3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
1ZCAA 2MMGA 4JBYA 5JJKA 4MRRA 4JKYA 1P2TA 1Z2AA 2AUKA 3B1VA 3VX4A 5JS7A 5GROA 4DKAC 1QBKC 2CJWA 1XTRA 4L15A 4US1R 4DZZA 2J45A 4IFDG 4GOPC 1KHTA 3GDEA 2V6JA 3GJ6A 4JKIA 4LBWA 1SULA 2ID0A 3STBD 3TMKA 1Y1WH 1KXLA 2YOGA 1FFHA 5FOWA 2ONKA 1HR0W 2PNRC 2PZEA 5SZIA 2V1UA 1VQ8A 1J2JA 1GDDA 1VG1A 1D2MA 1Q21A 5DH9A 4BFXA 4KYUA 1TXYA 5HKKA 2WWXA 1KHIA 4LZZA 1OTCA 1UJ2A 1YQTA 3CCEA 3EPHA 3KYHC 1EIYB 2C96A 5GJCA 3AKYA 3U3JA 4PSAA 1RRFA 1B9MA 1EFRA 1T3HA 3S1AA 1SLJA 2N46A 4LBZA 3EIQA 4EFNA 3SU8A 3J81j 2CQOA 2IYZA 1K8AC 2CVHA 1HNZL 4JVLA 2XGJA 3VNVA 3KLRA 4LHZA 5CJPA 4Q47A 2LCFA 2EJGC 4LF8Q 5AWFC 2EFCB 3V9PA 2OTLA 1DG3A 4LJYA 4XOIA 4YCWA 2VP6A 5KNBA 3X1WA 1OYYA 1KDTA 1RRGA 3AP3A 4IEEA 4Z1MD 1Q90A 4ILEA 3ND8A 3E2IA 3WNCA 1DAMA 3CC2A 3UATA 4AYTA 2A69D 4EJSC 3PEWA 1P61B 1Q44A 2C99A 1XPOA 2V4ZA 1AZTA 5FR2A 2YKGA 2DWPA 5JEEA 5EAYA 1UDXA 1EUJA 4TMVA 3DM3A 5SZJA 4DJTA 1XZPA 1VECA 3E9IA 3GLGB 1H8EA 4G7OC 4EJSA 1LYLA 2N3SA 4DV4L 2B21A 2WWGA 1Z29A 2H92A 3RRNA 3EIVA 1H9MA 3CF5A 1LF0A 3KQKA 3NDPA 3M9BA 4BWYA 1GZSA 1L2FA 4OXPA 2O8FA 1U2RA 2IT1A 4NMMA 3AF4A 2YNMA 5C0XH 2ZJRA 4YY3L 1Z0KA 2PX3A 2E2IH 3QBTA 4FCWA 4U00A 421PA 1KMHB 2DWOA 2ES2A 1HZ9A 1JJGA 1GILA 3PENA 2YTVA 4TSFA 5EE9A 3CRLC 4DV7L 5C1BA 2JA7G 3ZGXA 2QBYB 4PMWA 2KENA 2VSFA 1Z0IA 1BMFA 5FUXA 3BRWD 2GXQA 4MRPA 5CJ2A 2IUUA 4C3JH 2VQEL 3U3MA 4IOLA 2NZOA 1TUEA 4KKUA 4LGMA 1W36B 3OTOQ 1DEKA 1VCOA 4A8JB 4DSUA 1GJXA 1W5TA 1SHZA 1JR3E 4I1UA 4A8JA 4OX9L 1E96A 3R8CA 1P9WA 4PO9A 4DVGA 2CCGA 5KHOC 1T5EA 4DV2L 2XTZA 2EVBA 2RHQB 3W90A 3I1FA 3VDYA 4G01B 4LBVA 3NELA 3TQFA 1KI4A 1YR9A 4UP7A 3EPJA 2PMZE 2JJQA 5KO2A 3I4NH 1Y1VG 2BBTA 2JQOA 5ELOA 2VF8A 1E9AA 1NN5A 5CIWA 1P62B 5CDFE 2C77A 4EPYA 4CVNA 4PQRA 1II8B 3HOVH 1RZ3A 3E0EA 1YZQA 2Y0SE 2BE5C 1OSNA 1YJ9A 121PA 2QTVB 4B74A 3AVTA 3S1NH 1U98A 4PQYA 4MYHA 1ZM7A 2PX0A 4XD7A 3CNLA 2KA7A 2J59A 5EP2A 3WYAA 4B6FA 3CCMA 4ESHA 5LD2B 1NBWA 1UE7A 4FDBA 2DY1A 4IVRA 4X8MA 3TS0A 2UUCL 1JAIA 2GK6A 3ETLA 2SHKA 3QUSA 4JI8L 4QL3A 3QG1A 1WOCA 5DI9A 2GN5A 1ZYRC 3T5GA 4NYMR 5JEAG 3IHWA 5DI3B 4NCIA 1D6JA 4D0GA 2RGDA 4QNMA 2CL6X 1TPZA 4M9ZA 4ZCMA 2JJ2A 1W4AA 3MWLA 4YWLA 1KAWA 3CF6R 4DDUA 4EX5A 1GL7A 4OK6A 4A3BG 1QRAA 2J41A 4DIDA 4IOMA 4EFLA 5BWMA 3ZD7A 4Q00A 1W0JA 4R4OA 3AV0B 1YJWA 3FMOB 2CWPA 2ZRLA 4GZLA 1AQYA 2FFAA 2R8RA 3A8KE 4JI1Q 4YMUA 3WMFA 3KJEA 2YV5A 4PV1C 4BLQA 5C4XG 1P9NA 1E4YA 3MJRA 1DE0A 4NPSA 1L8QA 3I62A 1EGAA 3OEHA 3U44A 2OWOA 2VHUA 5FL3A 3BH6A 4KSCA 2EYUA 2O0KA 4M0LA 1KJYA 3SQWA 1XU4A 3NTUA 4AIIA 3U44B 3S17H 1ZRHA 4ZO4A 1NVVQ 1OIVA 2CMKA 5H68A 5JHHB 2PEYA 1AGRA 5B58C 1V5WA 3CMAA 4DV0Q 2GZHA 1XTQA 1YZUA 1NKSA 1UBFA 4RJLA 4Q9IA 4PPFA 2QORA 4URXR 3KQUA 1MKYA 2WJVA 2FSFA 2NPFA 2EU8A 3U4QB 3I8SA 4DAMA 1E94E 2BHRA 3CC7A 4DR7L 3OHMA 2NVYH 1FZQA 3AH8A 3PF5A 1IYUA 1U0LA 4RKFA 4JI3Q 2GXUA 3CX7A 1VQ5A 3JAMi 2GESA 1N3BA 5FBQB 3QF4A 1H8ED 2JASA 4HLUA 3LWNA 4B6EA 4MQBA 2AWOA 1BDOA 1VQPA 4A76A 4LF6L 1FP7A 2DFKB 2O5VA 1HQCA 3QKTA 3FKIH 1L0WA 4WAUA 4MGZR 3RS7A 1BKBA 1KNXA 4BQSA 2HYIC 2KSQA 3W5OA 2XGTA 4JBJA 4YCVA 2ZRHA 1E0KA 1XJ0A 2GKSA 4LUOA 3X1ZA 2I1VB 2FG5A 1SXJB 3T34A 5J4VA 1KK0A 1UBEA 2AL7A 3AUXA 2D0OA 1MABA 4A3KG 1IBLL 1DD2A 2J1LA 2OAP1 4G0NA 5EE3A 3UDIA 3FMCA 3TVTA 3I73A 2JJ1A 2YWHA 2QY9A 2QAGC 4EIWA 1N6PA 3HPRA 3CW2C 3BAFA 2FGKA 4F7WA 1S72A 2VP4A 3LD9A 4JLKA 1IBMQ 4OI2A 1U8ZA 5TB5A 4C0HA 3RC8A 3VKGA 2VY3A 4DR1L 4FN5A 4NYJR 221PA 2XEXA 3F5FA 4KLZA 1I4TD 2AK3A 3T1YL 2I3BA 1ZKOA 3T06B 4PZ8A 2KB0A 3THWA 1KK3A 2GAAA 1EK0A 3I5YA 2A7QA 2GEUA 1YZ6A 4MUAA 3W6OA 3EBEA 4BXXH 1TX4B 1TQ2A 3S24A 2WSSD 4F92B 4QL5A 2UZIR 2B8WA 3S15H 3CWZA 1QZHA 2R7FA 4XTRA 4BY7H 3WMEA 1AE3A 2V54A 2ORVA 1G6PA 3ADBA 1Z6XA 1NE3A 3G82C 4TL6A 2IYLD 1JMCA 1UKYA 1E2VA 2DNCA 3L0OA 3GTLH 4OQMA 4KI0A 1QHNA 4EUNA 4CEHB 2F3IA 4OWTB 2ZUDA 1ZIPA 1RYHA 1X6VA 1CR2A 1NP6A 4AYBE 4GOPA 3K0EA 4IKEA 1EFTA 3T1VA 1SXJA 5AJVB 4HLDA 3TIFA 1VQ9A 5TXGA 3X2SA 1Q20A 2C04A 3I4NG 3A4LA 3HDTA 4O2LA 3B1YA 3RS2A 5TY0A 1G8YA 1XTDA 3K0CA 2ZSDA 5FTLA 3GTGH 2C5LA 3GEHA 2CCJA 1K8GA 4XTCS 2BMJA 3FYHA 4R7ZA 4OBEA 2IWHA 2MSDB 2WV9A 5JZVA 4WA7A 2Q2IA 1YNJC 3NEMA 3HFZB 1R10A 2WOOA 5JSZA 1ZNYA 1E2MA 4AH6A 4BGDA 1UEBA 3UE1A 2QTHA 3KF8B 4TSFD 1XX6A 3EX7C 1X65A 3CRMA 4PC1A 1KAGA 5FTNA 2F1RA 4DR5Q 4LK2A 3VFDA 3W1GA 2F1IA 4C9BA 3U6BA 1A4RA 1GRNA 2PBRA 4FI3C 1FQJA 4RKEA 1Q0UA 5D3QA 3DVLA 4A0HA 1E1QD 3A7LA 2AFIE 1X1RA 5D3MA 1GG2A 4OKSA 3A1VA 2ZR7A 2WP8J 2OZEA 4QBIA 1Y8NB 3PSIA 4JLAA 3WYGA 2JA8H 2C2HA 5C4GB 5BW8A 4Y0VA 4TYYA 3RNLA 2G88A 2VHTA 5GJBA 1M2OB 4PFSA 1FVIA 2H57A 2QP9X 3E70C 4JBKA 1ZD9A 4K8OA 5FBRB 2ZM6L 1A0IA 4R98A 1II8A 2FPLA 2CVFA 2WJGA 1G5RA 4M22A 2NVTH 3K9NA 1TF5A 2FEMA 2NN6G 3VR4A 3ER0A 3HOXH 5C0XJ 1RL2A 3DOEA 4L9WA 4H13C 1W0JD 1E2JA 1IOZA 3AYHB 2XSZA 3B82A 4PPQA 3A8IE 1HH4A 4X62Q 3DEFA 3O8DA 3QKUA 2W2TA 3ZQJA 4LJ5A 4QIWE 1PH4A 1CKNB 2BM1A 1P8LA 4GN4B 1XPUA 4KAXA 2ASBA 2Q2HA 1SMXA 4JI6L 1F2TB 1S3GA 2ZE5A 5FFMA 4LY6A 3H3VI 1F2TA 2GF0A 2WB1E 1LF5A 2FA9A 2ZRCA 1BO6A 4GRAA 4QOSA 4OHYA 3AP2A 1S1MA 1FP6A 2O8BA 1DVRA 1WCMG 2FSIA 3VR6A 3OE7D 2EJFC 1N36L 4OX9Q 3PCOB 4JLBA 1G5TA 5CITA 1NY4A 2WAXA 5AUOB 1NVWQ 1F2UA 1CKEA 3LBIA 1LS1A 3T1HQ 1E9DA 2QMUA 4AKGA 4XSHA 4HB3A 4LJZC 4A6XA 4GP7A 2C03A 1A1VA 4LF5L 4B3RL 2W6JA 4AKEA 1Z9FA 2F52A 1XEXB 4G5SA 5E95A 4IPGA 3PO3H 2K4KA 5J40A 5EP3A 5JHGB 4DB4A 1I5FA 4UP9A 5E7NA 1G20E 3IQWA 3CCVA 2IBMA 3BFVA 3Q9LA 2FOLA 4IXMA 2RH5A 3G4SA 3TUIC 3DMDA 3MXNB 3B1XA 4P31A 3AVPA 3MXUA 1HR0L 1W4RA 3ZZTA 4A93H 3WWVA 1G6HA 3QXXA 3AEVA 2FDCA 1KIXA 1P73A 1XJVA 1G3MA 1YEZA 3BOSA 5KPDA 1OB5A 1GSIA 4TYWA 3N6RA 3K80C 4DV2Q 2ODBA 3H0GG 1CJKC 1TF2A 1Q8KA 1HEIA 1AK2A 3WP0A 1X8KA 1LV7A 1DOAA 4GOXA 2O8CA 1TWGH 3DO6A 2FGJA 4V03A 3CBQA 5K8TA 4XSGA 3W5JA 3TQYA 1XCGB 2K33A 4C2TA 2XB2A 4LPSA 1QUQB 2UKDA 1A6XA 3H0KA 4NZYA 4YDHB 1W4CA 1Z5ZA 3CF0A 4OL0A 3NENA 1JNYA 1WDTA 3Q7QA 4C3ZA 3K70D 5EUMA 5M3FG 4ZDIA 2IHBA 2FSHA 5HE8A 2JJ8A 2MSCB 4DLWA 4R9UC 1XJCA 3SJZA 1SXJC 4L8JA 3J81c 1GUGA 1PH6A 4B2PA 3THXB 2FZ4A 4BBRG 2R65A 4TLBA 2WWIA 4LYFA 4B35A 4AYWA 1M1YE 2HXSA 3O8BA 1XCPA 5AK0A 4DUGA 3U60B 1GUTA 3THXA 1YHNA 4OQLA 5HKKD 4QGAA 5C46F 1Z6TA 1M7BA 1PV4A 3CP0A 3OAAD 2IF2A 3A7AB 4G7HC 4JLJA 1PH8A 1NN1A 3CW2A 1R0XA 5KNDA 1JJ2A 1C9KA 4LI0A 4X62L 1FW6A 1A82A 1N0UA 4DV0L 2GDJA 2IUTA 1LABA 4EQ6A 1Z22A 3U7GA 3I55A 4JSTA 1J5EL 2Z4RA 4LHXA 2E76C 4POAA 2K52A 1NMZA 1CIPA 3I72A 2OFXA 4BBSG 1DARA 2Z6VA 2ZETA 3NBZC 3RWOA 1O7LA 1CUKA 1T4GA 2A69C 1EQRA 3RS0A 1U94A 4GDFA 1M7HA 5KSYA 3FP9A 5FJ8H 3OIVA 1N6KA 2ZSEA 4LF8L 1OFIA 3KQNA 3K9GA 5FBLB 4BRWA 4CDGA 1PH7A 3AVVA 4A3CH 4HJ5A 1E2HA 2VHQA 1WE2A 3FPPA 4A93G 3RDPA 3DHWC 1C0AA 3DKVA 5AJZA 3A6PC 4HDOB 3S1RH 3BERA 4LYHA 1JJVA 2VL7A 2V6IA 4URUR 3GLFE 3GJ3A 4DEYA 1NIJA 3HOYH 1ETUA 2WJYA 4PSKA 1JALA 3SS8A 4JLPA 1G4UR 2OXCA 1KO4A 1TWHH 1K83H 2KWIA 2RGNC 4YWMA 3W8NA 4DNRB 3J7A5 1KI6A 1NLFA 2OBLA 2YYZA 1WA5A 2QAJA 3D31A 2KHJA 3D0FA 1AIPA 1NVXQ 2GCPA 2OHFA 2QRNA 2CW0C 3K1JA 3MMPA 4Z8XA 5KDLA 1VQJA 2PCLA 2WWYA 1D8TA 1G7SA 2H1LA 2B7BA 3TSWA 2UXDL 3I3SR 2X8AA 2ZS7A 2OG2A 3GLHB 3BK7A 2DFTA 5GAHC 3HU3A 1J99A 3NIBA 4TMZA 4NXNQ 3IBYA 4DDWA 3CWQA 3P4YA 2LKDA 3DDCA 4MGIR 3I56A 1Q81C 4TT3D 2K14A 4DR1Q 3LX5A 1Q12A 5J4YA 4A6PA 1XD2B 4C2MH 2ZXUA 4BY1H 1PMRA 4GNXC 1H8HA 2FMXA 5FBWB 3W34A 1HPCA 3CPJB 3L0SA 1VG9B 3OESA 3VU9A 5GVSA 1TAGA 4GOKA 1XMSA 3U3OA 4JK1C 1H9JA 1MO5A 3TS2A 1XTJA 2CNWA 2GJKA 3EZ7A 3DL0A 2AWNA 3MJHA 4L5BA 4UNPA 5IYBG 1FNNA 5EE1A 5IDVA 3K81C 1R7RA 3CZQA 1ZM9A 2JLZA 1W44A 1B7YB 1X9NA 2HHHQ 2CJWB 4Q9KA 1I2MA 5AJXA 1HR0Q 4PX9A 2NVQH 4E03A 2JLWA 3K09A 5FL7A 4N1AA 4ESVA 3UMFA 1ZM3A 2D5DA 4MDEA 1T6NA 2EJMA 5BQ5A 3T15A 721PA 2ZR0A 2ZUCA 4I1SA 4KO8A 3LA6A 3L0IB 2UXCQ 5K8LA 5EXPA 2RGNA 3AVWA 4KFRA 3GLFB 2QGZA 5GVRA 2CHQA 1II0A 1G3UA 4FIDA 2OBMA 4TWZA 3RRYA 1LNZA 2PZGA 2OCAA 4BBRH 1GHJA 2G0NA 3A36A 1QZXA 3ZS9A 3PO2G 4JJKA 1A63A 5LMNL 1T3LA 4JL6A 3BZCA 2UUBL 3VKHA 5ANRB 1KMHA 4DV5Q 1VQOA 1P75A 3BWDD 3L8ZA 5DO9A 3CKLA 3ICEA 4YMSA 4DLXA 1VQ4A 2VUMH 1TMKA 4Q9LA 4Q4JA 1PZNA 4PG3A 1W0KD 3ZJYC 3PIOA 1H8HD 3J80i 3FGNA 4LV8B 2OO7A 4JI0L 1CKOA 2KCMA 4DR4L 2IHEA 5JMTA 1ZD1A 4POGA 4KV9A 2OCEA 1YITA 5EUQB 1J8MF 3MLEA 4UP8A 2VQSA 4TLDA 2EW1A 3FWYA 1JECA 4NTZA 5EZ6B 4DKXA 1O3YA 2QZ4A 3I4MG 1CR1A 2NO1A 4I7ZC 4R4QA 1N5JA 2QENA 3P32A 2BBSA 4UXIA 5C3EG 2IL1A 4JI2L 4BUJA 3TK1A 1KOFA 2R7ZG 1UKZA 3C8UA 5FI1B 3QY0A 4OO1H 4IHQA 2A1AA 1LFDB 4IO9A 5H1SE 2OTJA 2YOHA 4QJ3A 3Q5EA 3LQQA 1JT8A 1KY2A 3K0AA 1D8LA 1XNRQ 1JBKA 3P1JA 1GKYA 2WZQA 4G1UC 2D74A 4P4SB 3GJ8A 1MO6A 4FXPA 3AEZA 4JBXA 4L16A 3ZVMA 2C95A 4IDHA 2FPKA 2ZJZA 5FPKA 1MT0A 1Z7TA 5GQOA 3CM0A 3SJAA 2OAQ1 3ASYA 2JLUA 3BGWA 3SEAA 4BFSA 3CCRA 1L7VC 1YZTA 4J0QA 4M1SA 3THOA 3C4JA 4MDFA 2HYDA 4NP6A 1VQKA 3QPWA 2CEAA 2J7PD 1Y3AA 3B1WA 1MIUA 3CC4A 1SE8A 3CAMA 1CULC 4CT5A 4A36A 1L1OA 2XZLA 1MV5A 3JVVA 4UXHA 3J81k 2LKCA 4L4UA 3RS5A 3TR5A 4P72A 3RNUA 4A3FH 1COWD 1L1OB 1PYSB 1RPZA 4CEJB 1O78A 2IS4A 3RN2A 3V00A 4JI7Q 2QEQA 1WYDA 5DE3A 2NGRA 1KC8C 3JVUA 2ZS9A 4HLQB 4IDOA 1FUKA 1VMAA 5E7MA 1JR6A 2XX3A 4JS0A 4JT4A 5HTKA 4BLRA 4BZXA 3CONA 2B8FA 3L8YA 2QUZA 4KBFA 4E09A 5IT5A 3GLGA 3T5DA 5FLMH 2IX3A 2D2FA 1ANKA 3GTOH 1KK2A 4ON9A 4DV6Q 2DB3A 1E69A 3LW8A 4OONA 1I94Q 1XEFA 4HYYA 1R8SA 1Z8FA 1OJLA 1VYUA 2ZRFA 2VZAA 1YR8A 3P26A 3GTKH 4UQOA 4IDQA 2DYKA 1ZP6A 4BFVA 1IY0A 4DB2A 2QAGA 4ACBA 1NBMD 5BN5A 1CR4A 3QNUA 3K7AH 3O47A 2IYXA 3TKLA 1N9WA 1YBYA 4A3DH 4H44C 5TVKA 3SI7A 3HOUG 1XMVA 1S9DA 4B3ML 4WBSA 4PZZA 2FSGA 5M3MG 3GTMH 1T5LA 5DLQE 2B6HA 4HZUA 4JLOA 5FL7D 4HB0A 8OHMA 1QHYA 3UE0A 3PIRA 2PL3A 1EXMA 4MA4A 2ZTSA 4OWXB 4P0TA 1WBDA 4ZDWA 4LF9Q 4CEJA 5FOSA 4A92A 1QDEA 2OQKA 4AIMA 2ZYTX 1N32L 1X3EA 5HZKA 1KI9A 2XXAA 4KLNA 1DGSA 4DPGA 2ATWA 1KYIA 2WMNB 2CLSA 3LNCA 2WFWA 1YRBA 1ZVQA 2P0EA 3QENA 2ZJ8A 3A1UA 1S1CA 4I4LA 5J4LA 1VQFA 1PA6A 3K53A 4YMVA 4PC6A 1YE8A 2ZE7A 2JA1A 5FI0B 2B92A 1SHKA 3CRQA 1U5KA 3FKIG 2FFHA 5H8WA 4JI0Q 4EPXA 5LB4A 4D2IA 1S4QA 2ZIAA 4OO1G 1UBGA 3SBDA 1QG2A 2Q2TA 1N34L 4FD2A 4R2IA 1OXVA 5FLXc 3QXSA 2R93H 4IVQA 2MO0A 5AUNB 4MRSA 2NTYC 4BRUA 3Q7PA 4ZI2A 3IKJA 1PH9A 1A5TA 1VYTA 3W3AA 621PA 1N32Q 4E5UA 5JLJA 1J8YF 3K0FA 4PO8A 2PLFA 2A5DA 3KXIA 1AGPA 3CRVA 4I81A 2VP0A 4Q5IA 1X3FA 1V43A 2JDID 2O0HA 1WB9A 1A2BA 2G6BA 2O8EA 3Q85A 3EPKA 4A8JC 2O8EB 1FTSA 1E1QA 1HQYE 2ZJ2A 4X8LA 1MR3F 5FPTA 3W5IA 4B33A 1Q1BA 1NJIC 4B3BA 3UMRA 4DXAA 1FGUA 4A3MG 1KSFX 4B71A 2KHIA 3PUYA 2WJJA 1OIWA 5J4HA 4LF6Q 3UDGA 2NQ2C 4PHHA 2CL7X 2RHDA 3TQCA 1HQMC 2YTYA 2FE4A 3UWOA 3M7NA 1NNEA 4RD3A 4A9AA 3AVOA 4AD8A 2EVWX 2O52A 3QEJA 4LJ9A 4BLOA 4C0BA 4DCSA 3A4MA 1EG7A 2CBZA 5E7IA 3RWMB 4DUYQ 1IYVA 1N6IA 1U9IA 2IA5A 4JMPA 4ZCIA 3KKNA 1VQGA 1MABB 1ONBA 3IBGA 3HKSA 1EFWA 1MO3A 2G9NA 4C3IH 4MUBA 1OH8A 2OE2A 5TDHA 2BIFA 1D7QA 4UPAA 1G41A 3M6AA 4RZ3A 1OH6A 4NYJQ 1S2MA 1JPNA 1VF7A 3T12A 4LJ8A 3WNBA 3LFUA 4G5GA 1J6QA 3D8BA 4Q4HA 4EQ6B 2KBNA 2C35B 1E2QA 1IONA 1EFCA 1Q46A 2V4DA 1SVIA 4OQFA 5FPSA 2WKPA 1R9TH 4TZ6A 2F43B 5TARA 1JB1A 3ND9A 4HUQA 3HR7A 1GTVA 2WPDA 2Y0SG 4O2DA 1G4AE 5IWAQ 1HZCA 2VSOA 1X6OA 4A3IH 1K5DA 2HJVA 2QT1A 4IFBA 4EPRA 3HOUH 4PZYA 1Y8OB 1SKYE 5JJLA 2MNAA 2PT5A 5L3QB 4A3DG 3Q5DA 2ZRIA 1BBWA 1L2TA 2ZYUX 4E07A 2ORIA 2FN4A 4NCKA 4R2HA 1E24A 3OOCA 1HJPA 3SR0A 4D81A 3LAWA 1E2ZA 1PLLA 3KTAB 3PG5A 3JZAA 4BECA 4RZUA 1W7AA 1C4OA 1I4LD 2J87A 2ANBA 4DBLC 4F4CA 4A3EH 1E0JA 1SQ5A 2ZQ5A 5C0XG 1Y1VH 1SVOA 1U99A 1XMJA 3B6EA 2E2HH 4L5SA 1XTSA 3QPVA 1RW4A 3K0AB 1A62A 1COWA 4JI8Q 1U8YA 3NBHB 2DHRA 3MCAA 5HCNA 2DR3A 5IYDG 1BYUA 1U8AA 1UADA 3OIWA 2HXYA 2FH5B 4QJ5A 3CXCA 3QE0A 3CRKC 2E5LL 3HPQA 1FNMA 1I50H 5F98A 3WNDA 1NMYA 4Q7MB 1X1SA 2A9KA 3PV0A 4M1WA 2EYQA 3HU1A 1W48A 4N0EA 4A0GA 2YWFA 3ASZA 1CRQA 1Z6YA 5JSZB 4IRUB 1IZ6A 4JI1L 4OHVA 2RCNA 4MZ9A 3TUJC 3R9WA 2PI2E 5M5XH 2EFHB 2GK7A 1X3SA 1VYVA 3BS4A 4IXNA 4A2WA 4RCYA 2GCOA 1LB1B 5DYGA 1AH9A 1R6BX 3KFUA 4NBSA 2ZTDA 3CO5A 3EWAA 4Q4JB 3ZDQA 2VRWA 1ZNXA 1WCV1 1K8OA 2CFMA 1D9ZA 2VQFQ 2JGNA 4M1TA 4RZXA 4DK1A 2Q6TA 3SNHA 4JI4L 3QKSA 1XMQL 1JJ7A 4FCTA 4M9SA 1TKWB 4J15A 1W47A 1E79D 4DHEA 1SR3A 4IJHA 2EQSA 4UXJA 1JQJC 4WJ4A 1P6XA 3T53B 4B3XA 1TWAH 2GTPA 2R6FA 2V1XA 4WVFA 5EQTA 3UKDA 3PITA 3LWUA 2C78A 1YHQA 5HZHA 1GAJA 1OFTA 2G1JA 5LB2A 2AXPA 2BH2A 3V4RA 3AVUA 4H1VA 4NL4H 4ZKEA 3NBYC 1VDZA 4JI2Q 1G8HA 2VQEQ 4DCNA 1ZMXA 4O0AA 1CP2A 3P20A 2VP5A 1YR6A 2NG1A 2R2AA 4KODA 3CCLA 2B7CA 1ESNA 1SFOH 1QHGA 2GVDC 3GLFA 2BDOA 1AM4D 1E4VA 5KDDA 4IW3B 1NI3A 2PNHA 2ZAOA 3B13B 3KKOA 3NBFA 4URVR 1Z6HA 4Q1DA 1ASYA 4APVA 4MKFA 3T1HL 2ZE6A 1IBML 1WFQA 2VP9A 3B60A 2G0TA 3VAAA 4LF7Q 2IXEA 4UY8C 1QF9A 3QKRA 1VG8A 3G48A 1CFMA 1X56A 4LFCL 1G3RA 4LYJA 4MRNA 4PTLA 4DSNA 4M4SA 2GCOB 3KB1A 4GL2A 4C30A 1H9RA 1E2WA 2F3TA 2A5JA 3L43A 4QJ4A 1TUIA 2PPBC 2BEJA 1G51A 2PLRA 2Z43A 2Q0HA 4PO1A 1ZUIA 3GLIB 4X8OA 3C41J 1DAGA 4FMCF 4S2EA 2ONJA 1NVVR 4A0FA 4BFWA 4L8GA 3UWKA 1KI7A 2XOKA 3KKPA 2QU8A 3TRFA 5M5WH 1H65A 3KDFA 3KDSE 3C5CA 2VNUD 5C0XI 1KDPA 4NXNL 3BH7A 1IN6A 1WP9A 3UMSA 4LFBQ 4DCTA 3THYB 1JQLB 2ZITA 4NE2A 2P6UA 2H16A 4M9QA 2AUJD 1NTGA 2RGXA 3OF5A 3TGPA 1XEXA 2Q3MA 4BLPA 1SGWA 5E7JA 4HJAA 1Z6GA 1MJCA 3K8AA 1XBTA 2HIVA 4A75A 3U58A 4A3JH 1OF1A 2BBOA 2R7ZH 3OFND 2HF9A 4GZMA 1T0JB 4A3EG 1XXHB 3VR1A 3GTJH 1Q57A 1U81A 2FFBA 1IYJB 1R5BA 2IEYA 2RHSB 2REBA 1FPMA 5DLQC 3D6TB 4EPVA 4CIDA 1T0HB 3E5HA 4WOPA 3GTPH 2F9LA 1S8FA 1T3SA 4PZ7A 2QAGB 2RGAA 1Q82C 3GPLA 1G5PA 3IRBA 2EFDB 2PMDA 4DEXA 2HIXA 4HZUB 1DBSA 1KIMA 1QVGA 1VQCA 1E3MA 2AD5A 2F1MA 1FQKA 1IJFA 1E2KA 6Q21A 5JFGA 1VQBA 4HIOA 1VQ6A 4LHVA 2O8CB 3MFYA 5IWAL 1OKKD 1E2EA 5IP7G 1TU4A 3KJGA 1HV8A 3F8TA 2GBLA 2W6IA 3AKCA 3MG9A 1YZGA 3SN6A 4XWKA 3SGIA 2WAQE 2JLSA 3JZMA 3W6PA 4BZPA 1CSPA 1VS0A 4LW1A 3PFIA 1UEIA 3TE6A 2ODNA 3HJNA 3IIMA 2KCTA 2G83A 2Z0MA 4AYXA 1W36C 2ZSAA 4XIGS 1CBUA 1L1OC 2DGYA 1HUQA 3U3KA 4KJZA 1O7IA 1KSJA 3EPLA 2BOVA 3DLLA 4ME3A 3HOYG 1E9RA 4M9XA 5DGXA 2QM7A 4Y0AA 1H95A 2OCBA 4NCHA 2FNAA 1VCNA 2V8OA 4WXRA 1AJEA 3PEYA 2Z6KA 3Q8XB 3CNNA 2VHCA 4G5QA 1B70B 3A0JA 2ATVA 1XF9A 5BYJA 1G16A 4GLAC 4DK3C 4ZIRB 4O3MA 3U7HB 1PJRA 1QVCA 1ZC4A 1W3SA 2BC9A 3CLVA 3EIEA 2BWJA 2J46A 4Q4HB 1BBUA 2QROA 3FVQA 3LGJA 5JJIA 1CR0A 1YZKA 1KI1A 4K0KQ 3H1TA 4DLUA 4NYIQ 4BLSA 3AVXA 5J5CA 2K7VA 1Z63A 3EZ6A 1KK1A 2QQ0A 4B3CA 3E9HA 1AZSC 2GJ9A 3MUFA 4F4JA 4BXXG 5CK4A 3GD7A 3KUCA 1ZW6A 2BM0A 2LMCB 3CMEA 2W83A 3ZYCA 2KI5A 2W6JD 4TL8A 4UNNA 1XMOL 2J7KA 1UPTA 3M0EA 4QGFA 1ZNWA 2PEZA 4U7DA 2ZRBA 4MNOA 5FBVB 1LTLA 4QXAA 4P4UA 3A5UA 2ZJAA 4RD6A 521PA 4TQUS 4HIKA 2GHIA 4QBHA 5CB6A 2JIZD 1OIXA 4JYCA 4Q1EA 4GMDA 1RJ9A 4YLGA 2GEVA 2NZ8A 3TSZA 1AS2A 2GF9A 3QSYA 2O0JA 2FF7A 2IYQA 1NKTA 2WMOB 4PC3A 4DDTA 2W0MA 2JCSA 1RVDA 2ZI5A 4JLNA 3C16C 4LJ7A 5FOTA 1K3RA 3C5HA 2ZYVX 3D3QA 1P2SA 2EIFA 4XWOA 1FX0A 2IXFA 3K0SA 3RYTC 3PCRB 2Z6KC 4IJLA 1P9RA 4AG6A 1GIAA 3IO3A 4BA1I 2I5MX 3NDBB 3KF6A 5F9HA 3ADDA 4C2UA 4Z1MA 5FR1A 3J81i 1YZLA 1JAHA 3CH4B 3LVRE 5EE0A 1ELOA 1G18A 1NMXA 4LF4L 1IN8A 3AVQA 1TWFH 1NJFA 1YIJA 2KE5A 4LC0A 5C4JH 4PAOA 4PPNA 3BFKA 2Z4SA 3PJRA 1N6HA 4ZDJA 5IYBH 4TMXA 3THWB 4DV6L 1YJ5A 5J3BA 4QRHA 5A4JA 2Q3HA 3HWSA 5FTKA 1E2IA 5CLLA 1E6CA 4Q66C 1G17A 3CH5A 1KSGA 4TMWA 3PF4A 1E3PA 2GJAA 2OM2A 3PEUA 3SJCA 3WDNA 1VQNA 3K7UC 2OUKA 1KJZA 3SDZA 3AFQA 1OHHA 3EZFA 4IOKA 2D06A 4NDZA 3AF2A 1FR3A 4IPHA 1TNDA 4LK1C 4II7A 2J0UB 3ZD6A 3CCJA 3RHFA 4QM7A 1XMIA 3K09C 5DN6D 2ATXA 5LMUQ 2WHXA 5A35A 1NY6A 5FTMA 2PJRA 3AM1A 5HE9A 2QA5A 3HU2A 4W7SA 1VQMA 5JS8A 2BCGY 1JPJA 4EAQA 2H5XA 3U9SA 1K6MA 3U7EB 3KJOA 1K73C 4DUZL 4JBMA 4V0KA 3RAPR 2IHYA 3KQLA 1OPXA 1DS6A 4EDHA 1D5CA 4D82A 1X54A 2ZRJA 4PQFA 3PR1A 3G6EA 1Q22A 2ODEA 2RB4A 3ZVNA 2QE7D 4B75A 2W0SA 1XP8A 1XZQA 3CPFA 3CRRA 3TEHB 1MH1A 3VKWA 3U7FB 4D6PA 4LWZA 1JJCB 4GBMA 1EFUA 2JLYA 1IW7C 4JYBA 2HJGA 4DT1A 2A78A 5EXTA 1HE1C 3OFNA 5IK2D 5CM8B 2X2FA 1P2VA 2E1RA 4Q02A 3P27A 2E8GA 3BE4A 1HTWA 3M3YH 1DO2A 4X66Q 4C0KA 4A3IG 2E75C 1QHHA 2RGGA 2IUSA 2OT3B 3CPHA 4D4MA 1DTSA 4JBWA 5SZHB 2WJHA 2JA5H 4QM6A 1OXTA 2UUAQ 3BXZA 3FMFA 4B2LA 2VHJA 4GKKQ 1E9CA 3B1ZA 4FINA 4G3XA 5C2JB 5KDOA 3EZ9A 2VO1A 4KKSA 4B44A 2RGEA 3OPOA 2Q9AA 3NHAA 5B30A 1HT1E 2A6ED 3I92A 4A2PA 3T1OA 4CEHA 1NJGA 2QSYA 3C14C 3SHFA 3OW7A 2IW3A 1UE5A 3EZ2A 2AKWB 3UPUA 5FLMG 4RCNA 4MTNA 1VHTA 5G3YA 4KHPQ 1DAIA 1KKLA 3BJIC 1U0JA 2AHOA 2ZI3A 3GTQH 2K5HA 5L3RA 1GUAA 4V0ME 2XJ4A 2CNWD 4LF7L 2A6HC 4C0QC 4R4IA 4DR6Q 1I2DA 3LQRA 2OEPA 1TWCH 1V9PA 2UU9L 4B3TQ 4DSOA 4KHZA 3OYYA 1MKHA 2NZJA 3QEOA 1Y14B 1UE6A 3KFXA 3O8CA 4PC7A 2OFWA 3N2EA 4S35A 3S1AB 4P71A 3GJ5A 5BR8L 2W00A 4HJ8A 3EAQA 1EWHA 3QVVA 3OTOL 4YDSA 3BG3A 2F1JA 1VQIA 5M5YH 3I32A 2JAQA 1Z0FA 4KFUA 5EXXA 4DR2L 2VEDA 4FWTA 3K70B 5LMNW 3DM5A 1ODFA 1GOTA 2ZSBA 1EIFA 4ARZA 4TKOB 3IIJA 3TVDA 2ZM5A 4KN4C 3SE0A 3F2DA 2VH5R 1ZD8A 5BYKA 4PSVA 4BFTA 1CRPA 4IOCA 3LXXA 3KZ1E 1GL9B 1PHJA 2GILA 2JJ2D 3DPUA 1CLUA 2ZRNA 3GFOA 3RLNA 2V7QD 2ZS8A 4F93B 2FWRA 3QBVA 2WTUA 3EIHA 4A3KH 3F2CA 2ERYA 4LX0A 1GVPA 4YQFA 2D0PA 2HEIA 3QJYA 3WRYC 1IBKL 3K0CC 4JV5L 4XWAA 3NBXX 1ZBDA 2UXBL 1GFIA 4URWR 1N6NA 4DUZQ 1Z6AA 5IE8A 2WB1G 3RLFA 1HH2P 2JE6I 3I2ZA 2AX4A 5IYCH 2VS1A 1V8QA 3IFTA 1AS0A 2F7SA 4LYAA 1ZNZA 4TYPA 4C3HH 1OYWA 3A74A 2KJQA 1HZBA 3GJXC 3TBKA 5GJWC 4L5RC 2W2VA 1I3QH 4WZ6A 2ZRAA 1GL6A 1OH5A 3U4QA 3TUZC 2D7DA 5KUTA 5C44H 2R92G 1HNXL 3AB9A 3HOWH 4D4LA 3EXAA 1GD7A 1OHHD 4RZ2A 2OXRA 4LJAA 2RHMA 2KBEA 2Z5FA 3AKEA 4NH0A 1Q1QA 3MRSA 5FJ8G 2PJZA 4M1MA 3M4PA 3MAAC 2ZU6A 4A1FA 3G5UA 1ZUHA 3M4OH 3UXMA 4JI5Q 4RFSB 1G3QA 4Z51A 2YC4C 1G8PA 5CK5A 1GRQA 2EWWA 1LY1A 3NHBA 4D4JA 2V7QA 3HOZG 3IDQA 4OHZA 4XVUA 3LY5A 3N70A 4M8NE 4ASUA 1E0SA 1W49A 4YC7A 4HLCA 4TQAA 3ULPA 1KMQA 3M4YA 2ALYB 2QMEA 1P2UA 1W2BA 2EXDA 1HA3A 2ZJBA 5DYIA 4GKJQ 4DR3Q 4AQYL 4QBGB 1DAHA 3KF6B 2A68D 2D2EA 1AN0A 1K8RA 3SJBA 1RFLA 1N33Q 1P72A 4H02A 4HZIA 2WWHA 3IPXA 2WSMA 2E5LQ 1GNRA 4Q7KA 4IDPA 2E74C 3K0FB 4Q18A 1YHAA 1FL0A 5JBQA 2N1BA 5CM9C 4ZCLA 2DBYA 1VQLA 4YMWA 2DWQA 4AKIA 2IYSA 4ALPA 5K36G 5JCPA 2F43A 4B73A 1XD2A 3K70C 3X1DA 1CJVC 4HR7B 4KLKA 1L4YA 2D4HA 4WIAA 1P3JA 4UNRA 3LNNA 2JEBI 1X3GA 3VR5A 4DR5L 2MSEB 1M8PA 1XRJA 1XXHE 2AK2A 2HV8A 2QT0A 2R7DA 3AGQA 1QHXA 3FDIA 4JLDA 5JEDA 1WCMH 4DR3L 4AQYQ 1QZGA 3GJ7A 4DLRA 4GNXA 4JI4Q 3W6NA 2WAQG 4FMDB 3A37A 2C98A 2C9YA 4D0LB 1JEEA 1Q1ZA 3NC1C 5G41A 4TN1A 3H3VH 1O87A 1GP2A 3FFAA 3D7MA 1XEWY 3ADCA 5DNYB 4UKDA 2NN6H 3HOXG 2F4VL 1BOFA 2XOKD 1YRAA 3QOFA 3AP1A 4TMKA 5FUVA 2YU9H 3PIPA 3KB2A 4LNQA 4IVPA 4JL5A 1FUUA 4MGYR 3PO3G 3X1XA 3HR8A 2GXAA 4X8HA 4JYAL 3CX8A 4W5HA 3BJUA 1K8MA 4A3JG 4LBYA 2JLRA 2QNRA 4X64L 4OK3A 3B6YA 4XVQA 4JCVE 5KPJA 2JXMB 2ZUBA 4LJ6A 3RSOA 4CW7A 1AKEA 2P2LA 1IL2A 3MWYW 4TTQA 2X77A 2X1VA 3TW4A 4YCUA 4DV3Q 5LPNA 1HY3A 1G8FA 2WICA 1P5ZB 2V1CC 2XTNA 4R4TA 2F4VQ 4DT1B 3T35A 3I5XA 2QEXA 3BORA 1XD9A 5IP9G 3BU2A 1K5GA 2BKEA 4DLTA 5L8VA 2H17A 5JWOA 4ERNA 3T1YQ 2DFLA 2QGNA 5L3QA 5FTJA 5C44G 3HOWG 1YNNC 4LV5B 2YTXA 3ZZ0A 2UXDQ 3H86A 1G3IA 1HE8B 1KNQA 1EWRA 2GZAA 2W2XA 2ZRPA 2O5IC 3PO2H 2RKOA 2YOFA 1P60A 2PT7A 3WYFA 4FW9A 1HNWL 2D3WA 1HZAA 3OEEA 2CDNA 5JECA 5KNCA 3F0TA 3IUYA 3L0PA 3V4FA 1SVLA 3A4NA 3HYTA 2O5JC 1KO1A 4AK9A 4EPTA 2ZE8A 3IPYA 1ZM4A 2FEOA 1NBME 3R7WB 3U6KA 2CCKA 5HY6A 2UUAL 4HJ7A 4WZBE 1G1MA 4RD1A 4D80A 1UDWA 2BEKA 5M3FH 3FTQA 1TF7A 4HAYA 3CQZH 2XTIA 1Q86C 4OWWB 1DAEA 1M7GA 2WIAA 2F6RA 2B8GA 3MSXA 2ASEA 1M34E 5GAGC 4A3FG 2GJSA 4HB2A 1IM2A 1KY3A 2XJ9A 5JWRA 1W36D 1E2FA 2ZI6A 2ZRMA 4LOAA 4X66L 4RD0A 1RIFA 4KN7C 2JA9A 4DWJA 3WBJA 2L5TA 1EFRD 4AG5A 3UDXA 4B43A 4OHXA 2H18A 3RR5A 3H4MA 4FCVA 4ABYA 5IF9A 1VKJA 5A5GA 4Q48A 3QKSB 3IO5A 4NKRA 2IWRA 1AQUA 2PQAA 2AMCB 1U9IC 2CHVA 3HKZG 3VA7A 1JXOA 2OFOA 4FMBB 4OGQC 1NSTA 1LS6A 1FMLA 4JI6Q 2WJIA 2ZEJA 1AS3A 2ZYWX 1NF3A 4DV4Q 2FXQA 2BV3A 2YWGA 2A2ZA 4LRWA 4E22A 2CKZB 3QQ5A 3ZIAD 2ZTCA 1UM8A 4PAMA 1D2NA 2NO7A 1G7CA 1Y1WG 4Q19A 4IPDA 5DIFA 4QGUA 3VR3A 3WHLA 4ZDKA 3WBKA 4D0NA 2JK8A 4HIDA 1BMFD 2H7VA 5DHFA 3WRXC 4AY2A 4OK5A 4CZ2A 4TL7A 2A8VA 2J3EA 4OQXA 1XMOQ 5P21A 2ORWA 2VYFA 1F60A 1ZYUA 4GPTA 3BDOA 3B5JA 4TL9A 1RE0A 1R5OA 1EESA 3D4RA 1S40A 4N0DA 2GVZC 3H2YA 4F4IA 4A3CG 1OXSC 4B3SQ 3ZIAA 4NXML 1X8LA 2OCYC 4O2RA 4DV7Q 2IS1A 3KJHA 2KBFA 4Z8YA 4DLSA 3RABA 1CTMA 1Z28A 1BIFA 1IY2A 2FPMA 5M3MH 2GBLC 3RANA 4B32A 1U0HC 3VMFA 4RVCA 2DN8A 1GVNB 4Q1AA 4PXAA 5EXSA 3L2OB 1W2GA 4DIEA 4Q7LA 3FPAA 2CLCX 2JATA 4OYHA 4JZKA 3U2QA 2HLDD 2LXKA 4BPBA 1OE0A 4US0R 3RRZA 1ZC3A 1IXZA 1ZU4A 5M04A 4WXPA 5FOUA 4LF4Q 3VNUA 2DPXA 2F1HA 5B57C 4XD7D 4GN5A 3EASA 3KDFB 3W1BA 2UXCL 4GSYA 3RRMA 4HLUC 1UF9A 3W8RA 4PHTA 3R9IA 3KJPA 2JA6H 4B3RQ 1EX7A 5BN3A 2XNSA 4GOJA 4A4IA 4U02A 3SC3A 4ASUD 4EKDA 4BLTA 1SKYB 2AKAB 5IRCD 3WP1B 4C7OA 4KVGA 2QPAA 4CEIB 1KJWA 1MO4A 3I8XA 1HCZA 2Q21A 4P3YA 1QVAA 2RF4A 4G5OA 2Z0SA 3SYLA 5AJ3Q 3RLOA 3HGBA 1NN0A 1CSQA 2A5YB 2EDGA 4B47A 3DXJC 4A3BH 5AJ3L 1R5NA 1KQSA 1J70A 4TZ0A 1T5IA 1YVCA 3FMPB 5IHPA 1P16A 3QKRB 4K46A 5CLQA 2FU5C 2K50A 1E7ZA 1N2CE 1SVMA 1T91A 3AF0A 1TADA 1OLOA 3EC2A 1TL7C 1YJNA 4PZ6A 2VW9A 1NVUQ 3LH5A 5LMUL 2NO6A 5L3VA 4PPGA 4LFAL 1II9A 4HDCA 1N6RA 1KGDA 4BBSH 5IP7H 1IJEA 3LW7A 1EOVA 4ZPXA 1E1TA 5K8UA 3U5ZB 3GJ0A 5BXQC 2BDTA 2XITA 1DELA 4N3NA 4CF7A 3H15A 4NONA 4Q4AB 1ZINA 2HLDA 4I1OA 4QFMA 5DN6A 2R92H 4K81B 1EX6A 1F2UB 1SVWA 3GCGA 5GAEC 1E9SA 4BASA 4HIMA 3O8RA 3BIFA 3GQBA 3A1SA 3FHOA 3GMTA 3QG5A 4JJZA 1M90C 3B9PA 4GLXA 1HTPA 3F3YA 4W5JA 4OQNA 1U90A 3G71A 2IYRA 2ZRKA 3GLGE 4JOIC 4IDNA 4C4PA 4D26A 1US8A 1PH3A 1G19A 3PGZA 4A3GG 5FOVA 1XMQQ 4CT4B 2K5NA 3AVYA 1OXUA 1M1KC 2RAPA 3KXKA 1G9XA 3HOZH 2QF7A 1FJGL 3S2DH 2IYYA 3NKVA 5FPHA 2AD1A 5DISB 5LMNQ 2XNDA 4B3SL 3GJ4A 2QMHA 3R8FA 3DZ8A 3S16H 1C9OA 1Z07A 5JI3E 1DAKA 4JVMA 3U4ZA 5B64A 2YZ2A 1QHIA 5BR8Q 2ZJOA 3CCSA 1Z83A 4IEIA 5JEAJ 4Q9JA 1E98A 4HAXA 5CDFA 2P6RA 4GT1A 4V0NA 1RYFA 1E1RA 4KBGA 2OLJA 3HP1A 1PUJA 1IN5A 2D2CC 5E4FA 1OB2A 4O0MA 1G7RA 2Q8IB 4RCZA 3TRZA 2JLVA 2BMFA 3ONWA 3FKSA 1S9HA 1SMYC 3QF4B 2QGQA 5AUQA 4QJFA 2D7CA 4JIMA 4NPHA 3H0GH 3OE7A 1PVOA 2H5EA 4CYMA 2XAUA 2ZSFA 2RMKA 3T1QA 3RZOH 5AUPB 2F55A 4NXMQ 2B8TA 5FUYA 4JOIA 1QVRA 1J90A 4DUYL 1DXMA 1Q3HA 4URZR 2GAOA 2YWEA 4NYMQ 2KCCA 3M4QA 1RRCA 3B7GA 3ADKA 1JXMA 4LDJA 1VIAA 3GEEA 4KSBA 3R7WA 1KRSA 1OT3A 2BH8A 2E9SA 5JI2E 2N42A 1L4UA 1KL9A 3KKMA 2ZRGA 2VL6A 4I1VA 3SOPA 1ZAKA 2IS2A 2BBWA 5C3EH 1YNXA 4UNSA 1TQDA 2YJTD 4IQZA 5EP4A 3J7ZC 2DFNA 1AE2A 4KXFB 1GKHA 1N0WA 2B63G 3BFXA 3KJIA 3QF7A 4HEJA 4G7ZC 4GZYC 2VF7A 4DLYA 1OXXK 1I6HH 2GA8A 4PC2A 3FOZA 4KITB 3CCQA 2DUDA 4X6AH 4KYIB 1UKVY 2BCJQ 3OAAA 4GP6A 4OI4A 2GVBA 1GUSA 4XJXA 5SZKB 2JEAI 1VQDA 2ZJQA 3CRW1 3LVQE 5TMPA 1E79A 2VIIA 3MD0A 2NOAA 3ZVRA 4GI7A 1H9SA 4ACAA 2UUCQ 1P4SA 5F3WB 3LV8A 2WSSA 4RD2A 5CB8A 4UJ5A 1OH7A 1VQHA 2ZJYA 1K0RA 1W46A 4LF5Q 1IXSB 2EQBA 2P67A 4MGKR 4LFAQ 2NIPA 3ZZUA 4NCJA 4QBFA 4Y7NH 3SFZA 4DCUA 1JE5A 1XPRA 1Q1EA 2QM8A 3MEFA 1ZCBA 3RZDH 1FX0B 1FJGQ 1GUNA 1X86B 1EYGA 1ZJ6A 4IFDH 1Q7YC 2C9OA 2OBNA 3GP8A 3U61B 1N8RC 2A6EC 4L9SA 1DG1G 1Q3TA 3BB4A 3CF2A 3BB3A 4ZKDA 1KO8A 3GLHA 4PANA 4DUGD 1B23P 3NG1A 2AKYA 4V0MA 2CK3A 2HHHL 4R71A 3CNOA 3C15C 2JA8G 1KI8A 1VQEA 2NPIA 3PUXA 2JIZA 1IN4A 1VQ7A 1P7CA 3B2EA 3QXCA 3CX6A 3FB4A 5LD2C 1QHSA 4YHHQ 3F1ZA 3MWJA 3FHTA 4H9GA 2ZJ5A 4B3MQ 1K9MC 4DV1Q 1XNQQ 4WZAE 4R1JA 1N33L 5CYPA 1N34Q 4OI1A 1Z47A 4BFYA 1TU2B 4MH0R 4W9MC 1T8TA 2UVQA 2B29A 3TREA 1YZNA 2G3YA 4DNIA 1XNJA 1XCMA 3WHKA 1A2KC 3AF3A 4GKKL 4I99A 4LCBA 4OJQA 4HUTA 2OLKA 2VPPA 3EQLC 5IK2A 3TSOA 5HPYB 2X19A 3IEVA 3TZUA 1ONLA 5JRZA 2ZRDA 4NHOA 2ERXA 5CIQA 2REXB 1H9SB 1WXQA 1SVSA 1UFQA 3G0HA 2PH1A 3OIYA 3TW8B 1YHBA 2FFQA 4PHFA 2CCZA 4BFZA 3CD6A 3FHWA 3ZQ6A 4CGZA 4JI3L 2AHOB 2PMKA 1V1QA 1SXJD 4C0SA 3W9YA 1Z06A 1B8AA 4IFDJ 2VQFL 5AJYA 2E87A 3CIOA 2YVUA 2ZROA 1JI0A 2JDIA 3PUWA 4LJ4A 3SQXA 2EFGA 3K0XA 2BKUA 2ZREA 1KO5A 2R6CA 1LM0A 5AJWA 3CR7A 1CXZA 1NG9A 1N6OA 4B34A 4EPWA 2ZJPA 4P73A 5TV2A 5LBIA 3OEHD 3F2BA 5IP9H 1G8GA 2IC5A 1H9KA 4RD4A 4Q7JB 3WXMA 1GRRA 2I4IA 1W5SA 4A3LG 2ZM6Q 5H70A 3GLHE 2P5TB 5LDDC 1IBRA 4GMXA 1JR3A 1WBBA 3U3RA 2Q2UA 2B63H 2Z83A 4KFTA 4MRVA 4PZLA 4BEBA 1EWIA 2V55B 5D3MB 5F9FA 2NN6I 4TVAB 1NLYA 4NYIR 2OILA 4B76A 1NG1A 3NE5B 2AR7A 3NC0C 4LUCA 1GO3E 3PQCA 4MKGA 1TEVA 1A8VA 1WJJA 1MRNA 2HT1A 2QE7A 2YC2C 3HYRA 4KFSA 1QG4A 4NU0A 1ZIOA 2B3GA 5H1YA 4TLEA 1SN8A 4EJSB 3C7KA 4HAWA 3RS4A 1PLKA 1LVGA 2ZAMA 4MKHA 1BKDR 1E2NA 1JR3D 2BA1A 1TQ6A 4PHGA 4Q1FA 4RMFA 1KTVA 5KYKA 4RSGA 5EZ5A 2QP4A 3H84A 4JG2A 1CEEA 5HR5A 4CEIA 3S2HH 1E2DA 3KLWA 2REOA 3H94A 3A1WA 5C4XH 5ELXA 3IIKA 3QIAA 3K9HA 5GADC 1E9FA 2A5GA 2IF0A 2IXGA 1IY1A 1NSFA 2A68C 5L3SB 1KI3A 4QY7A 3EWSA 3FHCB 2MFIA 2UZ3A 5G40A 3KKQA 1I6VC 4JV5Q 4DV1L 1XNQL 4HAVA 3RSLA 2UXBQ 3IEUA 2JJ1D 5G3ZA 5UKDA 2HF8A 4TTRA 5K36H 1DAFA 5K8IA 1I94L 1ZU5A 4AYBG 3QI2A 4ARZB 4KCGA 2LSSA 2IY5B 1E1RD 4DSTA 1HYQA 1YU9A 2QPOA 3AQQA 4YMTA 1NIPA 1S0UA 4HAUA 3OW2A 3AKDA 3GFPA 1RRPA 4IPCA 2OCPA 3EW9A 4LSGA 3LBNA 5FUWA 1Y69U 4C0JA 4MITA 4IFEA 5AR1A 3X1YA 2BE5D 2DNEA 4URYR 3CPEA 4A82A 1RIPA 2C9CA 2JEOA 1GKUB 1LW7A 4X65Q 2NZHA 2D62A 1MRSA 1PUIA 1SKQA 3FE2A 1VTKA 2W6ID 2P65A 4TLAA 821PA 4DR4Q 4US2R 4GKJL 1NBMA 4M21A 4F38A 3UG7A 4JC0A 2PCJA 1XTIA 2ZI7A 4DR6L 4DK6C 3PVSA 1X55A 4K0KL 4Q01A 3AFPA 4L5QA 4XH9B 2UU9Q 4B3TL 5KSZA 1MJEA 1WRBA 2IK8A 2ECKA 2CWAA 3PUVA 4IFDI 2QMOA 1RKBA 2QRZA 3NXSA 4C0AC 1XDBA 4AURA 1KAOA 1S3OA 1G291 2QP3A 1VIYA 2ZANA 4LPKA 2HCBA 4QHTA 3VHXA 4JYAQ 1JEDA 3K8YA 2CHGA 1UKEA 2P6NA 1IN7A 2K32A 1E2GA 1E0AA 1XJQA 2P5SA 4B2IA 5CYOA 2QPTA 1E2LA 2HT6A 4A4DA 1XNRL 3K9LA 4JI7L 4HSEA 4OJKA 5JRJA 3L2PA 1E1OA 1XFAA 4RFSA 2QQEA 2AN9A 1VF5C 2J5XA 1TEXA 2ZT9C 4GLVB 5GADl 3CUEF 3PEVA 2G77B 1F5NA 1KZGB 1X8JA 3AB3A 4FMDF 3RS3A 3EA0A 2J0SA 2R9VA 2RGBA 3LBHA 2OV2A 1DCZA 2Q3FA 5HGQA 2GWHA 2IX1A 4B3GA 1TU3A 4DR7Q 4IJMA 3TR0A 1XB2A 5J4KA 4P4TA 4JVSB 1R0ZA 4KHPL 3UK6A 3MWKA 2VLIA 4LUZA 4W5WA 3EARA 4PR0A 1PH5A 3B85A 3QPUA 4HATA 4KKTA 4UJ3A 2N49A 1QVFA 1BYIA 4DRZA 2IS6A 3R9XA 3DOFA 1SRUA 3CCUA 1XWIA 2WWFA 5A0FA 4M1YA 4L5TA 4A3MH 1E9BA 3VHLB 4LFCQ 4HDQB 2JA5G 4B3DA 2NVXH 2WKQA 1LTQA 1CJUC 3LLMA 1WI5A 4QHYA 5JCZA 1S3SA 1NMGA 1E32A 1XEWX 1QJOA 2WM9B 4JLVA 3ERSX 2FJUA 1PFSA 1YR7A 4NCNA 1N36Q 4HJ9A 2K5VA 2WKRA 2HDNB 2ZR9A 2JLXA 1UAAA 2R6AA 4BA2I 2XNDD 2O8DA 2IEZA 1KI2A 1KD1C 3KTAA 3GLIE 1FTNA 3TAUA 4FMCB 1NL3A 3EA5A 3FKQA 3NH9A 3SYNA 1SXJE 4DK0A 1YVDA 5ELNA 4P33A 5G53C 2J0UA 3IILA 3OZXA 4GOPB 3MGCA 4DDVA 3TAHA 3QXJA 3WMGA 4A3GH 1IBKQ 3REGA 4KVAA 5EJEA 1HNWQ 4RG1A 4P75A 1HNXQ 4YWKA 1N25A 3E1SA 1KDRA 3T56B 2GCNA 3FMIA 3AF1A 1Z0DA 1Z0JA 3UIEA 1OFHA 5KTYA 4P4SA 2WVJA 4V0LA 1LUZA 1DADA 1KSHA 4DAYB 1GM5A 1MOZA 4MYCA 2NO0A 3W3ZB 4DCVA 2JLQA 1F3OA 4BFUA 4DNTB 2XZPA 5KOYA 3HKZE 3UANA 2IYUA 3LRPA 3ECCA 4TT3A 4HI0E 5KU1A 2QBYA 3I4MH 3B9QA 2R44A 2FV8A 4Q21A 5J47A 4G5RA 4KMUC 1HNZQ 2MMCA 3JC66 1N5KA 2K75A 2Q9BA 3DZDA 4WW0A 4QGHA 4C0LA 2GEDA 2GETA 2CL0X 2XB4A 4D25A 1R8QA 4AI6A 3GLIA 3VU9B 4JL8A 1BVSA 2WIBA 2PQAB 3RN5A 4YY3Q 3LLUA 1VCMA 4M1OA 1Y8PB 2HCJB 3A58B 1NY5A 3BBPA 2LXJA 4MKIA 4BY1G 4GFDA 2GNOA 3CPWA 1CTQA 2P3SA 2QL6A 3GEIA 3U4VA 2J0QA 1NN3A 4Q1CA 3ULLA 1R4AA 5EE5B 5IYDH 3FKSD 1XTKA 4U5XA 5F2EA 4DC9A 4TYNA 4LWCA 3ZVLA 1NMFA 2XSZD 2BA0A 2IYWA 1W2HA 4OI0A 1CJTC 1I4DD 4X65L 2JA6G 1KKMA 1N6LA 3BB1A 2PI2A 3IGFA 4B48A 1FYCA 1CU1A 4QQBX 3LO5A 1T8UA 1GITA 1R0YA 2QA4A 4CRWB 2K5UA 4JT2A 1E22A 2A19A 3I4OA 1IW7D 4NB3A 1T9HA 1YI2A 1KO7A 3LX8A 3KX2A 1M6NA 3REFA 2A5FA 5IY0A 2Q9CA 4FWIB 4LUVA 1GUOA 1J5EQ 2ZVPX 4QC2A 4IOAA 3JAMc 2A30A 2VA8A 2MO1A 1W0KA 4OHWA 1EQQA 1OV4A 5HCIA 1D2EA 1E9EA 4Q1BA 4X64Q 5JEAH 2E2JH 1TQ4A 2VBCA 3A5ZB 2QG6A 1GNPA 2ODWA 4H1UA 4TMTA 2I0QA 5EP1A 3NWJA 4HAZA 1EFHA 3VQTA 2IX0A 1OW3B 4DR2Q 1J7KA 4V0OA 1BS1A 3BH0A 2O8BB 2ZI9A 4Q4AA 1CJMA 1QHHB 2X2EA 3AUYA 4IOJA 3KQHA 4GN3B 2Y8EA 1HT2E 2J7PA 3QXHA 4Q4LA 1CF4A 4P32A 4ZV4A 3QVUA 4GS3A 1SVKA 2F9MA 1G6OA 3IQXA 4XVRA 2VTKA 3SYKA 3L7ZC 1R2QA 1VCIA 1AKYA 3N5CA 3B8HA 2WWWA 4UNQA 3UG6A 2GXSA 3L82B 5IYCG 1C1YA 4AKHA 5DHAA 4GNKA 2QSZA 1NLZA 2OSBA 4H0LC 3FFBA 3AGPA 3ICQB 2TMKA 1HURA 3PUZA 3LDAA 2CE7A 4A0RA 1GKIA 2N8NA 2VSXA 1IBLQ 4LF9L 4QHSA 4DV5L 2R6DA 3NEJA 2ANCA 3Q3JB 3DKPA 1BH2A 3KL4A 2PZFA 1ESMA 3NVAA 4TTPA 4A2QA 4AWXA 4BE7B 1DPFA 3N2IA 1YKSA 2BVNA 3R20A 1UEJA 1CKNA 2WBLC 2GRJA 1Z3IX 4QG7A 3T51B 5KSOA 4LHWA 1VPLA 2MQHA 1WF3A 2I1QA 3U50C 3CZPA 3ZJYA 2BJWA 2EWVA 3ZS8A 5L3SA 5IT9c 4OO1I 2W58A 3CR8A 3Q72A 1N0VC 2I5LX 4ITRC 4YXWA 3TLXA 1R0WA 3T61A 1Z0AA 1ASZA 2YINC 1IQPA 4GNXB 2H8KA 2A3RA 3RVBA 1AA9A 3WY9A 4QKQA 5FH9A 1IAQA 1VG0B 4Q9HA 2C8VA 2R62A 2R93G 1C7YA 3RC3A 2BJVA 5C4MA 1RJ9B 3TNFA 5FPYA 3SFVA 1XD8A 2I5HA 2GVAA 1G21E 1VHLA 5B2ZA 1N5LA 1US8B 2QI9C 3M85A 3NEYA 4POFA 4JLMA 3TJZA 4YXWD 4F91B 1D9XA 2CLDX 2HUPA 5BN4A 3EC1A 2BMEA 3THYA 2XXAB 1RC8A 2A6HD 1KI6B 1Z2CA 1WMSA 4YHHL 1W4BA 3ULJA 3KFVA 3VTKA 2YHSA 4HB4A 2EFEB 1W1WA 1KZ7B 1N5IA 1GHKA 3DM9B 4MYUA 4Z54A 4C7OB 2DCUA 4DLVA 2CK3D 4TQ9A 3SHWA 2WOJA 3I4LA 1CKMA 5DSZA 2QN6A 3STBC 3VX3A 4M2LA 4AC9A 5C18A 1XXHA 2UUBQ 4LC1A 4ZI3A 2O8FB 2IHFA 2OQ0A 1B9NA 3KXLA 5GJVC 2ZPTX 2AFHE 3KUDA 4QGGA 2VP2A 4WJ3M 2FZLA 2N78A 1IHUA 3TH5A 1PH2A 3BZKA 4RFVA 1F48A 4A3LH 2L15A 1G7TA 3CB4A 4R4CA 2XTMA 4QNRA 1FL9A 3S14H 2J0VA 1FOEB 2V9PA 1TTTA 2LWIA 1E2PA 1KDOA 4LV6A 1PH1A 1UBCA 5DI3A 3UDFA 1IXRA 3AQ4A 3Q8DA 3ZLJA 1QUQA 2O8DB 1ZUNB 1A7JA 4V02A 3M1IA 3S1QH 3PXGA 2J9RA 1OFUX 3EG5A 2R6GA 5FOXA 1EWQA 5KSPA 2NMVA 1SROA 2BMDA 4DV3L 2XZOA 1VQAA 2ZI4A 2F3RA 3J80c 1IXRC 5JWHA 2AXNA 2CE2X 2WAYA 4KU4A 3A8JE 2JA7H 3HOVG 1CS4C 1JB7A 1ZM2A 4LHYA 1F6BA 4O25A 4B3FX 1GWNA 3LXRA 3T1TA 3OEED 3I61A 3I7FA 1DO0A 3GFTA 2GJ8A 2HQLA 2V3CC 3A1TA 1FMJA 3EN2A 4M1KA 4Q03A 2QTFA 1OKKA 2GZDA 2ZVQX 1G64A 2ZTEA 4M53A 4BEJA 4D4KA 2WPDD 1LACA 4PAQA 3BC1A 4EFMA 3P4XA 4ZIRA 3VR2A 2OESA 3S1MH 1Z08A 2G1KA 2L0XA 3SZRA 4BY7G 1GNQA 3NH6A 4TLCA 2IYVA 4LFBL 3SBEA 5E3HA 3DMNA 4HUQB 1KRTA 4BZQA 2PCFB 1PLJA 4DLZA 1E99A 1SZPA 2NO9A 3OIUA 4Y52H 1WQ1R 1PYBA 1CI3M 1Y63A 1M74A 4YONB 2FX3A 4RY2A 4P74A 1NRJB 2CXXA 3ZH9B 4EQ5A 4MYTA 4TYQA 2ZU0C 3A8TA 4A15A 3GO5A 1S96A 3BD9A 3KOJA 1B0UA 3B78A 2IYTA 2RGCA 4JVNA 4JSYA 4JI5L 2VUMG 3IHLA 1UE1A 1UWVA
chains in the Genus database with same CATH superfamily
4EJMA 2A5HA 1VE7A 3BWCA 4OH7A 4IIFA 1GZDA 5FFFA 1TT5A 1PSZA 3P0JA 4MRRA 3TNLA 2RHHA 2X42A 1YTLA 3LGAA 2O7SA 1AHPA 1EWQA 4O4IF 1Z2AA 2CBGA 3B1VA 5JS7A 1AV6A 3FOFC 4L15A 4US1R 1JU3A 3VOBA 2Y0EA 3GJ6A 1KHTA 1VFPA 2WF8A 1WTQA 2PMFA 1SU6A 3F74A 3I5MA 3F47A 4KGDA 4PFKA 1JQKA 2JGEA 5F7JA 4LAAA 2PGLA 1PTOD 2R25B 3QW4B 3TMKA 1X8XA 5DK4A 5AIAA 5BUQA 3H42B 5JROA 1EFVA 5GOTA 2R8PA 3OPXA 2Q1TA 4OLBA 1B1AA 2XLBA 3BWEA 4OHOA 4PE5B 1Q21A 1RDFA 1L4BA 5CV5A 4KYUA 3TLKA 2WWXA 1KHIA 3HNOA 1L0YB 4LZZA 1SEBD 4FGJA 3CCEA 4RDCA 4UW9A 3ZU6A 3FLAA 3EPHA 1FFWA 1BFUA 3OQIB 3U3JA 1Z2OX 2Z2YA 3FW1A 4REQB 1RRFA 3S0JA 4WXHA 1MC5A 1KEKA 4KWIA 3GP7A 3IMFA 3DZIA 4DR1B 4LBZA 4DL9A 3JALB 3RZOB 3U16A 2IYZA 4OFZA 4JVLA 2CVHA 1HNZL 3ABZA 3VGPA 3SJUA 1VPWA 3KLRA 4LHZA 3BYYB 4E15A 1P17A 1ML0D 2P62A 2FWAA 2EJGC 3NCTA 3MUNA 4I7EA 4Y1RA 5DM0A 1FB5A 3TCNA 2OTLA 4KHVA 1DG3A 2EQAA 1ZJZA 2CUNA 4MI6A 2J3IA 3F6SA 4EVQA 4IEEA 4Z1MD 2IIQA 1NR2A 1JEYA 3EVAA 3ND8A 3F2VA 4RU1A 3WNCA 3CC2A 3I9MA 1RF2D 1VLMA 3SQMA 4EJSC 1JJBA 1P61B 1NM5A 2C99A 2V4ZA 4JYAB 2P6OA 2PSJA 4K86A 4KQKA 3QEAZ 3QRWA 5K0TA 5JEEA 1RT9A 1UDXA 2B94A 5F2DA 1C14A 1XZPA 3DC7A 4Y6RA 1IN1A 1LYLA 2DJGC 2JLAA 4K9SA 4LRSB 4X3UA 1I50B 4IUDS 3M70A 2PYDA 3QOXA 3EIVA 2CL5A 4JC4A 3IB6A 4N65A 4QPPA 1JDZA 1LF0A 5EG5A 1CE8A 1GZSA 1L2FA 2AUMA 2B2XA 5EA2A 4ALJA 2EY5A 1UODA 1KPGA 2FI1A 3AF4A 3F6YA 3ORRA 4YY3L 1Z0KA 4U00A 1Z0UA 5AKIA 4FB4A 1KMHB 3GLKA 3P1HA 1FTWA 1NW8A 2DWOA 2PD4A 3P9IA 1GILA 2XDQA 4HAIA 3OOHA 2JA7G 2CC2A 3KOUA 3V7WA 3S8MA 2IUUA 2MSWA 2VQEL 4B9AA 2NZOA 2SECE 5DMXA 1PT7A 5IDXA 4FN4A 1DEKA 1VCOA 4LMRA 4DSUA 1GJXA 1N3IA 4XGNA 3INTA 4LYDA 3UCFA 2ONZA 4XASA 4V190 3DLBA 3FCAA 1EK1A 3IULA 4UE6A 5AXDA 4H60A 4R8RA 1NUPA 4Y30A 5KTOA 3GGJA 2HMTA 3FYUC 1NASA 3G0CA 1R74A 3VDYA 1DX9A 1RKXA 1I7PA 1YR9A 3TQSA 3PEFA 3WJ1A 4E5MA 1N9ZA 2JJQA 3Q9LA 2QYHA 2CBXA 4UE2A 1U0BB 2VF8A 3WOEA 2VTDA 1P62B 2RHBA 1R4MB 4XDGA 5CIWA 1YR2A 4EPYA 2F0QA 3L0CA 1O8CA 5LOVB 3A3KA 3UJAA 1FNSA 2DG2A 1I14A 2A94A 1RZ3A 3E0EA 5IXSA 3ROTA 1ECJA 2VT6A 2BE5C 1OSNA 2F67A 4A2CA 1R1DA 4KB5A 4X6UA 2QTVB 3B3AA 4JQCA 2JANA 5DHRA 3H9CA 5FWAA 1QCYA 4PRLA 4YALA 2KA7A 3KETA 1SIWA 3EVBA 4ESHA 3RF6A 3L92A 1UE7A 4FF3A 2OFFA 1P19A 4DIMA 2UUCL 2C2GA 2II6A 3FCXA 5C7LO 4NRDA 2O2CA 3NJRA 3EAGA 2Q6LA 1RM3A 3VYWA 1ZYRC 4ENUA 4EG0A 5BV1A 2HIAA 2Z2ZA 4NYMR 4N7RA 1Y8ZA 1NULA 3JQGB 3Q88A 4J1TC 2PX4A 1UOOA 4PLCA 1TPZA 4R3UC 4ZCMA 3GEDA 2JJ2A 5M5BA 3V6LA 4KAFA 4NBWA 5A5FA 1KAWA 4N4AA 4CKCA 1FFXB 4YQEA 2F2TA 2HDLA 2D2VA 4OK6A 4LTDA 1Q1GA 1GRCA 3BQ9A 2V74B 3ABIA 1C3XA 4W9NC 3KZKA 1ZO8A 2JHCA 1IVYA 4Q00A 4BATA 1ZVVA 1DJMA 1W0JA 4ARSA 1JZSA 4R4OA 2XV1A 4HCSA 2XQJA 3ESCA 3PX7A 2Y77A 2PKYX 3UMMA 1V7ZA 1STOA 4JI1Q 3QBEA 3KJEA 4PV1C 4BLQA 3A06A 1CUEA 5C4XG 1YUBA 5F7XA 3MJRA 5FCDA 4ZQGA 4K88A 5BYAA 3OHSX 2JBAB 2FINB 1OI3A 1JQ5A 2VPIA 2QUJA 4HUJA 4BNWA 2OWOA 2VHUA 3EGDA 2LVBA 4M0LA 1Z0SA 4E70A 3KYIB 4UUOA 4CM1A 3PFGA 1Z5VA 1OIVA 2VF5X 1HXHA 3FPKA 3QOLA 3LY8A 1ICIA 4CF3A 3KE9A 2XA9A 2QPLA 4KTAA 3K35A 3CMAA 5IIFA 5IGBA 3EPRA 3GFRA 3GQVA 1UBFA 2ZGVA 4UBLA 4W5RA 4C3UA 5B58T 5EZYA 1LZKA 2F4VB 2FSFA 4L9RA 3KBXA 2BRUC 2P9FA 2JKZA 1G8AA 2QMYA 1NAPA 3AH8A 3E1GA 2FMMA 5IH7A 3LX4A 1K5HA 4X24A 4FMPA 3C3MA 2GPSA 2I9KA 4JI3Q 5KRUA 1TCBA 1V1RB 3QLVA 4FUTA 3FNBA 1DCTA 3UVEA 3H91A 3EZXA 3QF4A 4HLUA 2D0IA 1CUFA 3LWNA 1OU4A 3GPBA 5DWVA 4B6EA 1X7HA 3L7AA 2O3TA 1BDOA 1KQOA 1I2ZA 3HHEA 4A76A 1YHZA 4HK4A 1M5UA 1PZEA 4K2LA 1SOUA 2H1RA 2PBLA 1RADA 2WWYA 3PFCA 2YVLA 2HYIC 4GS5A 1WM1A 4RY8A 3EROA 1JQDA 2OYCA 4JBJA 2XYGA 1FNWA 3BIWA 1LBSA 3DOCA 4LY0A 4NP5A 3PXDA 1H4VB 1CEYA 2ZRHA 5IG2A 4PG7A 1DM0B 1XJ0A 2GKSA 5JCOA 3IQIX 2I1VB 2FG5A 5J4VA 5JS6A 2TMPA 2IP4A 3AUXA 2D0OA 1YA6A 4G0NA 2OAP1 4GKAA 4CKCB 1KZ9A 3A26A 1SYEA 3FMCA 3TVTA 4BO2A 3B1KA 5JS2A 3ICVA 1MAAA 1YK0A 3R3ZA 5JJ5A 4AQYB 2B2WC 1S4ZA 2FPXA 5E0KB 5I4KA 2D1YA 1IHZA 4JJIA 2X0KA 5IEJA 1D04A 4RGVA 1U8ZA 4C0HA 3ZWNA 3RC8A 1DBQA 3A14A 3Q3EA 1PR9A 3ROKA 221PA 2XEXA 4AJOA 3MWFA 3A11A 4ZAXA 1ZKOA 2MHCA 1SA0A 4CF4A 3THWA 3OY2A 2GAAA 4KGVA 1EK0A 4RANA 4RMGA 3FOEC 3I5YA 1C0KA 2OCLA 1C81A 3W6OA 5EHXA 5I48A 3S24A 1S4MA 5D00A 3DLTA 1VBNA 2IJGX 4URFA 4C56C 3QVXA 3CGGA 1ESFA 1LDBA 2IYEA 2WTNA 2YR0A 2GCGA 3N3AC 1Y3BE 4L0CA 3CWZA 2R7FA 1DFGA 2DMRA 1AE3A 1JIJA 2EW8A 2ORVA 3ADBA 2QRGA 5EWJB 5LP6B 2IIBA 2IYLD 1E2VA 5DP1A 5IT9A 3JYHA 4CEHB 1F8FA 4EUNA 1KS9A 4OWTB 4IMRA 2VHYA 5ALEA 3BVGA 1X6VA 3QLUC 1TA4A 2FLKA 2WJWA 3IV6A 1XO1A 3VTFA 1I3OA 4OSPA 3T1VA 1MP0A 3BD6A 1JHZA 4YAKA 1PNRA 2DE0X 3HR4A 5AJVB 1I1OA 1LBHA 1ACMA 1TK3A 2HV9A 3JYQA 1Q20A 3I4NG 2QW1A 4JI5B 2I7XA 4LXIA 3RVPA 2HOQA 4FQ8A 4ARUA 4B73A 1QV7A 2YMLA 1XTDA 5FUMA 2QD1A 2C5LA 1QH1A 4MLCA 4Q0MA 5M5WB 1LRLA 2DUNA 2CCJA 2D5LA 4U63A 1WDKA 1O94A 2JCGA 3FYHA 2MSDB 4RIHA 1EK5A 3NSWA 3HFZB 1R10A 4ID3A 3BL8A 1E2MA 4AH6A 5E2IA 3AR7A 1USUA 4TSFD 1XX6A 4OMUA 1X65A 4PC1A 5FTNA 5HM8A 1UZLA 1U8TA 4E1AA 2B99A 3EG9A 2P91A 1OLXA 3RUZA 2F1IA 1A4RA 1TTQB 2AOTB 2PBRA 1FQJA 4RKEA 3WGMA 3GT7A 4DXHA 5I7SA 2F3VA 5KIXA 3J81A 2CJPA 2BJHA 4CU2A 1X1RA 4QOIA 3NC4A 1JVNA 1G2SA 2ZR7A 3T0IA 4CLDA 2DSNA 4QBIA 4YDQA 1XZGA 1X1AA 5C4GB 1XVTA 2ID4A 4Y0VA 3VR4H 2VJQA 5BW8A 2P0AA 2G88A 2JCBA 2VHTA 3SLKA 1JFLA 5ITZA 4Q6BA 1F4VA 1KVSA 1FXWA 1WLYA 4UEWA 1ADGA 2FUEA 5JVH3 2GDZA 2H57A 2FX5A 2QP9X 2QXUA 3WGIA 1WTHA 1A0IA 1CEQA 2DQZA 2FPLA 3PRHA 1M5TA 3DTYA 3JD2A 1QVVA 3K9NA 1EJ0A 4G1FA 4UEKA 5LQCA 2QLBA 1Q15A 4UHCA 1N8TA 5LDHA 1Z13A 2FG6C 4H13C 2VRNA 1E2JA 1IOZA 3B82A 1GPKA 1HH4A 3K5LA 4DMCA 3RIMA 3ZQJA 4NDNE 4QIWE 1SCAA 1VKNA 4LWQA 2QY6A 2RIRA 2BM1A 3AMVA 5K03A 1REQA 3CV3A 1XPUA 4JI6L 1F2TB 2XQIA 4ZZ0A 2W6CX 5FFMA 3WGNA 5IN4A 3R6TA 9LDBA 4EY6A 1UZAA 4LY6A 1F2TA 5DOVA 3L5KA 4EA7A 3RU9A 2EZ9A 2QI9F 1SCUB 3BREA 3D6FA 5DX1A 3VNRA 1FP6A 2CH4A 4G1VA 4TQGA 4BQEA 5LP6F 3L4BC 2EJFC 3PQ3A 2QKYA 1QP4A 2HA6A 1YBAA 1E9VA 3S2SA 4O3FA 5AUOB 2G71A 1F2UA 2GPNA 4F96A 3R44A 1LS1A 4Y3UA 4MVJE 2C1ZA 4S2UA 4RESA 4AKGA 4C6SA 4GP7A 2C03A 4FC6A 4K8IA 4LF5L 1MIOB 1A1VA 4G07A 2YRWA 1JU4A 2WJ3A 3WMRA 2AQ8A 3GFGA 2K4KA 2GYWA 5BSUA 4DB4A 4O4JB 2RAUA 1CUWA 5DCWA 1F9SA 3ZDRA 4B4WA 1ZSYA 1D7OA 2QVCA 3ITDA 1EDOA 2BFEA 2O2SA 3NHRA 3MXNB 3B1XA 3O21A 3AVPA 5EPLA 3OD1A 4P31A 4AT1A 4IF4A 4IRMA 1WWKA 2PV7A 3TZ6A 1RYNA 3QXXA 3A56A 3ZZTA 3DEZA 1BE0A 1KQPA 5EUCA 4BKPA 3QVGB 2VH1A 1GSIA 4NK4A 4R9NA 4DIOA 3K05A 4EF4A 3ES9A 3LUJA 1MFPA 1HNWB 1HEIA 1MDFA 1Y1SA 1N77A 3T94A 2BMWA 3ESXA 4LXTA 3QWHA 4GOXA 1NSYA 1ENYA 3JVDA 4D8TA 1Y81A 2KVMA 1YS9A 3ZE6A 5JR3A 3WADA 2D13A 4C2TA 5I8PA 2XB2A 1LV8A 4BTVA 4RHSA 4YDHB 1QIFA 3S5UA 3ZPXA 3NENA 1WDTA 1I36A 4G1MB 1TS2A 1P31A 2IXDA 5M3FG 3HYSA 4P2GA 4PLFA 1NXVA 2EJCA 2PYKA 4HF7A 4BKMA 1F2DA 3OPMA 4A8TA 2QN7A 4L8JA 1NUHA 1VPVA 4WZZA 3L49A 2O2LD 3QFHA 3O8QA 3RSQA 4Z6KA 1GUGA 1C8LA 3EY4A 2X7JA 1PH6A 2JNWA 2XY4A 2FZ4A 4QARA 4QPZA 3UMCA 2WWIA 2O57A 3H3JA 5CX1B 4DMGA 2W2LA 4AYWA 2HXSA 3O8BA 4U2EA 1C9JA 3WHPA 4DUGA 4DY6A 3I28A 3ERCA 2YQZA 3L84A 4QGAA 3TL3A 1VSTA 1Z6TA 4J16C 1PV4A 1BJTA 4G8BA 3OAAD 3ZHYA 2IF2A 4AMVA 2BFEB 2PZMA 1PS8A 1FW6A 1NGSA 1FNUA 2I62A 1G2PA 1MA3A 1BDJA 4X62L 2CXRA 1N0UA 4DV0L 1UJNA 3DCIA 3WIOA 2X14A 3WLFA 5EIXA 4UBMA 3KZVA 4BKQA 4NPAA 2Z4RA 3AETB 4FDVA 2JC3A 3N2KB 3GVCA 4LHXA 5FPHA 3WWYA 1RQ2A 3NYIA 3EEIA 1CUKA 1O7LA 4U3JA 4IIYA 4XVCA 4CLRB 5E9AA 1EQRA 1QPGA 3L7IA 3WDLA 4EHDA 3EEBA 3G23A 4F4IA 2PAAA 3ONFA 1SQFA 1T1RA 1XDDA 4S1PA 5HCUA 1YVPA 1PRTC 1E61A 5FJ8H 3CHBD 3OIVA 4A3MB 2ZSEA 2Z8YM 3WKDA 2ZYSA 1V5GA 4CTJA 1RI4A 1EH5A 4NAHA 4YMLA 3BA6A 1HG0A 3LRXA 3GDGA 3BKXA 1WUTA 1PRTD 2VVTA 3FPPA 4A93G 4N01A 1QM5A 4JOCA 1NQTA 1C0AA 1XAHA 2CYBA 2RFLA 4JI3B 3FRPB 1RHJA 2HPVA 4YX9A 4MVJA 3BERA 1YOVB 1R18A 1TO6A 2XYVA 1CDEA 1Y5NA 2V6IA 4P98A 4FGWA 2UYQA 1SUSA 5ER6A 5K3CA 2FN9A 3VZQA 5AW3A 4REMA 1CY6A 2WJYA 3G2QA 4PSKA 4JLPA 2FAXA 2FKAA 3VOAA 2RGNC 1KO4A 1TWHH 2Z3ZA 3D7LA 1N2CA 4DNRB 4RACA 2QAJA 3NLLA 2BH9A 2QRNA 3MMPA 2OHFA 5KDLA 2BFPA 3KEQA 1VQJA 5JCOC 5EKLA 3CCFA 1G7SA 1WDMA 1BX1A 2B7BA 2OBYA 3I3SR 4JLSA 4LY9A 5CV9A 1UBSB 2ZS7A 3TSWA 3AL0C 4RVHA 3OWFA 3NIBA 5GAHC 3HU3A 4O29A 5AI5A 2ZJ6A 4O1HA 4NXNQ 3IBYA 4DDWA 3TDNA 2FZ5A 4MGIR 3DFUA 1Q81C 3PB3A 4TT3D 5BQPA 1HZJA 1SR8A 2OHXA 3RRBA 5FJJA 5HTOA 2HDOA 2C5FA 1HLPA 3EDQA 3ZJ4A 3AO0B 5J4YA 5JPCA 3R9XB 3DEOA 3VVLA 4IGEA 2NTJA 4UEQA 1PMRA 3X3MA 1H8HA 1I4WA 1PEYA 4IQ8A 3WBFA 5CC4A 3CPJB 1VG9B 3WIUA 3VU9A 3K9CA 3MTDA 4FFPA 5IVIA 3O1HB 1XMSA 3IL2A 5KIAA 3L9WA 1MO5A 3H2IA 3TS2A 2CNWA 4ZO9A 4L5BA 5DNWA 4ZOBA 5CCEA 3CGWA 3RK1A 4FOSA 4L0MA 2JLZA 1AW7A 1W44A 3UJHA 2DOKA 3H9QA 4Q9KA 4E03A 2GRAA 1P0IA 2Z2XA 4MYDA 3K09A 1O95C 2GPTA 3UMFA 3NDIA 5AIBA 1PNTA 1NBOA 1TM5E 2D5DA 3HC7A 4GU5A 4EUSA 7AT1A 1YOVA 5COYA 2EJMA 5L3ZA 2UUCB 1PXUA 2ZR0A 3L0DA 4I1SA 721PA 1TEZA 1W9MA 5K8LA 3H2KA 2JL1A 4PTZA 4FHCA 2X9LA 3Q2KA 2XVZA 3RRYA 2OBMA 4QFBA 3V1NA 1K3UB 2RK6A 2OCAA 2PLAA 2RAFA 3I5AA 2G0NA 4M8LA 4QVKA 5LMNL 1T3LA 5BWMA 3PFNA 4CV3A 3BZCA 2UUBL 2PPLA 5EKTA 1A0OA 2QR2A 1VQOA 3LTNC 1IKMA 3BKWA 1X80B 1T5TA 1D07A 3CKLA 3ICEA 3BMXA 1YB5A 2H9AA 2W2KB 5CA1B 4DFDA 1F8XA 5E1FA 1EE9A 2VUMH 4C6TA 2X7HA 3FTDA 4IHAA 3K7AB 1U5BB 2BDUA 4PG3A 1XKXA 1W0KD 3PXAA 3JZDA 3B3QA 3HCWA 2IX9A 1ZH2A 3J80i 1CUAA 1CHNA 3FJ1A 5I7WA 3GH3A 2GZ2A 2DFVA 4DR4L 3T3GA 4WCFA 4HRXA 4TWBA 3DJYA 2IHEA 2PUCA 1NDUA 3N1UA 4E5VA 3IALA 5JMTA 4N9WA 4R8SA 4IWNA 4MR8A 2FQWA 4QICA 2HK7A 3MMZA 3PK0A 5K0CA 1R9NA 1EDZA 1ZGZA 1K75A 1O3YA 2QZ4A 2NO1A 4H35A 3X1WA 4UXIA 1N5JA 4PZEA 5EVCA 3TLEA 5IASA 4ZTUB 4JI2L 1QOPB 2CLMB 1KOFA 2R7ZG 5CHYA 5FI1B 4ER3A 3CVVA 2VFAA 1P45A 1TUBB 2B9EA 4OO1H 3AWDA 4XB1A 2C7VA 2A1AA 2V8BA 1LFDB 2ZRQA 4UHKA 4IO9A 2VWQA 1LLQA 1U5CA 1NRWA 1UFVA 1UP4A 1FQOA 2CFOA 3DBHB 3EH2A 2JIMA 2QTLA 2IOHA 3LQQA 4FWBA 5IEBA 3IAS6 2INGX 4X1IA 1K3FA 2FP4B 2G7ZA 2BELA 1N9GA 1MHPA 3HL4A 4XB6B 1TTPB 1SKAA 1IRXA 2G5DA 1MO6A 4A3GB 5FPPA 2O6HA 3TI9A 2QSUA 2C95A 3ELYA 4IDHA 3ZVMA 4DDMA 5FPKA 2FCRA 5SYMA 3WX0A 2W6OA 5IULC 2KECA 1H2YA 2Q1WA 5E3IA 2JLUA 3K15A 1UOQA 4G9BA 3KO8A 3RC7A 2Q2NA 4GI2A 2AG8A 3C4JA 3VVMA 3PO2B