2H16A 4W5WA 4JBXA 3U5ZB 2XTNA 2QSYA 4E22A 1P9RA 3U7FB 5DI3A 4NCHA 3ZJYA 3S14H 1GWNA 3J7A5 4CRWB 1HR0Q 2E2JH 4A8JA 4X8LA 1A8VA 1Q90A 3CRKC 1T0JB 1Z06A 2IK8A 4EX5A 2WIBA 3CPFA 2WKRA 1E1RD 2Z4SA 3KOJA 4AYBE 5TVKA 3WY9A 1NJGA 4O25A 3AP2A 4DT1A 4PZLA 3S2HH 2ZRDA 2IL1A 3FVQA 2IYXA 5CK5A 1C0AA 2MQHA 1WCV1 4W5HA 1LVGA 1BMFD 4M1TA 1OFTA 2YU9H 2WWXA 1XJCA 3BFXA 4KFSA 4RZ3A 5JECA 3CC7A 5DLQE 2PJZA 1GILA 3K8YA 3WBJA 1N0WA 3DO6A 2O5VA 4OHYA 4UNPA 2ZJOA 5HGQA 4LYJA 1ZYRC 1VIAA 3CM0A 2Z6KC 2RGNA 4AWXA 2XAUA 2ZREA 1S0UA 2QQ0A 2W00A 4IJMA 2WTUA 2ZU6A 4LUVA 2OWOA 4JI4Q 3GFPA 4QNRA 2ZRKA 4UXHA 1SRUA 5FTMA 3TW8B 3IBYA 2WJGA 1QHSA 2O0HA 4BLPA 2Q9AA 1DAIA 2DR3A 4IFDH 3K70D 2W0SA 2FPKA 1P2UA 4YHHL 3IEUA 3CKLA 3NWJA 3J81k 1G64A 4LJ8A 1I4DD 2RMKA 2OTJA 1XCPA 3T53B 3KFXA 1CU1A 5GADC 2ZVPX 1E2PA 4A15A 3I4MH 1IL2A 1NKSA 1NMYA 2C9YA 2IS6A 3QNUA 5AJXA 1J6QA 2HV8A 1W4BA 4DV5Q 3S1NH 4II7A 3T56B 3GFTA 4ZV4A 4MRRA 4DR7Q 1AQUA 1IXRA 3GDEA 1EFHA 1XXHE 3THYA 2BE5D 3ZD6A 4A3IG 2FFQA 4QOSA 3OW7A 4NB3A 5L3SB 4DPGA 1Z3IX 2A6HC 2QMEA 3TSOA 3FHTA 2ZRJA 2VQEQ 1G7RA 3VNVA 2Q0HA 1TUIA 5EQTA 4IPCA 3FB4A 4GRAA 1LYLA 2C35B 3A4NA 3R8CA 5JSZB 1UE6A 1SMXA 3TSZA 1FUUA 3CR7A 4I1VA 3ZGXA 5A4JA 1N34L 1Z0FA 4PSVA 4ASUA 3B60A 2H5XA 1U98A 2WZQA 4DB2A 3SNHA 1KO8A 1GFIA 2XOKD 4LJ5A 1JJ2A 1YZGA 1QDEA 2CLDX 3STBC 2AKYA 1EFTA 2JJ2A 2CXXA 4TLAA 1TNDA 3O47A 5G40A 2RGNC 4JBMA 2JLWA 1CKEA 3HOZG 5FOWA 4B3FX 1NIPA 3K0XA 1HNXQ 1VYUA 5FTLA 3LBNA 4GLAC 4DCUA 1BH2A 4DDVA 4A3GH 1NLZA 1EUJA 1VHLA 2LMCB 2PCJA 3RNUA 2PCLA 4L15A 5JJKA 2H8KA 1NLFA 3OW2A 1BKBA 2CWPA 1I2DA 2CW0C 3AVYA 4DUZQ 1RIPA 1P62B 1Z07A 2E87A 3TSWA 3FHOA 1X3GA 4RD6A 4LGMA 2KCCA 4PPGA 4OJKA 4FI3C 4MDEA 2J5XA 3WNCA 1MJCA 1KKMA 3EWSA 1GITA 3W8RA 3KJIA 2O8DA 4R4QA 1G3MA 1OTCA 4PZYA 3THOA 4MZ9A 3R9WA 1GL6A 1SHZA 1GSIA 4L4UA 4JKIA 5JEDA 4K0KL 1SXJB 3CX8A 3H0GH 1O7LA 1GL9B 2B8GA 2Q3HA 4AI6A 4RY2A 4YMSA 2ZIAA 2ODNA 3GLHE 4MA4A 4HUQB 3BU2A 1KK1A 2VP6A 1KDPA 2CHGA 4PZ6A 3U9SA 4B35A 2DYKA 5H8WA 4C0SA 1Q1BA 4A3JH 1NP6A 2VQFL 1GRRA 1ONBA 2B8WA 3EZ2A 3TAUA 1TAGA 3H0GG 1DE0A 1LV7A 4W5JA 3CUEF 5F98A 2BCGY 3P4XA 4NTZA 4OQLA 1IYUA 4DK6C 1N5IA 2JJ1D 1E4VA 2VQEL 1PH6A 3CRW1 3I8XA 2ATVA 3KXIA 4PC6A 3KKMA 5EXPA 4QGFA 2Q9BA 3CF5A 4U02A 1TL7C 2R7ZH 4HIDA 5LB4A 4B3TL 1Y63A 3SHWA 3DMDA 3X2SA 4Q7JB 4DDTA 5BXQC 1VQGA 4P32A 3KQKA 2D0PA 4DEYA 4MTNA 3E70C 1NBWA 5FL7D 3B13B 4ZKDA 2CJWB 4C2TA 3ZVLA 2I4IA 2IXFA 3M9BA 2AFHE 2VA8A 2IUSA 3A4MA 4A3GG 1N3BA 3EZ6A 2R62A 3W1GA 1D9ZA 2WOOA 3BB4A 4US2R 2XXAB 2RGEA 2PZGA 4WOPA 3K0AA 4B3ML 1SVMA 2GXAA 3I4OA 2GF9A 2N8NA 4FW9A 1PH8A 3WP0A 1PH4A 1UBEA 2V6IA 4Q7KA 1NY5A 2BMFA 4DR5Q 2VP0A 5JJIA 1ZU5A 3NG1A 4KN4C 1G3IA 1SROA 3K7UC 4CT5A 4LJ4A 3TW4A 4JS0A 1H9KA 4DUZL 5KNCA 1Z28A 1DD2A 1QZHA 1ZIOA 4R2HA 5EE1A 3ZIAD 4JVSB 1W36C 5B2ZA 2QU8A 5KNBA 4EQ6A 4GS3A 1U0JA 1R5NA 2ERYA 4HLQB 4US1R 2ZJQA 1YR7A 4D6PA 2GHIA 2FXQA 2WV9A 3DM3A 1PLLA 1FR3A 1XNQL 3EIEA 3BE4A 2D5DA 5FLMG 4V03A 2JQOA 5AJ3L 2KCTA 1ZW6A 3CC2A 3NKVA 2Q8IB 3PF5A 1WA5A 4BBRG 2ZSAA 5FR1A 1WXQA 4DLUA 1I3QH 1EFUA 2GZDA 3NC1C 2PBRA 2R65A 3HOYH 3TRZA 1QUQA 5HKKD 3HOUH 1K5GA 4HIMA 3QPUA 5SZIA 1RFLA 2A5JA 4D0NA 3DKPA 2FFBA 1X9NA 1R4AA 4A3EG 3J80i 2Q2UA 5GJCA 4CVNA 4TL6A 5IE8A 1NBMD 4DVGA 3RABA 3BFKA 3F8TA 4CEHA 3W3AA 2N49A 1UEBA 2AUKA 3JAMi 3NBHB 4HR7B 4IOJA 1ZVQA 1RRCA 2QTFA 4LSGA 4DV6Q 2F3RA 4DV6L 5H1YA 3PUYA 4HJ8A 1UBGA 4GOPA 1I4LD 4LFCL 4Q66C 2BBTA 4EAQA 3I1FA 2XJ9A 2FZ4A 3QKRB 4CEJA 1P5ZB 4CDGA 3IIMA 1RYFA 2PCFB 5FJ8H 2VHCA 1YVCA 1W7AA 3TUJC 4W7SA 3GPLA 4OI4A 2OQ0A 2FSFA 1NF3A 3AKDA 3L0SA 4U7DA 5P21A 3ZIAA 1XEXB 1CLUA 4MRPA 4LJ6A 1Q21A 1EX7A 1QZXA 4RZ2A 4IOMA 1R0XA 4GPTA 4DR4L 2BM0A 2WKQA 2OZEA 3QG5A 4H44C 3PO3H 2F3TA 4TWZA 4DBLC 5EE9A 1UKYA 5TDHA 2RHQB 4JK1C 5M3FH 1N6IA 2P3SA 1CR2A 2X8AA 4N1AA 1IW7D 3ADBA 4JC0A 1FL0A 1N8RC 2P65A 3U4QA 5CDFA 4D81A 1N32L 1LNZA 2JA6G 4BLSA 3VKGA 2GN5A 4LF6L 1TWGH 2CEAA 2ZAMA 3W5JA 3I73A 3G4SA 4DSOA 4TYNA 1G5RA 2B7CA 1CI3M 4QHYA 1G8GA 3CPJB 2N78A 4LJAA 1ZNYA 1GAJA 4E5UA 1WB9A 3QPVA 4B76A 2J7KA 2YTVA 4LPKA 4IFDI 1YNNC 2I5MX 3S16H 1G6PA 1KKLA 2BBSA 1NRJB 3L2OB 4TLBA 1V9PA 1XZPA 2ZJBA 1IN6A 1MO3A 1NY4A 1KAOA 2F1JA 2FMXA 3KB2A 3IBGA 5L8VA 2LSSA 1YRBA 4OHZA 4A0FA 4BXXG 4L8GA 4NYJR 4QGHA 3VDYA 1PVOA 4ZI2A 4QM6A 3HJNA 4XVQA 2QZ4A 3EN2A 2W83A 3ADDA 4PQRA 2CQOA 1YJWA 1EWHA 3B1ZA 2HJVA 5B58C 2VL6A 3J81j 2RGAA 3IQWA 4R1JA 3IPYA 3UPUA 2J45A 5CIWA 2QUZA 1A6XA 2XNDA 2ZR7A 1Q3HA 1ZC4A 1T4GA 1BOFA 1DEKA 1U99A 2QPTA 2V4ZA 2A69D 3MFYA 3VU9B 3KQHA 2CMKA 4DV2Q 4S35A 2KBNA 4PANA 221PA 2DNCA 1HH4A 3MWLA 1HZ9A 1DG1G 1DO2A 1TF7A 4Q1EA 4LF6Q 1IN5A 4GKKL 4N3NA 1IYJB 1M2OB 2Q9CA 3CQZH 4LFAL 3NBFA 4KLZA 2BIFA 5AUPB 4CF7A 2K33A 3A0JA 1RE0A 4A8JC 1AS0A 1MO4A 3DXJC 1U0LA 2ES2A 4KHPQ 2OXCA 1IJFA 3CH5A 2ALYB 5IYDG 3J81i 4JI0Q 1TQ2A 1WP9A 2FE4A 2QT0A 2K52A 2VLIA 4NDZA 5M3FG 1KMHA 4BY1G 2G1KA 2ORIA 4DR1Q 5SZJA 2GCOA 1W5SA 2ZITA 4BZPA 1FVIA 4UNSA 3NVAA 3QOFA 1FFHA 3B78A 4A3BH 2WAYA 2JDID 2ZI4A 5JCPA 1CULC 3Q3JB 4TKOB 4LDJA 3B1VA 1XMVA 1MJEA 1NMFA 3PIOA 1N32Q 2DN8A 2OT3B 1BVSA 3LH5A 3LO5A 4QG7A 4YMTA 1XEFA 2JA7G 4DV1L 1IXZA 1AE2A 2PNHA 2G83A 3NENA 2GDJA 2A6ED 4QIWE 2E75C 3KF6A 1E1QA 4LW1A 4ARZB 3RN5A 2ZSEA 5SZHB 3WMFA 5BN5A 2PT7A 4RD0A 5TY0A 4AYTA 3T1YL 2IX0A 3NIBA 4Q01A 3VHLB 4ZDIA 1KO7A 3FMFA 1JJCB 1TF5A 2GNOA 3OIVA 1GNQA 3AUXA 2VHQA 4IPDA 1XP8A 3DPUA 4OYHA 1FNNA 2JLRA 2W0MA 3A74A 4F4IA 3TGPA 1Z0AA 3JZAA 4WZ6A 1Y1WG 3LRPA 3W6OA 4DUYL 2NMVA 5LMNL 2X2FA 1OXSC 3QVUA 1G4UR 2NN6H 3RSLA 2UVQA 2ZUCA 4DUGD 3PV0A 2HCJB 3KJPA 1P75A 3HOUG 1E22A 1Y3AA 2UXCQ 5E7MA 3GLFE 3GTQH 3B85A 2L15A 3DHWC 1LS6A 2QN6A 4Q18A 1OH7A 1NY6A 3SFZA 1AN0A 4QRHA 1K0RA 1DAGA 3NH9A 1R8QA 5GJWC 4BLTA 3RS5A 4GLVB 1GM5A 1J2JA 3W34A 1D9XA 3F1ZA 4JI4L 1CJUC 3K0CC 4DRZA 4IEIA 4EQ5A 2AWNA 4K46A 2PL3A 4A6PA 5ELNA 4XOIA 3R9IA 5FBVB 5M5YH 1M6NA 1G7CA 1DADA 1U94A 5IT5A 5F3WB 3AVPA 4Q5IA 4DSUA 4G5SA 3KXKA 1BBWA 1LUZA 1GDDA 2R93G 1S8FA 1L1OB 1WJJA 4YY3Q 1XNRQ 1CBUA 1ZNXA 3G5UA 3OE7D 1XPUA 2XB2A 2OQKA 5M5WH 1FQKA 1QF9A 1G6OA 3CZQA 3KUCA 2BMEA 2QAJA 2CBZA 3KJGA 1T9HA 2Z6VA 4TL8A 1AK2A 4XJXA 1UBCA 2QORA 5FFMA 5FUVA 4PZ7A 4OL0A 2K32A 4A3LH 1MKYA 1NJFA 2C78A 3FKSA 4D82A 2D4HA 3H1TA 4C9BA 1D8TA 1YZLA 3PCRB 1C7YA 1VQ5A 3TUZC 2JA9A 5CM9C 3PFIA 4EJSB 2OG2A 5IYCG 3AYHB 1Q82C 1LACA 2N46A 4JLNA 4D4MA 1D2EA 1HNZQ 1E2JA 4LUZA 1MR3F 1MABB 2DFLA 1A0IA 2GVAA 2HEIA 3CO5A 2UU9Q 1U8ZA 1RRGA 4X66Q 4LV8B 1N6RA 4JOIA 2DY1A 2P6RA 3AB3A 3K80C 1Z6HA 3I7FA 4BFUA 2BBWA 4R71A 3TS0A 3EASA 3IHLA 4JLAA 2J0UA 3AP3A 4MGKR 2FGKA 1JXMA 3A37A 3PSIA 5IT9c 4WJ4A 4PZ8A
chains in the Genus database with same CATH superfamily
1HNXB 4Q02A 2WU8A 2P40A 4WQMA 4UEWA 1E96A 2WUFA 4RA9B 4XI9A 1FZTA 3NQTA 4V2IA 3ILHA 3M6VA 3GV0A 4HLCA 3K0EA 1CF4A 4TYMA 2PBLA 3GAAA 1NJSA 3PHHA 4IDPA 3KE9A 2OC9A 4U63A 1IY1A 3U1VA 2WJ3A 2WU3A 2IH4A 3G2QA 4PQEA 3H6KA 3KF6B 1UZUA 5IYZB 3OEYA 1FUKA 2R68A 2OCLA 4M37A 3NHKA 5BN5B 3KQWA 1HK7A 121PA 2VJCA 4OQZA 5DX0A 3W5AA 4OONA 1N7GA 2O3UA 1IHYA 4LUCA 4FLEA 2ZB4A 4R3WA 1UUFA 5FQNA 4CWAA 2FXVA 2WHYA 3LF2A 3G5LA 2JCYA 4GSYA 1SC9A 4QUFA 4ND1A 2O8CA 4WCFB 5JQGB 2X0EA 1H9SA 1CUSA 2RQXA 1U81A 1E0SA 1VHTA 1WOYA 1Z26A 3GBSA 3P27A 4JFAA 4A3JB 4HZGA 4KX5A 4MH0R 4RM2A 1YUNA 1V2HE 2R11A 3T1HL 3OFJA 5FEUA 3CW2C 4UE3S 3U7HB 1SVKA 4NS1A 2AMFA 4ISBA 4ZHQF 1IN1A 5JSUA 4MYCA 1KAMA 1NKTA 1TZ2A 3GCXA 1F5NA 1UAAA 4G1BA 4RFLA 3BT7A 2J41A 3E18A 1AHHA 3CB4A 3PUHA 1TDJA 1O94D 1V1RA 2XSZD 4F60A 3VYTA 3W9BA 4JJ8A 5JS7A 1B9NA 4IUPA 1LLCA 2GTHA 3JR3A 3PRYA 3A9WA 4EQNA 2B6HA 2F3IA 5ADHA 5B3AA 2GZ2A 1FLNA 1P2DA 3OQPA 5H59A 2WUVA 1AP0A 1T10A 2MSEB 3IB6A 1YHAA 5GM1A 3THSA 4IQ0A 1YA6A 2NU8B 4NEGA 4DCSA 5DK4A 4NEQA 3KJOA 2E37A 4G0ZA 4EJ6A 4MCIA 4TLCA 1GKYA 2IHVA 2ZYVX 4WH0A 5I2YA 3UUWA 1CXZA 4S1OA 3TS2A 2NUTA 3RUFA 3L93A 1AZWA 1PHJA 4K28A 3ZH9B 1YA4A 2CLSA 2JAHA 4U4AA 5FWYB 1D8LA 3TZHA 1U9YA 4KLNA 1BHO1 1DAOA 1JVBA 2CNDA 2C88A 2JL1A 4EUNA 3JD4A 4I65A 1XDSA 5HJ7A 1PEYA 3L05A 4QO7A 3M6IA 1HUQA 1UFKA 3I9NA 4C20A 4CIVA 1GVHA 2YC4C 2CNWD 2ZSJA 4EABA 1T6ZA 2D1TA 5TQ2B 3O3MB 1T2NA 4RYDA 3KR1A 1UWKA 1C1DA 2CKZB 1TU3A 3JTEA 3ORFA 2I2BA 3B70A 3EQZA 5IC6A 1EPUA 1YQDA 5K09A 4OATA 2PU7A 5JSZA 1Y9JA 3HJTA 3KYCA 1NG1A 1PTJA 3FPKA 1Z7TA 4BV8A 2JH8A 4P82A 4PZAA 1NRWA 1BXRA 1EVLA 1QHHB 2BZGA 4FFDA 1IUPA 4AF8A 1F9SA 3DZBA 3LVBA 2JLSA 2VY3A 1VQLA 5TF4A 3D3WA 3DOCA 5F9MA 3B5JA 3SR1A 4RCYA 3T5CA 1ADBA 1IUNA 2A9PA 2BTQA 2AV6A 1GHJA 2BH2A 4J0KA 2ON6A 3ADKA 3G6WA 3SXHA 1WXEA 3RS3A 3VPHA 3D6UA 2HNBA 2Y93A 3CLSC 3NM5A 3MUOA 2EOTA 4X3KA 4GKJQ 1SUDA 2R6CA 4BPBA 2LE0A 4DV0Q 2REQA 3N2NA 4MW4A 1Y7LA 4FMCB 3K1YA 1I0ZA 2P7HA 4KFRA 1HNWL 1Z7WA 2JJYA 1EK6A 5COYA 3NORA 4B6SA 4E0BA 3S1RH 3GVPA 4KR7A 3IOMA 4YO8A 4QY7A 1Y7HA 1SKYB 2ZQZA 2F1MA 3WDSA 2H06A 4P7BA 4HDMB 1J2EA 3M6UA 4ANFA 4RFBA 1TKAA 5JSYA 1WPGA 3E61A 4CHGA 3PF8A 4HBGA 1WYDA 4Z4IA 4MRNA 4AQYQ 2J3LA 3E05A 4C4OA 2XYPA 3AINA 3C7DB 5J39A 2YJNA 4X60A 3WKAA 4YV1A 4LISA 1MUUA 3ZWPA 2IXAA 4D3DA 5C8DA 1S2IA 3I8SA 1C1DB 1LQTA 1WDWB 2A5LA 2FWNA 5C8VA 5KPJA 3OX3A 3S2EA 4O5AA 4P0TA 1TUGA 1WD5A 4PAOA 1FD7D 1BCSA 1JLHA 1PFUA 2EV9A 3JWEA 4H15A 4YB8A 5ALFA 4DLPA 3SHVA 3G9QA 1UMDB 1QHHA 4UBMA 5D5HA 1ECCA 3TXAA 1QVAA 1OMOA 1QDLB 1X7DA 1KI3A 1ZK1A 2VUSA 1CDZA 3MHTA 2O2SA 3CH4B 3IUNA 1BZYA 1YZFA 1AZSC 1L2FA 4TT3A 4YAJA 5EA2A 2LIPA 4EP1A 3F46A 3QMMA 4MDYA 1BD4A 1TWFH 5BQPA 1TCVA 3DXYA 3L0YA 3F97A 5AI9A 2ZUWA 1Y8OB 2AX4A 3FUCA 2UXBQ 1OXXK 2B2YC 2IGBA 1C3EA 3AOEC 4KQXA 5SICE 4GHWA 2H57A 3IIEA 3UUGA 2XA1A 1KYWA 3P7MA 1VMKA 3DM5A 1DJRD 4DCOA 2HV9A 5EIXA 1FQWA 2AJ8A 3BXEA 3DBHA 4FN4A 4NZ9A 5FBQB 2YWBA 1DKPA 3BWYA 1QRAA 2IT1A 3FTNA 4GR4A 1SN7A 4GOKA 4WEQA 5AM5A 3AFMA 3MFGA 4ZMRA 1NQAO 1SPXA 3E3AA 4TT8A 1HYHA 2P9FA 4A73A 4PFSA 4F4JA 2FDCA 4HAVA 3QWNA 1P19A 5I6YA 1K7EB 3TLYA 2WIDA 3P32A 2PQ2A 4R1SA 2XT6A 3T1YB 4BFZA 4NCAA 1HT2E 1MV8A 3A1EA 2Q8NA 2VAPA 5HNKA 2XPCA 4R83A 3JZDA 1VC2A 4LF6B 1UP6A 1Z18A 3O9ZA 4PHHA 4OKNA 3JVVA 2LKDA 2GMWA 4I4LA 4LRTB 3ZY6A 2APJA 1OFIA 2AI1A 3TX6A 3IAAA 1RLMA 3AKYA 3FCXA 4HDSA 4XT3B 3HR8A 5SY4A 2O2ZA 3HKSA 4F2GA 3U44A 1N2XA 1XTVA 2YJTD 3MCWA 5M34A 3LUJA 3MTGA 1ZUD1 4LXXA 4L0QA 4TGLA 1IQ0A 2Q8PA 4ZIRB 1YUMA 1ZVVA 1A2TA 2GSWA 4TV8F 1PSWA 1DJOA 1EDBA 2VQFB 5M5XB 3AEVA 1DOAA 3G9XA 2I7XA 2OB1A 1G41A 4X93A 1XMXA 2ODAA 4H31A 5TGZA 2GM4A 3PPYA 1SB8A 1I6MA 4NZZA 4JDUA 2J31A 1F1JA 4KHZA 2OHIA 2WU0A 1ECPA 3EA4A 3KJXA 4LMPA 3WLFA 4DMHA 2ZJAA 4B3XA 1J22A 4EYGA 3CO0S 5FUYA 2A30A 2WHXA 2NTTA 5GROA 1KC8C 3G8CA 1BVUA 1AQJA 3VAAA 4K03A 4HEQA 2A8VA 4PVDA 2ANCA 4I9NA 3GCWA 2Z8YA 3E9ZA 3J80E 2Q5LA 3OOHA 3T1OA 1J23A 3H87A 3NJ8A 2X77A 1GPMA 2LKVA 2GT1A 4DV1Q 4BVGA 2V7WA 1RI3A 1HTWA 2DQ4A 2H2GA 4DLZA 1XWFA 3TP8A 4OMCA 2J4FA 4AJ2A 3DM9B 4B3BA 3Q98A 2IYNA 2A74C 4JROA 2BUCA 3LBHA 3VSEA 3PB3A 2V6MA 3V7NA 2L18A 2RCYA 5A3SA 3FFXA 1J8YF 3HU5A 3FGZA 3O5AA 4JJIA 4KO3S 1A8QA 3BZWA 3VR4H 2C98A 1MW8X 3GX1A 2PS9A 2A0WA 4LWZA 4WVLA 5JS6A 1K8AC 2FEXA 1TJ5A 2ORED 3F3YA 1P45A 3MCUA 1USIA 1WQ1R 1WCWA 3NRCA 1ZMTA 2F64A 4IKOA 3SC2A 3VBCA 2FZGA 2VHZA 2KOLA 3S2DB 1P5HA 3PDJA 2IC5A 4AZ3B 1HZCA 1V95A 1RLUA 2B8TA 2JEOA 4HWKA 3NP8A 1FFDA 2RJNA 4NBLA 5AMXA 4UQOA 2AIRA 3I2JA 3T9EA 1L8AA 4A2QA 4HT3B 2M6KA 4OO1H 4G67A 3OZDA 3ELYA 3ZDDA 3GV3A 1TT5B 3V7YA 3MAAC 3BS4A 3LDHA 4L4RA 1NSTA 4HDRA 3N0XA 1UPTA 1YRLA 3FPBA 1L1QA 2A78A 2GCNA 7REQA 2Y0SG 4C2UA 1XZAA 4JP1A 2C0QA 2QL5A 4NBWA 1ZGCA 3JAMA 1TCAA 1XSEA 4F86A 2Z04A 1XZ8A 3EVZA 3NE5B 2GJ4A 1E1CA 4MAMA 5DM63 2E9SA 4TTSA 4CG0A 2IYTA 1Q5PA 4AB1A 2JHCA 1O97D 1O9GA 1LDGA 3ANSA 1A76A 3JD3A 4JYMA 1PG2A 4US0R 1STYA 3NZEA 5L7WA 2W6JA 4PXAA 7AT1A 3DWEX 1ZNWA 4J15A 4ZU1X 5C3EG 2FEOA 4A4IA 1QKKA 2G63A 2V3VA 3S1MH 4D6YA 3B51X 2CLIB 3HKCB 4MTKA 3V4FA 4KN5A 1E77A 3GJSA 3O75A 1L4BA 1A7JA 2R7NA 2X8BA 2Z0MA 2W37A 1YWGO 3C43A 2WUEA 3GK3A 4KIWA 4REQA 5BSGA 5HR5A 1Q17A 4MB2A 1K9SA 1HZAA 1M7HA 4J3FA 1I4WA 5LYYA 1HNNA 4OGGA 1W48A 1FYCA 3E8MA 4WJ3M 3GO5A 3L0IB 5B7NA 4MI3A 1E2MA 3KJEA 3MUNA 1JMCA 5EQFA 2OBFA 5BV1A 3MTEA 1E5QA 4ZQHA 1Y69U 1ND6A 2VPTA 2XNDD 4HGQA 3UMRA 4AZVA 1IONA 1LTGD 1PD1A 3ZUGA 3OOCA 4DAYB 4KOEC 2Y0DA 2O8VA 1PFWA 4RF2A 3V9AA 4X90A 4FMBB 3T7EA 1T5DX 2GM5A 2AXNA 1CJKC 4EHAA 3TNDA 1I4OA 2HU2A 3HN6A 2HCFA 3CONA 3DWIA 5F77A 1YDWA 1YMVA 3LNTA 3WK6A 5FFNA 4ACAA 3EARA 1VI6A 1CQXA 4JL5A 5FJ8G 1LT5D 2BZ1A 4AKGA 1QK4A 3LO8A 1Q0QA 1M74A 3VYUB 1NQWA 1X1TA 1U4RA 3QX7A 4DJAA 1Q0PA 1MZVA 3VC2A 4MZXA 2QGFA 3TZLA 1PLKA 2ZRLA 2IX1A 1HORA 3IMCA 2NPFA 4NZPA 4C30A 4BY1H 2J7PD 4WTOA 1NW3A 4B7CA 2X23A 4X63A 3OAAD 1JORA 3OZXA 4R8MA 1PR9A 4WOKA 5E6SA 2V6GA 3RRXA 3S8YA 3R3OA 2BEWA 3COWA 3MUEA 3L1VA 2D59A 1TYZA 1KS2A 3C14C 1JNYA 2ALJA 1I3OA 2W2KA 2A7XA 2W71A 3IXQA 3MXTA 3IBFA 3LMKA 3SG0A 2K6GA 2DTEA 1NR1A 5JXHA 1KP3A 4RULA 4CHTA 2QY9A 4M88A 3D4WA 4YHHQ 1WXGA 1NDUA 3VA7A 1DIBA 3KD2A 3W6ZA 1YNJC 3KX2A 1OBCA 1N8SA 1X3SA 2BFCB 2OBBA 2OCKA 4ARCA 4OGFA 1BQ3A 4E2FA 3FZQA 3Q12A 3K5MA 3NV7A 5K0TA 2FFHA 2P9JA 2V4UA 4URUR 4JYCA 1WMFA 3DBHB 5H3HA 1E8NA 2RC6A 3BGVA 2I34A 4RJ2A 5E3FA 1B8NA 3R0JA 4H1UA 2XGSA 5J1TB 5GPBA 4MLCA 1L5SA 3FH0A 4P08A 1FFSA 1JXAA 3M1YA 1LPBB 2JS7A 5DNVA 1D2CA 1WNFA 3ND8A 1ADCA 1RACA 4NP5A 1KFEB 1LDYA 1MFPA 2HJGA 4YY3B 3WSWA 4FYWA 3U4ZA 3ZIUA 4JYBA 4C3VA 3CVYA 2BDNA 1VQIA 1KWKA 4DV7B 4AY6A 4OXPA 2WD9A 4AXBA 5CYUA 4HDKA 5K0SA 3GJ6A 2Z6BA 4OB7A 1S89A 4FF2A 3IR6A 1LPPA 1XAIA 3KOZA 3LCVB 4PLVA 4NONA 4TTVA 4WLUA 4BLUA 4BE9A 4XLZA 1ZYRD 3F6BX 3P9XA 2GSDA 4K9LA 1NG9A 2JGIA 5E1OA 4X3SA 5CB6A 2IEIA 2QAGB 3OCXA 4YQFA 1ZBQA 3CEMA 3O73A 1M8PA 4YIKA 5EZYF 4JI1Q 4WD3A 3G2LA 5FHQA 3IURA 1NFRA 1Z6XA 4H3HB 4K5QA 2IV2X 4F3YA 2EYJA 2GPWA 2YWEA 5ER9A 2YBEA 1KAGA 1USVA 2ZS8A 3NALA 4GE0A 4PU0A 4BP3A 3OU7A 5I7RA 3K9HA 4BBJA 3IT3A 4DE5A 4FEYA 2Q9UA 5T5QA 5CVJA 3JYHA 4GNXC 4BGIA 2Q41A 1LQUA 2CJXA 2WIJA 3OC0A 5J5AA 2H08A 3OZAA 4E30A 3IPXA 5TQ0A 1T2CA 4JJKA 2OD9A 4QUDA 4EJSA 1C3JA 2EFHB 3DOJA 3PVCA 1X55A 2GO7A 5B2FA 1EQVA 4ZQIA 3O9VA 4CT4B 2B63H 1JJBA 4IJ6A 1CR0A 1XLTA 4ZTBA 1T5LA 1TOAA 4MR8A 5AKYA 4JOIC 3PNPA 3DZDA 5BYBA 3ZQUA 2DHQA 1FP6A 3MNFA 4CI0B 5KGUA 2HO5A 1Q8IA 2BOSA 5LBIA 4EHNA 3F5FA 1KMQA 4PBRA 4JSRA 4QVIA 4NABA 4J91A 4LOIA 5LDHA 2X8WA 2EQSA 1DAKA 3NFYA 3SQXA 5GY7A 3UZUA 5DEIA 3F90A 2VWPA 3A1FA 1V35A 2EJWA 1T8UA 2Q99A 3NTQA 4JD5A 1XNGA 4MV9A 3EVQA 1M8GA 5AK6A 2HIVA 4EZBA 3OZIA 2XXAA 3QV1A 3GLGA 3ANLA 3U62A 2VK8A 4G97A 3OUTA 3LC2O 4EHDA 1RYZA 2G77B 4K26A 5JTUA 1C30A 1KZ1A 1KMIY 1WTQA 1JE0A 2O0KA 1ORWA 3CURA 3LBAA 2OXTA 3BZCA 2XF2A 2AFIE 4KXQA 4QQFA 4YT2A 3SM9A 4A3LG 1ZMXA 2E49A 3B89A 1WDMA 3KBOA 4R84A 2W6MA 3GQBA 1P8AA 2E18A 2QR3A 3EIQA 2F1KA 3CG0A 4G65A 1MGSA 4DV1B 1J70A 1RQGA 4M7OA 3URMA 2A3NA 2KHJA 3A7LA 2VPWA 5K8UA 1KO4A 5LZ2A 2Y0PA 4DR6L 4QRDA 5AKEA 2VJOA 4YDRA 1DRJA 4AROA 1AB5A 4IXMA 5JSKA 2F0OA 4E5DA 3QU4A 4IG4A 2FMKA 4KQEA 3E7FA 1HA5A 4DW8A 5A3QA 5L3SA 2B1RA 4IXNA 4YT4A 2DBYA 1NE3A 1MKHA 2CCZA 2ZT6A 4XIFA 4JI3Q 3TR5A 1FEZA 5ESXA 2J32A 5FNVB 3K5PA 3R75A 4ZEWA 4EJSC 3LL7A 3I09A 3LPNA 4QODA 1I9GA 3R41A 1BX1A 3E48A 3QGMA 2B83A 4XRGA 3T1HQ 2Y0SE 1JXQA 1RABA 1GVPA 1OBFO 4C6HA 4IDBA 1JE5A 1N9ZA 1EAMA 1SPBS 4G6ZA 1RWOA 4IO0A 4MYHA 3EFXD 4IIEA 1BOSA 2OD7A 2C7BA 4HDOB 4LWPA 4MNTA 3T1QA 3U9TA 3Q7TA 1NT4A 5JPIA 3UDGA 1HXHA 2NQ2C 3VH2A 3LT1A 2QD5A 1V1QA 1B43A 1XNJA 5KSZA 4JI8B 3TTSA 1XL0A 3OZBA 3K6SA 1DXMA 4AICA 5K8LA 2NADA 1UQUA 4NMMA 3GD7A 3WA7A 1Q7EA 4AKIA 2ECOA 2EZ9A 1I94B 1JU4A 3U3RA 1ZD9A 9GPBA 1U2GA 3MINA 4RX1A 4C1NI 3PBKA 3CXCA 1UFVA 5LR6A 2ZT7A 2B3GA 4D02A 4BO0A 1XL1A 2ZBGA 4KZKA 4PHCA 3VPXA 3LT0A 1DOMA 1XP5A 3VNRA 1ENPA 3OLZA 2OCPA 4KACA 3FYTA 3BFPA 2XTIA 2GPYA 1ZJ5A 4ZI5A 4D44A 3BXPA 5EWMA 4D8TA 4DKXA 3TGLA 1B23P 1OJLA 4YECA 2OBNA 1QUEA 3X1ZA 1KYQA 3AFHA 4IQFA 5KYLA 2YJZA 1X70A 2CMGA 2FRXA 5DTEA 4UZEA 4XCXA 1X94A 2C07A 5LQJA 3H94A 1BHSA 1DKNA 2G9DA 1Z9BA 3SE7A 3GF4A 1UC5B 3ZX5A 2P0EA 1V41E 1ZJJA 3QVXA 3TQOA 1QH0A 4DB4A 1QCBD 2PUHA 4M98A 5TNXA 1Z2OX 1OVGA 3R3WA 2C77A 2VEDA 2X19A 5C7OO 1XF9A 2DPYA 4ZO9A 4QAQA 2H4HA 2CLOB 5FLYA 3T94A 4B4OA 4C6TB 4QT0A 3I1IA 1NR5A 4DKJA 2DFPA 4AYBG 1X32A 1M10A 1QOZA 1ZJ4A 3ZXSA 4DRXA 1N0IA 1RL2A 4A3CH 5H81A 4P53A 5L8VA 1XMOB 2XITA 3G6EA 1QGOA 2Q1UA 1PUIA 1NFQA 1YOVB 4G81A 5K6AC 1P1KA 3D4BA 4GUAA 2Z3VA 5DWDA 5E4FA 1QLHA 4G5RA 1NXSA 1RYBA 2H1VA 1KI8A 3ETDA 5E6UA 1I2MA 1DRWA 5K8VA 3V1NA 3VKWA 1YS2X 1SQGA 1TLLA 2F1OA 1EI9A 4DK1A 1CQIB 1BUVT 1EWTA 3G02A 3K9GA 1I6WA 2ILVA 4GLOA 3QKRA 4CEJB 3ELUA 4Q5VA 1Q6YA 2WE7A 1Z7GA 4F5WA 2ZYDA 3DAGA 5HSGA 2H07A 4JJ6A 4FR5A 1X1RA 1T3HA 1I6KA 3C45A 3LFTA 3HZXA 3VR2A 1IRXA 3BSSA 3PCTA 4ENPA 2YWXA 1KZGB 3Q9NA 4FINA 3VC7A 1L5FA 3UK2A 3CZPA 4XSVA 4PYKA 1ISRA 2AG5A 2JGFA 3E82A 1XCBA 3CBGA 5E4JA 1AUPA 1J2RA 1L9XA 1WUIS 3OJFA 5EKKA 1N33Q