3PV0A

Crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 86
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pv0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pv0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pv0A01
4PSAA 2C77A 1RRCA 3R9IA 4A75A 1T3LA 5M3FG 1HH2P 2VLIA 1DG1G 3TEHB 1JQLB 1G7SA 1IXSB 1IZ6A 3BZCA 1SHKA 1T5EA 2D06A 2ZRBA 3C16C 4PHTA 3H0GH 4JI8L 1XMSA 4WZ6A 4BFTA 4YQFA 2ZRJA 1LW7A 3J81i 4IFDJ 2VQEQ 2Q9AA 3AVTA 1Q12A 2R8RA 4FIDA 2W2TA 2F1HA 2GA8A 1BDOA 3TSOA 3U4QB 5JEDA 3KXIA 1ASZA 1Z6AA 1WCMH 3TZUA 5GJBA 1EFRA 3FMCA 1YZKA 2SHKA 1KI9A 4LJ4A 5GADl 2CVFA 3K0SA 2NTYC 4HLUC 2NG1A 1ZYRC 2JK8A 3IHWA 4ESHA 2FXQA 2AXNA 2W00A 4MYCA 3ZLJA 1C0AA 3H0KA 4FMBB 3M9BA 3LLMA 2GBLC 1E2DA 3M4PA 2KE5A 2QTHA 2J7PD 3CW2A 1KKMA 4HAWA 4LJ8A 5EXPA 3T35A 1ZM2A 3K0CA 3Q5EA 1P2SA 2R7ZH 4JSYA 2XSZD 3E70C 5KPDA 3KQUA 3R8FA 4AWXA 5DIFA 2LMCB 1FMJA 1GFIA 2XTZA 2Z6KC 1HZ9A 2ZI7A 4NBSA 2YC4C 5IWAL 4A4DA 2QPAA 1W4RA 2OXRA 4GP6A 4A3MH 3QPWA 4DLTA 1GNPA 1E2FA 1A8VA 4DEYA 4TYWA 3S17H 4G7HC 3CRMA 4JBXA 1N6HA 4LK2A 4ZDJA 5A4JA 3CRKC 1E32A 1T5LA 4W7SA 3EIQA 3HGBA 4HJ8A 2CL6X 4A6PA 4CEIA 3KKOA 4JI1L 2JJ2D 2KHJA 4HB0A 3GPLA 2RHDA 1HZCA 3BH6A 1LF0A 2QRZA 1Z63A 4TT3D 3VR4A 4A3BH 4CZ2A 1QDEA 4QBGB 1W7AA 4JI2Q 2B29A 2F55A 2C03A 2G0NA 3SE0A 4YCUA 2IC5A 2Z6KA 1VQKA 3S15H 2F43B 1C9OA 5AJ3L 1YJNA 1KI2A 2HDNB 3NHAA 2EU8A 1I2DA 1Q86C 2VP9A 2YWFA 3PJRA 3CIOA 2ECKA 4HZIA 4CF7A 1E2VA 3MEFA 2GJKA 1E2HA 2QAGC 3GFPA 4TN1A 4DHEA 4MYTA 3VMFA 1CI3M 4JOIA 4D80A 2FWRA 1XB2A 4HDOB 4XTCS 2ZYUX 3T53B 2A5GA 4ZDIA 3U4VA 4ZKDA 3WP1B 4Y0VA 3GLGA 4G5SA 3KKNA 4S35A 2O8FB 3B1VA 3HKSA 2FMXA 4EDHA 4EPXA 4A3MG 3GQBA 1NN0A 2RGNA 4A3JG 4G5QA 3GO5A 4KN4C 1HQCA 2F7SA 3EARA 2ZIAA 4BFUA 2ZRKA 3E0EA 1IBRA 3HFZB 3DPUA 2ONKA 1DOAA 4NTZA 4LW1A 1FFHA 1H9KA 5FTNA 1Z29A 1W36C 2MQHA 4RZ2A 3VDYA 1AGRA 4LPKA 2AKWB 2GESA 4YWKA 1ZJ6A 5TARA 5IRCD 2YKGA 3HOYH 3A36A 3IPYA 2C04A 1AKYA 1E1RA 1YR6A 1ZD1A 3GTGH 2EWVA 3B1YA 3FYHA 4GKKL 4AYWA 5L8VA 4BY1G 4P75A 1GRRA 1Y63A 2UU9Q 1XMVA 1WBBA 4F91B 5E7NA 2QMOA 1O87A 3MD0A 3RANA 4LFBQ 2X19A 4PPNA 1WCMG 1EX7A 3RS5A 3RABA 4DV5Q 1VQJA 2HT1A 2AD1A 2OE2A 1CS4C 1OKKD 2W6IA 5EQTA 3SJCA 3CUEF 2KI5A 2O0JA 4WAUA 4NKRA 4NMMA 3CAMA 3CMAA 1US8A 4U5XA 3L43A 1X8JA 4QL5A 2F4VL 1LNZA 1QBKC 3B1WA 3KKMA 3MSXA 5TVKA 3PVSA 2AFHE 3TUIC 3KJOA 2H57A 4H9GA 2A5FA 1G5RA 5BYJA 3A7AB 2XGTA 2KCTA 3A8IE 3EAQA 1XMOL 1US8B 1F60A 5IWAQ 3PIRA 4LF4Q 4WIAA 2ZM5A 1KTVA 1ZUHA 2R65A 1V43A 3HYTA 1VQMA 5ELOA 1IYVA 2FZLA 2ORVA 2P67A 3VR6A 4UPAA 1XWIA 2QU8A 3PQCA 4IOJA 4JYCA 2Q3MA 4QXAA 5SZHB 4ASUA 1N6OA 5JI3E 3LFUA 2JJ8A 3X1YA 3CC7A 4HB3A 4C0QC 4B33A 1P2TA 1Q90A 4D81A 3CD6A 2YC2C 2HCBA 3AEVA 2DY1A 3GTQH 2XXAA 4HB2A 1NG9A 4O2RA 2NVXH 3QBTA 3QXHA 5C4MA 2JEAI 4JLVA 5JFGA 1RRPA 3WNDA 3QY0A 4YMVA 1NVVR 4CIDA 1H8HA 1GKIA 3SJBA 5AR1A 3K80C 4IFDI 2DFLA 3U5ZB 1FJGL 2CMKA 2V7QA 3VR2A 3NBYC 3VTKA 2E9SA 4RZ3A 3CF5A 1X9NA 3LQQA 3HU1A 1XEXB 4IOAA 4US0R 4UXIA 5B58C 2Q21A 2ATWA 4M2LA 2AWNA 4GDFA 2JEOA 4CT5A 3GJ5A 4DCVA 1WOCA 2G0TA 2NOAA 3NKVA 2PNRC 1TF7A 3H84A 3WHKA 3RRZA 2PJRA 2IEYA 2JA7H 1XFAA 2CL7X 3C15C 4B3ML 4PZZA 5DI3B 4Z1MA 2A8VA 4E09A 3SDZA 4A3LG 1LY1A 3B7GA 4A3KG 3GJXC 2OG2A 1SVMA 1D2MA 1RJ9B 2ORIA 3UATA 3FPPA 3QOFA 1PYSB 4JI0Q 2VF8A 3WYAA 3WBJA 3S16H 2V4DA 5JSZA 1XTRA 2UXDL 4TZ6A 3G4SA 2VYFA 3BB1A 4A3DG 3BU2A 2V54A 3ULPA 1A63A 4DV7Q 1I50H 3ZS8A 3IBGA 1OXTA 3PR1A 5LB2A 3W34A 2RHQB 1Z0FA 3GLHA 4ON9A 2ANBA 2ZRNA 4KITB 1J8YF 4XVUA 2VH5R 2GN5A 3A4LA 3ZZUA 2GZHA 3DEFA 4TL7A 3SQWA 5EXXA 1SE8A 1X3GA 4XIGS 4DV5L 1H8HD 2FSIA 4IKEA 4B47A 4F93B 3F3YA 2JLYA 1QVAA 1E79D 2NZHA 2E74C 2JA6H 3HJNA 1U0JA 3K0AB 3L2OB 4TL6A 2IWHA 2A69C 1KMHB 2WSMA 4P4UA 2YTXA 1YE8A 5C4JH 4ZI3A 1XTKA 1EUJA 4IXNA 3PUXA 2VW9A 4AK9A 4PG3A 3ADKA 4DV3Q 1B0UA 1JR3D 2XITA 1D5CA 4LRWA 3CCQA 3K0EA 4EQ6A 4RMFA 4B3TL 3AGPA 1QG2A 4XH9B 2XZOA 4OBEA 3MCAA 5FPHA 1B23P 4YMSA 2JLUA 2QMHA 3TW8B 5FL7D 5LD2C 1TWCH 4RD4A 2QP4A 5EP4A 4QNMA 3PFIA 3NEYA 4IEIA 2QL6A 2FGJA 1CJVC 4LJYA 4DNRB 3F2BA 4HIMA 2EFGA 2VHUA 3QPVA 3M85A 3T06B 1NBMA 3FKQA 3K9HA 1HA3A 4C0HA 2YOFA 4PO9A 2GEUA 1T91A 2D0PA 2YOGA 4MQBA 3CNLA 1JJCB 3FKSA 1T0HB 3LO5A 1MO4A 4GBMA 4ZCMA 4B6FA 4BQSA 2IXEA 2NPIA 4WBSA 2J46A 4U02A 5IK2D 3C8UA 4OQMA 5KDOA 2QP9X 1E2PA 2QP3A 2BJVA 4Q47A 4WW0A 2IBMA 4LUOA 3PUYA 5CYPA 4URVR 1GAJA 3AVUA 3TJZA 3ND8A 3S1QH 3N2EA 3FVQA 4C0KA 2ZU0C 4KKTA 1EYGA 1S96A 3MLEA 3L8ZA 1KSGA 4M22A 1S9HA 1KK1A 2UUAQ 1NVWQ 2B21A 2ZYWX 3LXRA 3FFAA 2X8AA 1PA6A 1KSJA 1P8LA 4PO1A 2DWOA 1FZQA 1YVCA 4NXMQ 3P32A 1ANKA 4GMXA 2K5NA 4LPSA 4FMCF 3SHFA 2PX0A 4DB4A 5F9FA 3HOUG 2E8GA 1E79A 1TMKA 4P71A 4JI0L 4I1VA 4RFSB 4LOAA 2H16A 1CTMA 3IKJA 2ALYB 4DR4L 1T8UA 4PC1A 3PEVA 1YRBA 4OQXA 4B48A 3CRLC 1E2MA 4GP7A 3OIUA 3EBEA 1T3HA 4RCYA 5DNYB 4LJZC 2OLJA 4LK1C 1XBTA 1OH5A 5KSYA 2D2EA 1E69A 3ZVNA 2EFCB 4QGAA 5E7JA 1CJMA 3I4MH 1GRQA 2IA5A 4K81B 2W0SA 3GJ7A 2QAJA 4TQUS 4EPWA 4H44C 3A1TA 3I4LA 1YEZA 1W0JD 2LKCA 1ZW6A 4IVQA 5M04A 2VQFL 2EYUA 5CYOA 2BIFA 3CQZH 3QE0A 4TT3A 3TK1A 4PANA 2B8GA 1W2HA 2FFBA 3U3OA 3AKEA 1ZCBA 2JJ1A 1UJ2A 2O0HA 2AKYA 3I32A 4X8LA 3L0OA 4A3KH 5FOSA 1Q8KA 1S9DA 1H9SB 5JCZA 2PQAA 1Z08A 3QVVA 4HLUA 4OI4A 2AKAB 5EE1A 5DGXA 1UKEA 1DAGA 3ASYA 4RVCA 1CEEA 2H92A 1L1OC 2P65A 1UE1A 5CDFE 1W36B 2GJAA 1N5IA 1WBDA 3SYNA 4RD1A 1DCZA 4DV6Q 4OWXB 1SKQA 1Z0AA 4MA4A 3RVBA 4B32A 1HNZL 4DEXA 4EX5A 3RS0A 4BLQA 4CEJA 3ADDA 2A68C 3PUVA 2LXKA 2NVTH 4TMXA 1NJGA 4KYUA 1GUAA 3U9SA 3H2YA 3A8KE 1QHHB 1VQLA 1U0LA 2QTFA 1UPTA 1ZD9A 3NH9A 1DVRA 1FTSA 2OCPA 3RS2A 4C0BA 3AFPA 1YZGA 3OIYA 1XD2A 3VHXA 3NEJA 2HCJB 1Y3AA 1TNDA 2IYTA 3S1AB 2WMNB 4GN3B 1UF9A 2BDTA 2BKEA 3L7ZC 1KJZA 4JK1C 1R0ZA 1WE2A 2A5JA 5IYCG 1WDTA 4LUCA 4RFVA 5CLQA 3J7ZC 3CKLA 3D3QA 1V1QA 1GL6A 5FOWA 2EXDA 1ZCAA 4CRWB 5JZVA 4DR6Q 1I2MA 2Q2TA 4EQ6B 1NF3A 1ASYA 4JSTA 5JCPA 1W3SA 2GK7A 5FTJA 4KFUA 4OHVA 1NNEA 2NIPA 4MUAA 2Q2HA 1EWIA 1GOTA 1KMHA 1KK0A 1Z0JA 1GKYA 1NMYA 3VR5A 2Q0HA 1NBME 5JS8A 1GVPA 1CIPA 2H7VA 3QI2A 3UG7A 1VQOA 1GNQA 1XDBA 3CM0A 1OPXA 5FOUA 1E0AA 4B3CA 1FQJA 4OKSA 1ZRHA 1Z9FA 1FVIA 1IQPA 1NVVQ 4RY2A 1VQAA 1N36L 3P26A 5C0XJ 1XNQQ 1VQ6A 2FEMA 4Q1CA 3K7AH 1GL7A 4B74A 3D8BA 3HDTA 2D5DA 1BBUA 2O8EB 3HP1A 4UNRA 4Q4AA 3X1XA 1T8TA 3UKDA 5G40A 4IVPA 3EXAA 3IDQA 4IPDA 5BR8Q 1DAFA 3BOSA 4RKEA 4DIEA 2GXSA 1LS6A 2AK2A 2ZM6L 2X2FA 5AUQA 4A82A 1TWFH 4BXXG 4UP9A 4DK6C 4PZ8A 2GJSA 2HLDA 2L0XA 1F2UA 3I8SA 1PH6A 3T1VA 4BFWA 4E5UA 1XJVA 1FOEB 1XPOA 2IYVA 3OOCA 3NXSA 1KO5A 2BCJQ 5ANRB 3O8CA 2VL7A 4I1SA 2CKZB 1OJLA 4CT4B 4BLTA 4A36A 5HZKA 2YYZA 1CKNB 4JIMA 3TNFA 1ZINA 4V0MA 2WM9B 3A0JA 1ZNWA 5DHFA 4NXNL 5HGQA 5DO9A 4TVAB 2B8WA 2P6UA 1HE1C 4RZUA 3ZJYC 2IYXA 1YHQA 3S1RH 4DLRA 1VCIA 1W49A 4CEJB 1HEIA 1YZNA 3WP0A 2GWHA 3LBHA 4W5WA 4YXWA 4AQYQ 2UUBL 5K8LA 1X6VA 1B70B 3W3AA 2A1AA 3KLWA 1GL9B 3MXUA 1AKEA 2EW1A 2ZSAA 3KKPA 4IOKA 4O2LA 4TLDA 4XJXA 4F92B 2ZTDA 1E2LA 5JJIA 1AQUA 2K7VA 1X8LA 1J5EQ 2AK3A 3PG5A 4URZR 3WNBA 2GCPA 1UE6A 1ONLA 4H1VA 3ICEA 1KMQA 5DI9A 5GJCA 2WP8J 2IEZA 4BFYA 3EIEA 3U7FB 2QBYA 2QAGA 1DBSA 2AWOA 3U61B 4QJFA 3WRXC 2REBA 4LF6L 1E9EA 1Z28A 2NN6H 2EJMA 4KO8A 3CF2A 3R20A 4EFNA 2OCBA 2RGEA 4QIWE 1DAMA 3NHBA 3PENA 4NDZA 2BE5D 2WICA 4IQZA 3HOWG 1IJFA 3CMEA 1J90A 1VIYA 2XB4A 2V1CC 4ITRC 1JBKA 3LV8A 2C9CA 2XTIA 5J47A 1KJWA 3PEUA 3R9WA 4DK0A 2CCZA 3CCJA 2RGGA 4PSVA 2GHIA 3BZKA 1BYUA 121PA 1R0YA 1X54A 3AUYA 3GLFA 5DHAA 3DMDA 2WAQE 2DR3A 2E75C 4PV1C 4P3YA 2IHFA 2BEKA 1L4UA 1F48A 4N3NA 4DNTB 4JLPA 4TYNA 3QQ5A 4LWZA 5EJEA 3KUDA 5IP7G 2IX3A 3B5JA 2QEXA 1TUIA 3BG3A 1N5LA 2FOLA 4Q19A 1N36Q 1TQ6A 5SZJA 3ULJA 5AJXA 5IY0A 1E9FA 5BN5A 1GD7A 3HOXG 1KC8C 5CM8B 1E96A 5F3WB 1QHXA 3DKVA 3E9IA 1MOZA 2GETA 5UKDA 1BVSA 4C0LA 2IF2A 3AB3A 3S2DH 3FMPB 3G48A 4DV2Q 1HNXQ 1IJEA 3T1YL 3B60A 3AP1A 2YHSA 4DZZA 5HZHA 1OHHD 3ECCA 4XOIA 1F5NA 2QN6A 3SU8A 4ESVA 3CCEA 3NENA 2W58A 1BYIA 2RGCA 4LCBA 1NSTA 1G1MA 3C41J 2CJWB 2ODBA 4P32A 1G4UR 1LYLA 4IDNA 1VG1A 2C35B 3H15A 5HKKA 5JI2E 1XJ0A 1A5TA 2EVBA 1CBUA 1KDPA 2DYKA 3EWAA 1OHHA 3SFZA 1KRSA 4QC2A 2XZLA 2JA8G 3F5FA 4PHGA 1HT2E 3KF6B 1P9RA 4ABYA 3SBEA 4MGIR 2NN6I 3ZD6A 2QSZA 1L1OB 3K0AA 5JRJA 1AQYA 1WJJA 1IBMQ 2BMEA 1TEXA 1U9IA 2ZSDA 1JI0A 3FTQA 3Q7QA 1UBEA 4GI7A 5E95A 2KWIA 1B7YB 1BMFA 4KJZA 1E9DA 2RMKA 1BIFA 2ZSBA 3I5YA 3UDFA 1JXOA 3GLHE 5AJWA 3C5CA 3T61A 1R5OA 1XXHB 3I3SR 3E1SA 1KYIA 2N78A 1SVIA 1OXUA 1XEWX 4IRUB 2BA0A 1QUQA 1X56A 2P6NA 2VQEL 1Y1VG 1TF5A 3QG1A 1E98A 3A4MA 5BWMA 4LYJA 4WZAE 1J5EL 821PA 1CR1A 3LX5A 5DSZA 4DV1L 2J7KA 2ATXA 2VP6A 2IX0A 4OI2A 3FFBA 4GOPC 4JLOA 2A78A 1N25A 3HOVH 4MYHA 3KFVA 4TWZA 1XD8A 1AZSC 4GRAA 4KHPQ 4M9SA 2ZYTX 3LVQE 3FPAA 2DFTA 4LF7Q 2N1BA 3A1VA 3IQXA 3F2CA 4UNSA 5E7IA 4BLSA 1IYJB 3AKYA 4OJKA 4D6PA 1QHYA 3QKTA 4GNKA 3UPUA 3U58A 3L0IB 5BW8A 1XD9A 1KHTA 5KNDA 5D3MA 3IIKA 3B9QA 5D3QA 3OFNA 4JT2A 1EFRD 1ZNZA 4IW3B 1L8QA 1JAHA 1W4AA 4PSKA 3QBVA 3JC66 3PITA 4AH6A 4Q7KA 5CM9C 3ZIAD 4DVGA 1GKHA 3GFOA 4IDPA 2WAQG 5LMUQ 1COWA 4QHSA 4A2WA 5JSZB 1G291 4L15A 3VFDA 1C7YA 1Q3TA 1Y1VH 1M7GA 3DOEA 4LJ6A 1OFHA 2XXAB 4B3SL 2Q9CA 1U81A 1NI3A 1U8YA 4YDSA 1C1YA 4ZCIA 1G6HA 4PAQA 3W8NA 3WMEA 3X1WA 1B9NA 1QUQB 1OXVA 2O8BA 4KKUA 4IPGA 4Q4HB 1JQJC 1VPLA 4I81A 4JVMA 4N1AA 1E4VA 1WF3A 2KCCA 2ZJBA 2KBEA 5H68A 2OXCA 4ALPA 1IXZA 2F1RA 1OB5A 4BY7G 3RC8A 1PH7A 1U99A 2ZT9C 1X6OA 3A6PC 4TYYA 4C3IH 1FP6A 5M5YH 1AH9A 3FHWA 4TMZA 1Q3HA 2WJVA 1AGPA 1BS1A 2JA8H 4Q5IA 4JBYA 5IYDH 4QGUA 4LBWA 4NPHA 5AUOB 2A6HD 2HXSA 3STBD 3Q7PA 3U44B 5AWFC 2GK6A 4JVSB 4B71A 1P75A 5BXQC 3WDNA 4IDOA 3MWJA 4L8GA 3UANA 4EJSB 2QORA 2ZAMA 4AIIA 4E22A 2ATVA 1X86B 2J5XA 2ZAOA 5DI3A 4KMUC 2ZRLA 2BH2A 2WJIA 4TTRA 3HOZH 5EXSA 1Z47A 1JPNA 4LI0A 3UXMA 1RZ3A 3TR5A 2GJ8A 1BKBA 4L5RC 2WWFA 1G3RA 2YU9H 3MJHA 3KZ1E 4YDHB 5JWHA 4ZPXA 4EPVA 1M2OB 5IDVA 1S1CA 2V55B 1PH3A 1CUKA 1NVUQ 1SVWA 5H1YA 1XF9A 3DHWC 4FXPA 2HXYA 3K0FB 1RIPA 1E99A 2E2HH 1W36D 1Q1EA 3Q72A 4A2PA 3MUFA 4DCUA 3CRQA 2EJGC 4YY3L 2A9KA 2QTVB 4BRUA 1PUJA 1CSPA 1JJGA 1NL3A 4KBFA 4R7ZA 2UU9L 2IYZA 1MIUA 2WZQA 2J87A 3CX7A 2PMKA 5F2EA 4DR5L 4BASA 5B57C 4D4KA 1NY5A 5IE8A 3RLNA 3CX8A 4AKHA 4A6XA 2CJWA 3KYHC 3U50C 3EA0A 4JYBA 3D4RA 1G3UA 5FBVB 5J4HA 1II0A 4GOXA 1Z6YA 2R7ZG 1W46A 5CK4A 2QI9C 3RWMB 5L3SB 3TMKA 3ZZ0A 4NCIA 2KJQA 2OAQ1 3B82A 4KSBA 3EN2A 4A92A 1VCMA 5IHPA 1QZGA 2GXAA 2UZIR 3BC1A 1EQQA 1RIFA 1YR8A 1IW7C 2XZPA 1VQHA 4IFDH 4R4TA 2ZI3A 3BFXA 4Q4JA 2IYUA 5C46F 2HHHQ 2IHYA 4GLXA 5C3EG 4TMKA 3REFA 5J4LA 1HQYE 1ZM7A 5KNCA 5F98A 1JJ7A 3A74A 5LMUL 4HIDA 2A30A 2WWXA 4NCKA 3U3JA 2ERXA 3GJ8A 4M53A 4R2HA 2GTPA 3HR7A 3SQXA 5GADC 5C4GB 1OYYA 2MNAA 1Y8NB 3EZ9A 4LF9Q 2YINC 4B3SQ 2UXBQ 3QKRB 4M9QA 3HYRA 4M1MA 4A3GG 3CRW1 1N0WA 3BD9A 2WIBA 5FH9A 2WWWA 4A93G 4ILEA 3NG1A 4DR3Q 1H95A 3KX2A 4P31A 4C2UA 1PV4A 2E1RA 4GOPA 1AS0A 2WPDD 4Q4HA 4NU0A 3RYTC 3UMFA 4EUNA 2ZRPA 3FE2A 1HCZA 1Q1QA 3H86A 3HOWH 2I1QA 1MT0A 1W4BA 4BY7H 4ZO4A 5GVRA 3B6YA 2W6ID 2G6BA 2WJJA 3KQKA 3TAHA 5BQ5A 1OTCA 1E94E 4E03A 4A3IH 2ZJQA 1IN8A 1HR0W 3LDAA 1ZKOA 3JZAA 1MV5A 2ANCA 4OO1H 3EQLC 5M5XH 4B2IA 4HAVA 2O52A 1VQDA 1T3SA 2V6JA 3MWLA 2AUJD 2CE7A 4JLJA 4D4LA 4J15A 2BH8A 2CVHA 1R6BX 2JLXA 1EFUA 2AUKA 1E22A 4BEBA 3CONA 3AVVA 3MGCA 1Y1WG 1Q22A 2H5EA 2YNMA 4JL5A 2PJZA 1LTLA 3TQCA 1MR3F 3P4XA 1AIPA 3RC3A 1G5PA 4JBKA 3HOVG 3DOFA 4RD2A 2FEOA 4KLKA 1P62B 2FN4A 4WOPA 3PIOA 3F0TA 1ONBA 3SN6A 4YY3Q 3TW4A 3OYYA 2P0EA 3U44A 1N34Q 2WJGA 3KOJA 1K6MA 2PNHA 4XSHA 1HZAA 3TE6A 4AYTA 4G5GA 1UFQA 4QRHA 4H13C 1GIAA 4OI1A 4URUR 1C4OA 1NLFA 2ZSFA 1NP6A 2OO7A 3GEHA 3G5UA 1E7ZA 4YLGA 2DGYA 3GLFE 1FL9A 1P2VA 4PC3A 3G82C 4CEIB 3AP2A 1AE2A 4C3HH 2JLVA 3H3VH 1L2FA 2BMDA 4H1UA 3TLXA 1XEXA 4LYHA 1Z2AA 2OTLA 4UNNA 1W47A 3LRPA 5LPNA 2NVQH 3CR8A 5EP3A 1I5FA 3LVRE 1E9AA 2OFXA 3PO3H 2F6RA 2NO1A 4DB2A 4KFTA 4B3TQ 1RL2A 2BM0A 4LZZA 5IYCH 2HHHL 5KSOA 3PO2G 3A1WA 3AH8A 2IK8A 4EAQA 4A3GH 1EESA 1K5DA 2YTVA 1DG3A 2DWQA 2GKSA 2V4ZA 3ZIAA 4BLRA 3QJYA 3QPUA 2L5TA 2UUCL 2FPMA 1XPUA 3VU9B 1PMRA 4AG5A 1VYTA 4DSNA 3NIBA 4Q1BA 4B2PA 2K75A 2KCMA 1I94L 1IONA 2BDOA 1SMXA 2WPDA 2ZE7A 4GSYA 4B3DA 3OF5A 1IBKQ 2C2HA 5CDFA 3FOZA 5C3EH 4Q7MB 3RNLA 3KFXA 2D0OA 4DR3L 1KIXA 2QRNA 4A3EG 2ERYA 5GAHC 2C8VA 2WV9A 1VTKA 3CB4A 3DMNA 1M1YE 3M6AA 4WXPA 3RS4A 4C0SA 1GUGA 1I4DD 3QXJA 1EGAA 3T5GA 3D0FA 4LF4L 1G18A 1UKZA 2WB1E 2GNOA 4JI6L 2J3EA 5L3QA 1N6RA 4KBGA 4MUBA 4NONA 4CEHB 1A62A 1U0HC 1NJFA 2F52A 4X62Q 4DUZL 1AE3A 1HTPA 3DKPA 2VHJA 3OHMA 2MO0A 2WTUA 1M7BA 4UJ5A 4DKAC 3C4JA 5FOVA 2FZ4A 3TKLA 3I72A 1KK3A 1TF2A 4DV0L 3KQNA 3WWVA 1NIJA 4X6AH 5C4XH 3S2HH 4JL6A 4DK3C 4QJ3A 1MJCA 3T1QA 4B75A 3I2ZA 4KODA 3BK7A 2JCSA 2R2AA 3TQYA 4Y0AA 4NYMQ 3QKRA 5CJ2A 1EWQA 1Y14B 1YKSA 2A5YB 1A7JA 1AZTA 2P2LA 5EUMA 1U9IC 3DM9B 1SVOA 1OLOA 1TX4B 4DV4L 5CB8A 3N6RA 4R98A 4OXPA 3G71A 4EKDA 3FB4A 1ZD8A 1N32L 1IM2A 1Z5ZA 2JAQA 4DDVA 1PFSA 3OTOL 4NCJA 4TMTA 1W44A 3W5IA 3ZDQA 2RKOA 1NSFA 3K09C 1N5JA 1QZHA 3VX3A 2WWIA 4IEEA 2XTNA 3WMGA 2C9YA 2IT1A 2VS1A 4C9BA 5KSZA 4RZXA 2VNUD 1RVDA 1ZNXA 3TBKA 3T5DA 3PEWA 2GCNA 3NC1C 4DUGA 1XTDA 3ZYCA 3THXA 5KPJA 1QRAA 1MH1A 4A76A 1XTQA 4LV5B 5CJPA 2VQFQ 1KDTA 2GF9A 2AFIE 3N2IA 2ZE6A 1XMJA 2KB0A 4QQBX 4Z1MD 2WVJA 2C5LA 3FGNA 4DRZA 4X65L 5EP1A 2BBWA 4MGKR 3LNNA 4R1JA 1R2QA 3EX7C 1FW6A 3V4FA 5DE3A 2L15A 1ZIOA 1E0KA 1TWHH 3NDBB 2Z0SA 4QBIA 4R71A 1YR9A 2JDID 5FOXA 2PH1A 1S40A 4FINA 1NMFA 4YWLA 2ZRGA 2E2IH 4QG7A 4JJKA 3AP3A 3RDPA 3J80i 1GDDA 1K8AC 3A37A 4O25A 1P73A 3X1DA 5CITA 3EZ6A 4KHZA 1VS0A 1VCOA 4DR2Q 2RHMA 1QJOA 1IBKL 3ASZA 1IW7D 5KUTA 1W48A 3AVQA 5FFMA 5FTKA 2I5LX 2K5VA 2MO1A 1GNRA 4JLBA 4PZYA 3EPJA 4YCWA 1VQCA 2A68D 4ASUD 3P1JA 5A5GA 2Q9BA 2R62A 3LAWA 1E9CA 3CCSA 2XJ9A 4R4QA 3LA6A 3HU2A 1D2NA 1YJ5A 3M4OH 4IFEA 5TMPA 3KQHA 2FNAA 1WFQA 4AYBE 5FJ8H 4QBHA 2EVWX 5JHGB 3VA7A 1R0WA 2WJYA 5FBQB 4PC6A 5C44H 2GVDC 4DC9A 2OQ0A 2J9RA 3KTAA 5HCIA 4MDFA 1II8B 1N0VC 4JC0A 3QSYA 2B92A 4A15A 1TWGH 3FHOA 4XWOA 1K5GA 4DDTA 1X65A 1GUTA 4K0KL 1J99A 1E1QD 4DR7L 4X64L 4XVQA 4EPYA 2G88A 1DGSA 5EE3A 3RRMA 1Z2CA 2CNWD 1PLLA 3BJUA 4AYXA 1DARA 1E24A 2JASA 1VQ5A 4UP7A 3AB9A 3UG6A 3KTAB 1P4SA 3W1GA 3NBXX 3SI7A 4LJAA 1YR7A 1U5KA 421PA 1FX0B 4JBMA 2IYYA 4II7A 4B3FX 1LF5A 2KA7A 3K7UC 2FG5A 2IYWA 2FFHA 4HEJA 4ZV4A 1FNNA 4F4JA 1N32Q 2A3RA 2QMEA 4B3XA 3OTOQ 3EPLA 5FLXc 1JB7A 1KSHA 1YZ6A 5DN6A 2PCJA 1OXSC 2ZS7A 1GUNA 1OFIA 1KZGB 1GM5A 2UUAL 2J0VA 1XZQA 1B8AA 3KXKA 2H8KA 4HDQB 4KN7C 4KFRA 1Q20A 3CNNA 2NZOA 3PF5A 2ZR9A 1JR6A 1Z07A 2QA5A 1VQGA 1K9MC 2D2FA 5FLMH 2C98A 2O5IC 3I92A 2GEDA 1GG2A 4URYR 4MITA 5L3SA 2GXUA 1E3PA 2VP2A 1WMSA 4DR4Q 2P5TB 3THOA 4TYPA 4JOIC 2G83A 4TL8A 3AQQA 4YC7A 4YCVA 4FW9A 5JEEA 3KDFB 2D62A 3CCMA 4Q9IA 1JECA 5G3ZA 3ER0A 4C30A 4D25A 4ACAA 1YZLA 2JEBI 1PH4A 1KY2A 2CQOA 2ZE8A 3M3YH 1CR4A 2IF0A 2GJ9A 4KLZA 3DM5A 1M1KC 4JMPA 4D4JA 2WBLC 1QHNA 2Z5FA 1EFHA 2FX3A 4BA1I 3NC0C 3LBIA 3QENA 1G5TA 2AHOA 2RB4A 2Z4RA 2EWWA 5A0FA 3G0HA 3BAFA 1IBLQ 5GQOA 5EE5B 1I6VC 2PLFA 5FPKA 1CJUC 3FP9A 3T34A 2CK3A 1HZBA 1L0WA 4XD7A 1PH1A 3CBQA 2CBZA 3AVWA 4DKXA 1W2BA 1O78A 4M8NE 3OE7A 4HJ9A 4AQYL 3BB4A 1N6LA 1ZVQA 2Q8IB 1XMOQ 1VQ9A 1U90A 2WKQA 4L5BA 3Q8DA 2BM1A 3VR3A 2NVYH 3BH7A 1KO4A 1CP2A 3OPOA 2H5XA 4DSTA 1JPJA 3IUYA 3IGFA 1GZSA 3KJPA 1XMQQ 2XB2A 2JJQA 3T1HL 3AV0B 3H1TA 3IEUA 1UKVY 3LY5A 2GEVA 5IYBG 4GNXC 1UDXA 2GF0A 3GJ6A 3ICQB 5FOTA 521PA 3SJAA 2XSZA 1HR0Q 2C9OA 4JLAA 5HE8A 4X8MA 1F2UB 4K0KQ 4OONA 3OEHD 3QXXA 4CYMA 3TVTA 4X64Q 3I5XA 1EWHA 2CWAA 2PI2E 4YHHQ 1S3SA 4URXR 3GLGB 5KO2A 1K0RA 4BBRG 4DLVA 1Q1BA 5JEAJ 3LBNA 1P2UA 3B1XA 3WRYC 1CXZA 2R6CA 4OX9L 2HJGA 4DSUA 2HV8A 3QF4A 4A8JA 3CPHA 3VAAA 2D7DA 3U60B 3DL0A 2RGNC 2UXCL 2VL6A 2XEXA 3WXMA 4ZIRB 3IIMA 3LWUA 1GILA 4TYQA 1AS3A 4GZMA 4DSOA 3FKIG 5SZIA 2CCJA 1M34E 3UWKA 4ZI2A 1TL7C 1RC8A 1OIWA 1VIAA 4N0DA 1E2ZA 1W1WA 2WAYA 3AEZA 3U4ZA 4Q1FA 5FPTA 3IRBA 1DAKA 2Z6VA 1NJIC 1CJKC 2Z83A 2OAP1 1XEFA 4QHTA 2QMUA 1G3MA 3CLVA 4NP6A 2WSSD 4ZKEA 2W6JA 3K1JA 1M74A 2V9PA 3GEIA 4MKIA 4HDCA 1WQ1R 3N70A 4QNRA 8OHMA 3I7FA 1A2KC 3AF4A 2PEZA 5JMTA 1II8A 4LNQA 2K50A 4B73A 2JA5G 2J0QA 5GAGC 2AD5A 4ZDKA 4A93H 2W0MA 4AI6A 1G17A 4JI7Q 3STBC 4A0FA 4Z54A 2GZAA 2UXDQ 2CL0X 3PGZA 1N6IA 1QZXA 4P4SB 2CW0C 4JCVE 1YZQA 2IUUA 3U6BA 1TU4A 2K32A 5ELXA 5DH9A 1U8AA 3OEEA 3FMFA 2HYIC 3KKQA 3TREA 3E9HA 2ES2A 3B13B 1K8OA 1ZU5A 3DXJC 1HJPA 3J80c 4NCNA 4GS3A 5HE9A 4P4TA 4BZPA 1U98A 1COWD 2O8CA 4HATA 1MKHA 1E0SA 1E2EA 3PF4A 1D6JA 1D7QA 1E2KA 1SROA 3DZ8A 4Q7JB 3AF1A 3HOYG 4RCZA 4U00A 4KLNA 4OYHA 2X2EA 4B3RL 4IPHA 4QM6A 1OYWA 1TTTA 2ZS8A 1XTJA 4KKSA 5BR8L 2ASBA 1ZU4A 3L82B 4TLCA 2VHQA 1AA9A 3A1SA 4A3EH 4LFAQ 4LF8L 4DUGD 4Z51A 1OSNA 2A7QA 4US2R 4C3JH 1YBYA 2NPFA 3T1OA 4A1FA 1FX0A 3PIPA 5EZ6B 2VRWA 2I0QA 2RAPA 1NMZA 3I4OA 3CPFA 4Q02A 1FNMA 2ZI4A 4ZDWA 3TGPA 4RD3A 1DEKA 1Z83A 1YJWA 1M7HA 5JWRA 4GOPB 2Q2UA 4A3DH 1R5NA 2ORWA 4FN5A 5M5WH 4NYIR 1IHUA 4D0NA 4A0RA 3AVXA 1HR0L 1W2GA 1VQPA 5B64A 4DUYQ 3O8DA 4PFSA 4D26A 1JJVA 2NGRA 4QHYA 1GJXA 3KB2A 1EOVA 1XTSA 5KOYA 4A3FH 1Z22A 1EFCA 5HKKD 4JI8Q 3RSLA 2MMCA 4OX9Q 3RZOH 4P74A 1V5WA 3U7HB 2HYDA 4PC2A 1TWAH 2VIIA 3GTPH 4YXWD 3E5HA 3EZ7A 1WB9A 2IYLD 1A6XA 2XAUA 4OK6A 1NLYA 4IO9A 1XXHA 2CWPA 4V0KA 1E2WA 1ODFA 1XCPA 3THYA 2E2JH 4NB3A 1W0KD 2ZUCA 2FSHA 4LV6A 5JLJA 2ZJ8A 2QGNA 1ETUA 1ESMA 1VHTA 2IYRA 3J7A5 1TADA 2FA9A 1KXLA 4QKQA 1FL0A 1PH5A 2VPPA 5GJVC 4NXML 1M6NA 1OV4A 1KNXA 5HPYB 4M1OA 3BWDD 1LM0A 2FJUA 4GNXA 4GOJA 1R5BA 3CZPA 2WFWA 5H1SE 4LFCL 2YV5A 4L8JA 1Q44A 1J6QA 1AS2A 2JQOA 2QGQA 2F3TA 1QHIA 3K9LA 4LJ5A 1V8QA 3W9YA 1MABA 4OJQA 5FI1B 3SC3A 2B8FA 2ZUDA 2RF4A 3CW2C 3G6EA 2OCAA 3MG9A 4HIKA 1OF1A 1KI8A 1SXJB 2RGDA 2F1IA 1PLJA 4JJZA 4HB4A 3BFVA 2XNSA 1E9RA 1FUUA 2OCYC 3LW8A 3TRFA 1HQMC 3FMIA 3JVVA 4JI1Q 2A6HC 2VHCA 1VKJA 4EJSC 3DO6A 2JLSA 2OV2A 3I8XA 2BOVA 4JV5L 4JBWA 2IY5B 1QF9A 3RSOA 3NEMA 1MABB 2ZRMA 3KXLA 4RFSA 1HNXL 1R10A 2FPLA 4Q00A 4LC1A 1J7KA 2PEYA 1SVKA 3ZQ6A 3QKSA 4W5HA 5EZ5A 3BRWD 2ZRDA 4MRNA 3SBDA 4ME3A 4BE7B 2IXGA 3GJ3A 2ZTCA 1KDOA 3ULLA 1D9ZA 1I3QH 4LF8Q 4A4IA 4LFAL 1E9BA 1G9XA 5M3MG 1NIPA 3RS7A 2R6GA 2A6EC 2OBMA 4AKEA 1GO3E 1PLKA 1KI7A 4MDEA 3T51B 2EYQA 4FCTA 1BH2A 3B8HA 4BY1H 3K70B 5AK0A 3CPEA 1G51A 2F3IA 1QG4A 2G1KA 3X2SA 1KOFA 1LVGA 4DR5Q 1MO6A 4MKGA 2CFMA 2PT5A 1KO7A 2JLWA 4OO1G 1AN0A 3CCVA 5K36G 3SYKA 4CEHA 2I4IA 4DLUA 4GN4B 2OM2A 4HLCA 4IJMA 1JXMA 4A3CH 4M1KA 3U2QA 3S1AA 1J2JA 2IX1A 2YOHA 1F3OA 1SXJC 2CXXA 2O0KA 4MH0R 4Q9LA 4PR0A 3BXZA 1D9XA 1P60A 2ZEJA 4A3JH 4LJ9A 3TSWA 4EJSA 2JJ2A 3CC4A 1SZPA 4C2TA 4X66Q 3K0CC 4PTLA 1SXJE 1IY1A 4W5JA 4QBFA 2C99A 4P72A 1ZUIA 1ZBDA 2FSGA 1UE5A 5KSPA 1VQEA 1Z8FA 4FWIB 5J5CA 2GXQA 2ZXUA 1A2BA 1AJEA 3P4YA 3K0XA 2D74A 1O7LA 4Q1EA 1OKKA 2ZITA 4U7DA 2MSCB 2ODWA 1E6CA 3AF3A 1FYCA 1N33L 5FBRB 5TXGA 1XP8A 5F9HA 3UIEA 3QKSB 1E2GA 1F2TA 2DUDA 5C0XG 1TU2B 4DR1Q 4DWJA 1XCGB 1DTSA 2VSOA 2UXBL 4OHZA 3W5JA 1GTVA 1M8PA 3KJIA 4HJAA 3CF6R 1GP2A 1E4YA 3EA5A 3REGA 4A3BG 2GVZC 3AVPA 2TMKA 1SVSA 4IFDG 1XEWY 1OH7A 1AM4D 3LW7A 4PHFA 4HR7B 3VX4A 4LFCQ 3PUWA 1Y69U 4L5TA 1IN6A 4HJ5A 2AR7A 3CPJB 2KBNA 4OHYA 4FCWA 4AKIA 5IP7H 2XOKA 4EPTA 3MJRA 2FU5C 1QVFA 3GFTA 1EIYB 3I4NG 3QEOA 4R4IA 3D31A 2QEQA 3K81C 4OK3A 4YMUA 5AJZA 3UE1A 3F2DA 1TEVA 2R6DA 3GMTA 3GJ0A 3LWNA 1IN4A 2BMJA 4LGMA 1G4AE 4UQOA 4QOSA 3OZXA 2BKUA 1UE7A 1N8RC 4JV5Q 4HJ7A 4HAUA 4RG1A 5IF9A 5K8IA 1TQ2A 1KGDA 1EQRA 1GITA 2ZRCA 1T9HA 1VHLA 4LHVA 3RRNA 2V1UA 3HPQA 1E2JA 1ZM3A 4NYJR 1RYFA 3UDIA 1G6PA 4EPRA 4M9ZA 1KZ7B 4G7ZC 5IT9c 3E2IA 3B6EA 1KHIA 2NO0A 3CR7A 4HUTA 4R4CA 1HUQA 1CKMA 4S2EA 4W9MC 1X8KA 2EFHB 4Q9HA 3K53A 2E5LL 4EFLA 2AMCB 1OFTA 5D3MB 4O0MA 3WYGA 4URWR 5K36H 1G8YA 4PXAA 4A3LH 1PHJA 4D0LB 2RHSB 4LX0A 4NH0A 4LY6A 1OT3A 2IYSA 2MSEB 3K09A 1QVRA 4BECA 1JEDA 2J45A 4PZ7A 1KSFX 2BA1A 1PJRA 2W2XA 3WYFA 3HOZG 4LHXA 3GTKH 2K52A 2B3GA 3ZVMA 4JI3L 1DAHA 3KJGA 4NXNQ 4B3MQ 4BRWA 1IAQA 1VDZA 1P9NA 1B9MA 1P7CA 4N0EA 4PO8A 4V0ME 2KHIA 5M3MH 1JNYA 1VMAA 3R7WB 4A8JC 3R9XA 2QG6A 3V4RA 2O8DA 1WI5A 4NCHA 3U3KA 3IIJA 5TV2A 1RYHA 1RJ9A 1JALA 3WBKA 4O0AA 1EWRA 2KBFA 2QM7A 1MRSA 3LXXA 3MAAC 4JBJA 5M3FH 4V03A 1OXXK 3A7LA 4DAYB 4HUQB 1W5SA 5FPSA 1S2MA 1G41A 2GZDA 3ZJYA 4A0GA 2ZJ5A 2D2CC 4DLYA 1E1OA 2R93G 3EASA 2R92H 1UEBA 1GVNB 1E2IA 1Z3IX 2Q6TA 3IBYA 3UMSA 4B44A 3ADCA 2ZTEA 2WAXA 4BXXH 3CWZA 4KCGA 1K73C 4TTQA 3T56B 3IFTA 1G8PA 2MMGA 3IPXA 3U6KA 4BA2I 1CKOA 2EQBA 2PZFA 4JLNA 3K70D 4BFVA 2CEAA 2W2VA 4UJ3A 5TB5A 2V3CC 4G7OC 1H8EA 4WJ4A 3ONWA 1II9A 1K8GA 5DYIA 5K8TA 3VKGA 4B3GA 1VQFA 4ERNA 2ODEA 1YZUA 4A2QA 1T6NA 2VQSA 3GLIE 1BMFD 1EX6A 2DHRA 1KD1C 2EFEB 2PI2A 3CCUA 3OIWA 3QUSA 1KI3A 4Q66C 4AIMA 1DE0A 2WB1G 4C2MH 2FFAA 2WOOA 4LSGA 4OGQC 4KSCA 2JATA 4TLBA 4C3ZA 5KNBA 4V0LA 3I62A 3RRYA 6Q21A 3BORA 2YWGA 2BHRA 2VY3A 2BC9A 1VYVA 2ZRHA 4LF9L 3HR8A 1YHAA 1PUIA 1HE8B 2V1XA 3OIVA 3QG5A 3QXSA 4EIWA 4LHZA 3ETLA 4L9SA 3W6OA 1T5IA 3LH5A 1P6XA 1KIMA 3GLIB 2NMVA 2ZSEA 4MRPA 1G64A 1Y1WH 4WJ3M 3SEAA 1W0KA 4UY8C 4MYUA 5L3VA 5C2JB 4JI2L 4JYAQ 1OIVA 3BS4A 4M4SA 5FR1A 3PEYA 1HT1E 3RAPR 2REOA 3SJZA 3U7GA 3AFQA 4A3FG 4Q1DA 1NN5A 1UWVA 2PZEA 4DV4Q 2ZJ2A 1LB1B 1WYDA 1X1RA 3K0FA 5CIWA 5GVSA 4QM7A 1NE3A 1OH6A 1K8MA 1IXRA 1CTQA 1Z7TA 4Q4LA 2OILA 3J81k 3OFND 3TS2A 4HLQB 3VHLB 1H8ED 1JR3E 2C95A 2V8OA 1SR3A 2AN9A 2WKRA 4JI4L 2CDNA 3A4NA 3FKSD 1S4QA 1Z6GA 1GSIA 2OFWA 1KNQA 1HYQA 4KU4A 4MKFA 4MRRA 2XNDA 1VQ8A 1RKBA 5CB6A 1NG1A 4Y52H 3SZRA 2BJWA 5L3QB 3NVAA 1G7CA 4ZCLA 2GRJA 3KDFA 2BMFA 2QGZA 4HI0E 5CLLA 1KK2A 2WWGA 2ZJOA 3TRZA 4B3BA 2QBYB 4IOLA 5EXTA 1NKTA 1NY4A 1EG7A 3JZMA 4K46A 2ZS9A 1ZP6A 1YRAA 3RLOA 2XNDD 4YMWA 1SULA 2IL1A 1UBCA 4TQAA 3W8RA 2ZJRA 2DPXA 1DAEA 1FP7A 2ZROA 2R6AA 1RPZA 1R8SA 3A5ZB 1G6OA 2OSBA 3B9PA 3DLLA 4OI0A 4GKKQ 4DT1B 2ZVPX 3J81c 2NN6G 1NBMD 1FGUA 4AC9A 3QNUA 1DS6A 1ZYUA 3OESA 5A35A 2P5SA 5E7MA 1LS1A 2O8EA 2FE4A 4KFSA 3B85A 2J0UB 2O8BB 1MJEA 1D2EA 1JEEA 1X3EA 3IILA 4V0NA 3RN5A 2BBOA 1A82A 5IP9G 3Q85A 2F1JA 4XTRA 3SFVA 3Q3JB 2OESA 3CO5A 4O3MA 1VF7A 1KAGA 4HIOA 2F4VQ 3AGQA 4UKDA 5EP2A 3AQ4A 2YVUA 4QY7A 3H0GG 1S1MA 3LGJA 3RNUA 1PVOA 1CKNA 2NZJA 4RJLA 1XRJA 1U8ZA 3U3RA 5C0XH 2B7BA 2RGXA 1Y8OB 1ZNYA 2ZJYA 2KENA 1DADA 4HZUB 4JLMA 4QGHA 4F38A 1JB1A 2RGBA 1Q7YC 4I1OA 5EE0A 3TSZA 3NBZC 4BLOA 4GZLA 5KYKA 2AXPA 2FV8A 2ZJZA 1KI6A 2CCGA 1IXRC 1OIXA 3GCGA 2F3RA 4X8OA 2VSFA 2XOKD 4PZLA 2GILA 3Q9LA 2B63G 1XX6A 4DV6L 3SHWA 2ASEA 4MKHA 1HY3A 1XNRQ 2ZRIA 4DLXA 2QSYA 1CJTC 2XTMA 3EC1A 4P4SA 3ZS9A 4BBSH 3P20A 2EIFA 1DELA 3WMFA 1R0XA 2WWYA 2IS4A 3A8JE 3DVLA 4TLAA 1XJCA 1G19A 4GOKA 2IHEA 4JYAL 3FHCB 2BBSA 2EFDB 3KQLA 5LDDC 2RCNA 4I99A 4LF5L 3GLHB 5H70A 3ZVLA 1VQ7A 1KI1A 4J0QA 2QROA 5E3HA 2O8CB 1CLUA 4HSEA 1FJGQ 4R2IA 3S1NH 1QHHA 3SYLA 5J40A 4POGA 1G8GA 1SQ5A 2GDJA 4LBYA 2GAOA 2ZRAA 1VG0B 1H9RA 1TXYA 4L5QA 2VUMH 2A5DA 1XTIA 2IXFA 5JHHB 1G21E 4JLKA 3NTUA 4JI4Q 4DV0Q 4LWCA 2DNCA 1D8LA 2QPOA 1DD2A 2QPTA 4PZ6A 5LMNQ 3M1IA 4YMTA 4DR6L 3BBPA 2MFIA 4OQNA 4DIDA 1PH2A 4O2DA 2DCUA 4XWKA 2OZEA 3HKZG 2BV3A 1LABA 2VP5A 4A3CG 1VQIA 1JT8A 4M9XA 4LC0A 2IUSA 5KHOC 1KL9A 1KQSA 4KVGA 4B2LA 3U3MA 1XPRA 5K8UA 3PV0A 2IS1A 3CC2A 3CRRA 4DV7L 3S14H 1BBWA 1IYUA 1LV7A 2N42A 1NKSA 2H18A 1PYBA 3OAAD 4KYIB 2NO7A 3KB1A 4HAYA 4RSGA 1DO2A 2RGAA 1YNXA 5BYKA 1CSQA 1N2CE 5GAEC 1E0JA 2R92G 4QL3A 3ADBA 2YJTD 1YQTA 3BH0A 2XJ4A 1VG9B 1A4RA 3D7MA 4AD8A 1BO6A 1F2TB 2WOJA 4IPCA 3PCRB 2IS6A 2G3YA 1IN5A 2FSFA 4NPSA 1YHNA 4Q9JA 3ZZTA 1K3RA 2C96A 1LTQA 3CWQA 2D3WA 4MGYR 2FF7A 4PAMA 4Q18A 4Q4JB 1ZM9A 4AYBG 5FUWA 5JJKA 5JWOA 2IS2A 2ZM6Q 1YZTA 2GCOA 3FWYA 2EQSA 4DV3L 2IUTA 3VR1A 2JA9A 3L0PA 2R7FA 3KFUA 4DPGA 1DAIA 2GBLA 3QXCA 4F4IA 3HOXH 4IHQA 4E07A 2O5VA 2BEJA 5IYBH 2HJVA 1L1OA 1GHKA 4LFBL 1VCNA 3B2EA 2N46A 4H0LC 3MRSA 3QF4B 4HAXA 4A8JB 2JJ1D 2ID0A 2Z43A 1ELOA 4LDJA 3M7NA 1HNWL 1I4LD 2VTKA 2QAGB 5AJYA 5TDHA 3TR0A 4GNXB 4KI0A 2BWJA 4JVLA 5JRZA 3CH5A 1T4GA 4CGZA 1XNRL 2N3SA 1EK0A 3OEHA 4RD0A 5GJWC 3I61A 1YNJC 5JEAG 3K9NA 4PPFA 3SOPA 2ZYVX 3M4YA 3H4MA 2QQEA 3W1BA 4IOMA 4FMDF 5FL3A 2AHOB 2E87A 2XGJA 4JS0A 4OQLA 4GN5A 2PZGA 4QGGA 4LF5Q 1CKEA 4OK5A 4R9UC 2ZREA 3L8YA 1TUEA 2PPBC 3D6TB 2Q2IA 3EIHA 2UXCQ 2YWHA 4BGDA 2CHVA 1WP9A 4JG2A 4IJHA 1O7IA 4ARZB 4KV9A 3IO3A 4BFXA 2CK3D 4XD7D 4DK1A 3K8YA 4IJLA 4DR7Q 2VBCA 3OAAA 3W6NA 3GDEA 1PZNA 1E1QA 5LMNL 1G3QA 1HTWA 1TAGA 1XCMA 2HEIA 2ZPTX 4M0LA 4MRSA 2OHFA 3TQFA 2Y0SE 4FWTA 3SGIA 3TUJC 4H02A 4JI5L 1RRFA 3BDOA 3GTLH 221PA 4A0HA 1UBGA 4B76A 4DCNA 3T12A 2O8FA 1XXHE 1CULC 4POAA 1S3OA 3THWA 1R8QA 4Q9KA 2OWOA 3EG5A 2CLCX 4M1YA 4PPQA 4HUQA 4TSFD 4V02A 1TPZA 3THYB 4G5RA 2K5HA 4C7OA 3C14C 1SFOH 2JDIA 4FCVA 3X1ZA 4JKYA 1UEJA 1KRTA 4RD6A 3UK6A 4NHOA 5P21A 3CP0A 1BKDR 1SVLA 4BFZA 4GL2A 1LFDB 1N34L 2NO6A 3AF2A 1VQNA 3EIVA 5FPYA 1EIFA 4YWMA 3PCOB 2HF8A 4IXMA 2GVAA 1VF5C 3ZH9B 4AG6A 3MFYA 1UM8A 3QF7A 3I4MG 1Z6HA 1ESNA 5AJVB 5DN6D 3I73A 1NN1A 2NZ8A 1TQDA 1XU4A 3CRVA 5TY0A 4OWWB 3IO5A 2PT7A 3KUCA 2VF7A 4FDBA 2JA5H 4V0OA 2DNEA 2J41A 3H94A 1VYUA 2P3SA 3EPHA 1FR3A 4OHWA 1KJYA 2PMDA 1CR0A 3JVUA 3L2PA 4JT4A 2Z4SA 3FMOB 4TL9A 3T15A 3GP8A 2K5UA 4UXHA 2ZR0A 1IY2A 1W0JA 2N49A 3AVOA 2YTYA 2D4HA 2J1LA 2JLQA 2JIZA 1K83H 2VSXA 4P33A 2PCFB 4G1UC 3SS8A 3TAUA 4D4MA 4D82A 3LNCA 1GRNA 5L3RA 3FKIH 5CK5A 2JLZA 4P0TA 4LYFA 2EDGA 5C0XI 2DFKB 1O3YA 2UZ3A 4G01B 1G7TA 3W90A 4XSGA 1G8FA 4WA7A 5CIQA 3AVYA 2UUCQ 2LWIA 1GWNA 3IEVA 5DISB 2HIXA 4KXFB 2WJHA 2E76C 3LD9A 1HNWQ 3EW9A 5KDDA 1S72A 1CRQA 1KKLA 2IWRA 1QVGA 5G41A 1IBLL 2OBLA 3EPKA 2KSQA 4TMWA 2A19A 4BBRH 2X1VA 2OEPA 4PAOA 621PA 3RS3A 4TLEA 4AY2A 1SN8A 1R4AA 3GLGE 4JL8A 3PSIA 4US1R 3Q8XB 4GLVB 1Z0DA 2IHBA 3A1UA 1Z0IA 1S3GA 4PQYA 3V9PA 1YITA 4DBLC 1IL2A 4WXRA 1P9WA 1FPMA 3GJ4A 1AK2A 3BIFA 2HLDD 1LUZA 1XMQL 3WY9A 3NBHB 4PQRA 2B8TA 3CXCA 3T1HQ 4X62L 4DUZQ 3QIAA 2J0UA 1DPFA 4NZYA 3VKWA 1N6NA 3C7KA 4PMWA 1XJQA 4DDUA 4Y7NH 3J81j 2ZE5A 1VG8A 3NWJA 2WKPA 2WWHA 2CHGA 3EWSA 3AF0A 1HV8A 3NH6A 2Z0MA 3RWOA 4PHHA 3GTJH 4YHHL 3UMRA 1ZC3A 2GAAA 4OQFA 3VQTA 3WNCA 4GZYC 2B7CA 3AYHB 4JI5Q 5EAYA 3ND9A 2DWPA 3TH5A 2ZJAA 5KDLA 3PUZA 3SNHA 1A0IA 5IP9H 2G77B 4NE2A 1JAIA 1MO3A 3NDPA 4HYYA 2IYQA 1GUSA 3ZVRA 1KAOA 2UVQA 4MRVA 2ONJA 3ZGXA 5AUPB 1L2TA 1HH4A 4L16A 1NRJB 4LUZA 5H8WA 4ZIRA 1GUOA 2ZR7A 2LKDA 4WVFA 4XWAA 4B6EA 5LB4A 1X55A 5FL7A 3EC2A 5FUXA 1SRUA 4R4OA 2JE6I 2JA6G 4GKJL 1M90C 2OTJA 1D8TA 1NLZA 1EFTA 3MWKA 5FUVA 4KAXA 4BWYA 1E1RD 2F9LA 3S24A 4LV8B 4RCNA 5LD2B 2CLDX 2K14A 1OE0A 2ZI6A 4X8HA 3TIFA 2LCFA 1ZIPA 1SKYB 2N8NA 4OL0A 3THXB 5ELNA 1NTGA 5J3BA 1IN7A 2DB3A 5LMNW 4KVAA 2CE2X 1JR3A 3PO3G 2HUPA 1YI2A 2QE7A 3UWOA 1KO1A 4TSFA 5KTYA 3GLFB 2LSSA 1WRBA 1DO0A 3JAMi 4JZKA 4M1TA 5DYGA 4FMDB 5SZKB 3RN2A 4X65Q 4QJ5A 5C4XG 1L4YA 3BERA 4NYMR 2HQLA 4HLDA 5JEAH 1Z06A 1G8HA 4C4PA 3DZDA 2CNWA 4M21A 3LLUA 1SKYE 4BPBA 1YNNC 4TZ0A 4DXAA 2R44A 2OT3B 4HAZA 1S0UA 5JECA 2Y8EA 1G7RA 3OEED 5AUNB 4C7OB 2RH5A 1CF4A 2JA7G 2FGKA 3CNOA 3QKUA 3UDXA 4B35A 4UNQA 1QVCA 1RRGA 2QF7A 2UKDA 2ZI5A 4IVRA 4DCTA 4AKGA 1P3JA 4B3RQ 2JLRA 3C5HA 3P27A 4DR2L 3Q5DA 1Q46A 1YIJA 1SXJA 1S8FA 4TTPA 4DLZA 2CHQA 1Q57A 2DBYA 3AM1A 1TKWB 4DAMA 3CPWA 1N5KA 3MWYW 3O8BA 5C1BA 3DDCA 5JS7A 3BE4A 2QENA 2PX3A 2ZU6A 1G16A 3GLIA 2F43A 3NE5B 3F1ZA 5FJ8G 1T0JB 2VP4A 4D2IA 1KI4A 2X77A 4BLPA 1YJ9A 1EXMA 1UKYA 4L4UA 4FMCB 2G1JA 1NBWA 2WHXA 3W5OA 3R7WA 3M4QA 2CLSA 2D7CA 2QM8A 2JA1A 4APVA 3PO2H 1YVDA 1UBFA 3AKDA 1HNZQ 1MO5A 4DCSA 4DUYL 1N33Q 4LF6Q 2PMZE 1G20E 2Y0SG 4PX9A 5DLQC 3R8CA 1N0UA 1RE0A 3M0EA 3ERSX 1Q0UA 2I5HA 5J4VA 4P73A 3VKHA 1EFWA 4BEJA 3HPRA 3KDSE 1IY0A 1V9PA 1L7VC 3VU9A 3BFKA 3GEEA 2R7DA 1C9KA 1P5ZB 3HU3A 3N5CA 1IOZA 4YONB 3KL4A 5DLQE 1Q21A 1UDWA 2REXB 2JGNA 3WHLA 1CRPA 1OB2A 1ZAKA 2FFQA 1VQ4A 2A69D 3F8TA 4EQ5A 2A2ZA 2NQ2C 4DLSA 4Q4AB 5C18A 3VNVA 3HKZE 4UP8A 2VUMG 2OFOA 1MKYA 5C44G 1XNJA 1Q1ZA 1SXJD 2VA8A 4DJTA 2C78A 4GKJQ 5HY6A 1E2QA 2HT6A 3LX8A 4GMDA 4Q1AA 3UE0A 4BFSA 1CU1A 4LUVA 2PCLA 2ZI9A 3OE7D 2FDCA 2F9MA 4LYAA 4QGFA 4C0AC 2F1MA 1RW4A 4MNOA 5FR2A 1Y8PB 3CCLA 1H9JA 1WA5A 1YU9A 4G0NA 1JMCA 1MRNA 4DT1A 2WMOB 1E2NA 1VECA 2ZQ5A 2PBRA 2QZ4A 4JLDA 1UADA 2ODNA 3HOUH 2OLKA 3A5UA 2XX3A 1XD2B 2G9NA 4AURA 1OW3B 4EFMA 3U4QA 3W6PA 1N6PA 1H9MA 3TVDA 3PXGA 4POFA 4UNPA 2QNRA 3SR0A 1R7RA 4IDHA 4OWTB 2FPKA 1ZMXA 2ZTSA 1G3IA 1X3SA 2VEDA 4CW7A 5IK2A 1NN3A 2IW3A 3VNUA 3EZ2A 2ZJPA 2YWEA 2R93H 4Q48A 4Z8YA 2JIZD 5J4KA 4M1WA 4GFDA 2VZAA 2DFNA 1XNQL 2QT1A 4DNIA 1UAAA 1QHGA 4A3IG 1ZC4A 1E1TA 1N9WA 2QE7D 3CF0A 4BZQA 4HZUA 2O5JC 4JI3Q 3JAMc 4LJ7A 4M1SA 3RHFA 2K33A 3H3VI 4C0JA 2PL3A 3THWB 4I7ZC 5EE9A 1E3MA 4PC7A 5IT5A 4QJ4A 3GTOH 5FBWB 4GT1A 1KAWA 1I4TD 4LBVA 4DDWA 2O8DB 2CCKA 1CR2A 5E4FA 1FMLA 3FHTA 3BGWA 1Z6TA 2ZVQX 1DXMA 1XMIA 3QEJA 4B34A 2QT0A 3S1MH 5GROA 5G53C 1N6KA 2QY9A 3GD7A 1GHJA 3K9GA 5HR5A 1W5TA 2BE5C 2QUZA 3U7EB 1Q81C 3TS0A 3QVUA 4GLAC 4F4CA 4DV1Q 5EUQB 4WZBE 2PQAB 1BOFA 1J8MF 1PH9A 2QQ0A 5J4YA 1P16A 3CCRA 2FH5B 4PPGA 1H9SA 3IHLA 1JJ2A 2HIVA 3MMPA 5IYDG 4KHPL 1XZPA 1N3BA 1R9TH 1ZUNB 4Q03A 3W3ZB 3OW7A 4LF7L 2BVNA 4OO1I 2P6RA 1SLJA 5HTKA 2UUBQ 3GTMH 3BJIC 3DM3A 5JJLA 1ZM4A 1U94A 3KF8B 3FDIA 2WSSA 3CX6A 1P72A 2ZUBA 721PA 3K70C 4X66L 2VP0A 4Q7LA 2BBTA 4JKIA 2ZRFA 2GVBA 3A8TA 4Q01A 2OCEA 3AKCA 2OUKA 1FUKA 2PLRA 2Q3HA 2K4KA 4L9WA 2V6IA 5BN3A 5FLMG 4TQ9A 1H65A 1KDRA 1WCV1 3KJHA 4LHYA 2AL7A 3ZQJA 4QFMA 1K8RA 3B1ZA 4ARZA 1YHBA 2BCGY 2J0SA 3I4NH 3K8AA 4MTNA 2HF9A 1NMXA 3CZQA 2OQKA 1Z6XA 4MZ9A 2JXMB 4LBZA 4DR1L 1A1VA 1I94Q 1E9SA 4L5SA 2I3BA 4LHWA 4ACBA 5KU1A 1SMYC 3RZDH 1TU3A 4D0GA 2B6HA 2VO1A 1OH8A 2R6FA 2W6JD 2ZANA 4UXJA 3ZD7A 1SGWA 1U2RA 2WIAA 5FTMA 3HWSA 4FI3C 2R9VA 5B2ZA 2H17A 3IQWA 1JE5A 1KY3A 4G3XA 3BB3A 4G5OA 4IDQA 5BN4A 4NYIQ 3V00A 4XVRA 3KF6A 4Q21A 4JI7L 4RKFA 1Q82C 2J7PA 1UEIA 4OHXA 4JI6Q 2Q3FA 1KO8A 2I1VB 4DLWA 5FTLA 1QHSA 1OFUX 1SHZA 1FTNA 4A9AA 1F6BA 1HPCA 3LQRA 2H1LA 1X3FA 2J59A 3T1TA 5B30A 1LACA 1J70A 1P61B 3RR5A 2GCOB 2LXJA 2DN8A 1X1SA 4NYJQ 4CDGA 3O8RA 3OW2A 4JVNA 3NELA 4NL4H 2W83A 2MSDB 4GPTA 4F7WA 4K8OA 2EJFC 5HCNA 1PH8A 2YZ2A 4MGZR 1CFMA 4DV2L 1Z0KA 5FI0B 3T1YQ 1I6HH 4IOCA 3I56A 2ZETA 5FUYA 3EZFA 2V7QD 5AJ3Q 4IFBA 1VQBA 3MXNB 2E5LQ 1GKUB 5LBIA 3CH4B 1FQKA 3UDGA 4BBSG 1TQ4A 5JBQA 1NY6A 4I1UA 2OBNA 3KLRA 5G3YA 3I55A 3NBFA 1HURA 4I4LA 3KJEA 2B63H 1W4CA 2VHTA 2QA4A 3A58B 4BZXA 1NVXQ 4TMVA 1RFLA 4CVNA 3RLFA 3I1FA 3B78A 4FD2A 5FBLB 2AX4A 2A6ED 3AUXA 3L0SA 1NMGA 1KI6B 4BUJA 3TUZC 1IBML 4Z8XA 2I5MX 3O47A 1WXQA 4B43A 4TKOB 2NO9A 4PQFA
chains in the Genus database with same CATH superfamily
1IH8A 3DV0B 2C77A 4FQ8A 2YIJA 3R9IA 1L5NA 4BEVA 4BWVA 4D0SA 5M3FG 3LNTA 3OPXA 4DCCA 3KWLA 1PYOA 4GR5A 4LDNA 1NKVA 4PHTA 3G1TA 2GPJA 3IAFA 3RVNA 4CMGA 3PDWA 2WJZB 2VQEQ 3DKRA 3AVTA 1Q12A 2AZ4A 3RU3A 4EELA 2QB5A 1KDAA 2F1HA 2W2TA 5JDCA 1WW3A 4HQLA 1BOOA 3IVXA 3KXIA 3ID6C 3SQMA 2RSOA 4ZGBA 3MJEA 1IZ0A 2H9IA 3DEYX 1WCMH 1ZSVA 3NWBA 5EXDA 4WK2B 5GJBA 5CLJA 2EBUA 1OU0A 2SHKA 5TS2A 3T7KA 4HGQA 3TLZA 4HFNA 4AUMA 1LT5D 3KBGA 1XZEA 2G82A 3B1FA 3MWEB 4FHEA 1RSZA 5GADl 4QOIA 3K0SA 1ZYRC 3IHWA 2FXQA 2P35A 3ZLJA 2J4XA 1C0AA 1Z4PX 5H83A 1ML0D 1GFSA 2GBLC 3M4PA 1TAHA 2KE5A 2XQVA 2PZUA 3BREA 3AR6A 4LJ8A 4GWLA 2DY7A 4EI8A 3Q5EA 4OTZA 4F9GA 2ORYA 4MDYA 1IKMA 2RD2A 1V96A 2R7ZH 3OCVA 5EG5A 3WLSA 2GFHA 3E70C 4N9QA 1XIVA 4OBBA 5ALRA 2L17A 3R8FA 5EPLA 3V46A 1FMJA 3AQIA 3U62A 5AJTA 4FKBA 3HUEA 2YC4C 1PP4A 3INYA 3PFWO 4KXNA 5F78A 3UJDA 1W4RA 2OXRA 2XCQA 4ZT6A 4A4DA 3JS5A 3NGXA 4QYSA 2ZBQA 4A0QA 3EZGA 1A8VA 1OI7A 3T7DA 4DEYA 3KEGA 2BGWA 3I1YA 2DLCX 2QQFA 2VQ6A 1E32A 1QAMA 1KPHA 2C8JA 3EIQA 3W04A 1OASA 1Z4JA 1N7IA 2EL9A 2FJPA 2R7AA 3JQCA 3S2YA 4E11A 4G89A 3Q24A 4CEIA 5IAEA 4JI1L 3G8DA 5CGQB 1MQ9A 2JJ2D 1JILA 1P1IA 4ZVMA 1HA6A 2AC7A 4HO1X 4HZGA 3GPLA 2ZIGA 3OF2A 4IZHA 8GPBA 3BXHA 4MHTA 2PMZB 5ETJA 4XQGA 3DPIA 4CR6A 4CZ2A 1QDEA 1W7AA 2ZYDA 4O4JB 2AW3A 3HY6A 2R1VA 3NNSA 4DANA 2GPWA 4WD3A 2G0NA 2VHWA 5HF5A 3SE0A 2BUCA 2I55A 4WQMA 2F43B 1C9OA 3NHAA 1KI2A 2P90A 4G1CA 1PWZA 2G1UA 2ACWA 2YWFA 3JR3A 3ZE8A 2KJXA 3K5WA 3TOSA 4N6NA 3MEFA 1E2HA 4AO7A 4TN1A 3NTQA 4DHEA 3VMFA 3DLHA 4F3KA 3NHHA 5A2QA 4FZRA 1A5AB 3T53B 2A5GA 1L0BA 4Y0VA 4G5SA 3KKNA 4K6MA 3BGVA 4NBKA 1CT1D 1EQUA 4NG4A 3AYXB 2QK4A 5IARA 1L4MA 3HKSA 2BGIA 1JUDA 2ZWOA 4EDHA 4ERXA 5DVZA 2EPBA 1NN0A 1OROA 4A3JG 4O59O 4UU1A 5MGBA 3FIUA 4NDNE 5EEGA 2IHZA 3NI2A 3L3BA 3VC2A 3MFGA 1UT6A 1UXGA 2GBIA 2CUZA 1IBRA 4NTZA 1M2NA 4LW1A 1FFHA 4ITVA 4M54A 3RVJA 3UV3A 4DA7A 1KWKA 2MQHA 1IHDA 2H4WA 1AGRA 1Z7YA 1GSAA 1Y5NA 3USES 3WIVA 3RUFA 3K0HA 3EEQA 1HX7A 3H3JA 2L19A 3V8VA 4WBXC 2C04A 1AKYA 2EWVA 5HIJA 5IVDA 3H4VA 3FYHA 3HLYA 4HAOA 3NYIA 5J23A 1Y63A 2FW8A 4BNHA 1J21A 2IY9A 3AONB 3VHXB 3L4JA 4BQPA 4F91B 5E7NA 2QMOA 1S01A 1Z4IA 3R5FA 2XT9A 5GONA 3N2KB 3ND5A 1EX7A 2R8PA 1QQ7A 4JLSA 3RS5A 3NCTA 3LUHA 1YXMA 2J33A 2HT1A 5EPOA 1LDYA 2AD1A 2DQSA 3L46A 5REQB 1JHZA 1BXGA 1TM2A 3I2HA 2WT4A 3P2YA 2O0JA 4O5AA 3P9NA 4WAUA 1US8A 2PWBA 2DJGC 3Q12A 4U5XA 1P2FA 1FSFA 4ENRA 4QL5A 5EJIA 2F4VL 2MWMA 2IV2X 2OYRA 2AFHE 5TT0A 3I6BA 5F3RA 4PLVA 1S8NA 4IDCA 4LXXA 3IQFA 4N48A 2KCTA 3A8IE 3D4NA 3HKCA 4I5FA 4UW9A 3PIRA 1WR8A 1QO0D 4RA9A 3VOAA 1FD7D 1X2BA 2DG2A 4MO2A 1V43A 1QS0B 4BKMA 2ORVA 2P67A 5SZHB 4UPAA 4DMHA 5I9OA 2INGX 2Z9BA 3F7MA 4J43A 1N6OA 4MPRA 3OKPA 3TQTA 1ZK2A 2H00A 1U0FA 1RPJA 1E3JA 2WW8A 1W5AA 1F2VA 3C6BA 3M89A 4HB3A 4DM4A 5T8KC 3HBMA 2XUPA 4EGVA 3CD6A 1Z6ZA 2YC2C 3PCTA 2RAFA 3AEVA 3JYNA 4YCDA 1D07A 1N4AA 3ORHA 4EEZA 2XXAA 5JVH3 2YBDA 4D9NA 3UJBA 4I9GA 3A9WA 5EXEA 1Z15A 5G0VA 5JFGA 1ULZA 1PZJD 3GR6A 3G8CA 2EZ4A 3HP4A 3IB3A 4O4JA 1NVVR 1ONNA 1LD3A 1GKIA 3UGTA 4CIDA 1NCVA 5AR1A 1MA3A 1VJ0A 4C4RA 3K80C 4IFDI 4V0RA 2UXDB 5H3LA 1RYZA 3VH4A 2V7QA 4KKVA 4RNDB 4ZVVA 4BKPA 4EQZA 5HYVA 4EQPA 4HVTA 5B58C 3HU1A 1XEXB 3L6OO 5EFOA 2Q21A 3WK5A 1Q14A 1H3EA 4N18A 2AWNA 5JPCA 1A9XB 1ECCA 2A9PA 2F62A 4UOQA 2G0TA 4I1YA 4CT5A 2VQ3A 5DX0A 3H09A 1EPUA 3H84A 3EH1A 3WHKA 3LYHA 2JA7H 4MIYA 4Y1GA 1XFAA 2CL7X 1FS5A 3L02A 5FWDA 3WV5A 4BWFB 5DPMA 5GZ3A 3Q1LA 1PF7E 4EBBA 1GSOA 3RFCA 1CZLA 3GJXC 3Q88A 2D5IA 2JKZA 2YZGA 3K73O 4H6WA 1SVMA 3I2KA 2Q3BA 2P2DA 4GMHA 3ANNA 4KMOA 4QOEA 1C81A 4EMBA 3WYAA 3LY9A 2V4DA 2LUOA 2W5UA 3MGBA 2HBZA 3OOEA 4MUXA 2R3SA 4QPDA 2UXDL 4TZ6A 3G4SA 3MCWA 1UIMA 4KSYA 1Y5LA 1XEAA 2RI1A 4GF5A 1A63A 5JH7B 5KNCD 4AJOA 1USGA 3MCUA 2XE6A 3PR1A 3FEWX 3W34A 1VA4A 4YMGA 2ANBA 1I14A 4KITB 1UODA 3L0BA 4WX2B 1DEAA 1N7HA 2GN5A 1TYCA 2VH5R 3D5TA 2C4NA 4NICA 3FOEC 3CNQS 1JQEA 4W5QA 4KDCA 2WU3A 5CMLA 5EXXA 1X3GA 2JLYA 3CRNA 4IKEA 2K01A 4X54A 5TPWA 5E3FA 1QVAA 3UT6A 4AL4A 4F46A 2E74C 3K0AB 5G4LA 1U0JA 3L2OB 3ZLTA 4E88A 3I9NA 3ILXA 1WSDA 4ZI3A 2QN1A 2PXCA 5AVXA 1EG2A 1LGYA 3V34A 1QDLB 1AGNA 4KB5A 4TMXA 2VW9A 3FBWA 4DY6A 1UJ5A 4PG3A 2B7LA 1JR3D 4WNIA 2XITA 1Y8CA 1NXQA 3K0EA 4MLCA 5KIAA 1Q7EA 3P71T 2FPUA 2CT8A 1DOMA 1JIVA 1MZVA 2JLUA 5LD2C 3AHJA 3TW8B 1DRJA 3BMNA 1QKKA 2QP4A 1F4VA 3GGGA 4YUYA 2XTJA 3E3MA 2H4XA 4QNMA 4F4HA 4P53A 2F4VB 4JCOA 2ZCVA 4DNRB 3QU4A 4NJEB 5M29A 2LGJA 5A4KA 1ZI8A 3E22B 3M7IA 4N76A 1LLUA 4KQWA 4QUFA 2P8SA 5GY7A 3IPRA 4C0HA 1TK2A 2WTBA 1XWFA 3CEMA 3TF5A 2D0PA 4MQBA 3GFGA 3TXAA 3EVNA 1SCNE 1JJCB 1T2CA 1C3LA 2A6PA 3GLUA 5HIMA 4NE7A 3RF6A 4E1BA 4Y6LA 3UFXA 3N7TA 4RPLA 2IXEA 3I6IA 4FNAA 5EESA 2NPIA 5C34B 5CH8A 1U2DA 2ZVJA 2JH3A 3L6BA 3ORSA 2WUWE 1PG0A 3OCCA 4HYTA 2F8SA 2LDBA 2WDPA 2EC5A 1X7GA 4DR4B 1BEEA 1DEOA 3MYRA 4WCVA 4WW0A 1A8QA 5FLXA 4EHNA 2HW8A 3TQSA 3FZGA 4LUOA 3SLGA 1FXUA 1GAJA 3BXPA 1NNEA 1QUFA 1TT5A 1G2TA 3ND8A 1F8YA 5JISA 3AVUA 2F0JA 1R8XA 4LMRA 1PHPA 3HS0C 1AZQA 3TN7A 3MRTA 1IWOA 2XW6A 4YQEA 3T7IA 2CFTA 2UUAQ 1W1UA 2ACVA 3FNFA 4GH5A 4ZV9A 2ZYWX 3D7LA 4WDRA 3LT0A 4OUDB 1NUSA 2P41A 2X8AA 4PO1A 2DWOA 1MB0A 5F9FA 4PZCA 5IC4A 4MVWA 2FRDC 3DCJA 3TP5A 3HFGA 1YK1A 4NBNA 2H7YA 4BQNA 3ENNA 2E8GA 1E79A 4G07A 4JI0L 1ODSA 2OVFA 4NR0A 5CA1F 2CYCA 1B43A 3ZIUA 1UK9A 4DV5B 1T8UA 1UZUA 4DR4L 1P4GA 3BDIA 4KQHA 4G4JA 4J1MA 2GD6A 1JJBA 2WU4A 4KJOA 1DOKA 5IEBA 2O54A 5AXAA 2JFHA 1E69A 1KL7A 4XLZA 2PS9A 3OQBA 5KYUB 3TZDA 2P1ZA 4ZYSA 1AXGA 2BRUA 1YVPA 1JHAA 5DLYA 5FQNA 5C8YF 1T5TA 1GRQA 5K0TA 3AEKA 2NO4A 4O1NA 2Q45A 2X15A 1C7QA 4MI6A 2PSEA 4YJ2A 5LWHA 1POWA 3L5OA 3E7DA 2VYQA 4RBNA 1SYDA 4HX2A 1ZW6A 4G8DA 1PJZA 2PUFA 1F7UA 1PSZA 4L2IA 1W6JA 2VAXA 4I2VA 5M04A 3CQZH 2ZXPA 3LT5A 4JU8A 2XD4A 4PANA 2B8GA 1W2HA 2FFBA 4QO8A 2FZCA 3H4TA 1ZVKA 1ZOOA 1XMOB 4YBRA 5C8DA 3HYSA 3KETA 2Y4NA 1ZCBA 3PT5A 5B2FA 1DJOA 4CM9D 1UJ2A 5SYNA 2AKYA 3I32A 3JRNA 3L0OA 1ZGBA 3HXTA 1N2EA 2HQRA 4MAAA 3S2EA 1H9SB 1ZCZA 3ZCRA 4WZAA 2Q5IA 1YAJA 4EG1A 3BG5A 2UUBB 1CQJA 3QVVA 3R3SA 4HLUA 4LXUA 1K2VN 2AKAB 4B6OA 5DGXA 4CKWB 1N2IA 1UKEA 3ASYA 4RVCA 1XA4A 2PW5A 2Q4BA 1NX9A 3KAKA 4QD3A 4X91A 5EYPB 3ZD8A 2GJAA 1JQ5A 3EBPA 1E4OA 1Z18A 2LR0A 2YASA 2EP7A 1WBDA 4MA4A 1SKQA 4ND3A 1S7CA 5ELMA 4CEJA 1HNZL 4CQNA 5M3FB 4BLQA 3NB0A 3PUVA 2NU7B 3WRYA 1CZHA 4LGYA 2X2PA 2BGNA 4Z53A 4M98A 1AP0A 3C98A 3G5MA 4ZC1A 3WYDA 1WD0A 4KR7A 1O96B 1EHYA 3UJPA 3I34X 1Y34E 4KO1S 1MGOA 4IPTA 3WDKA 4MCIA 3ET5A 1UM9A 1WD5A 3ZI0A 2HCJB 1KE1A 1TNDA 5IG2A 2WMNB 4GN3B 1UF9A 2BDTA 3VYUA 3L7ZC 1WE2A 2R2GA 3RSLA 4PLYA 4EQ6B 5C4HA 2DWCA 3D3QA 1DRWA 3MXTA 5AI9A 2Q3LA 3PQ6A 5FOWA 4BJ6A 3GC6A 4GSLA 4RYLA 1A4IA 5ELCA 3A6DA 4HTFB 4CRWB 4DFDA 3OVMA 2K5QA 3ZWMA 1OVGA 5BSKA 3KCQA 1ASYA 4JSTA 3I9LA 1W3SA 1S8AA 1WKBA 2AFIA 1MEJA 4G5XA 1ZISA 2ZDGA 3SF8A 5KOJB 4JQCA 3V8MA 1X1CA 1EWIA 2J07A 3PGKA 4X1IA 1SCAA 3V4PB 2DFVA 2KQUA 3QUQA 5KJFA 1G8ZD 1KP9A 1DCKA 1VE3A 4WH0A 4YH1A 1FJXA 1WTCA 4BC0A 3RYCB 1DRVA 1NBME 3G9ZA 5JS8A 4JNKA 1CIPA 2CZQA 3BSWA 2A57A 3HOVB 2OO5C 1NYTA 1XDBA 3Q23A 3AL2A 2P1DA 3CLTC 3S2GA 3PI7A 5EKDA 1L1FA 4BNDA 5JQGF 1EUYA 3SEZA 1YU6A 3CKIB 3TRKA 1ZRHA 4R8VA 3HYCA 3T52A 1FVIA 2NUPB 4MCHA 4M0MA 4DQ0A 4RY2A 4EO9A 3LYLA 1YUBA 3T38A 3P26A 3WICA 4LYDA 1O54A 3SHVA 1CS0A 2X4LA 2WZDA 4ITUA 3HDTA 4UNRA 1UBRS 2GGSA 1T8TA 4HFJA 5EA2A 1EU4A 1QONA 3O73A 4NHEA 1A2TA 1SD1A 4KVFA 2B1JA 4NRDA 3QZUA 3ZWPA 1GUWA 1Y3DE 2YCLA 5K6AC 4HNGA 5AUQA 5I7VA 4BKOA 3ODPA 1RQLA 3HJFA 4RPHA 2GJSA 2L0XA 3K92A 2IZ1A 3LPMA 3IX7A 4AX8A 2K04A 2HMAA 2IYVA 5A03A 1A9XA 2OYCA 3TWOA 1E8DA 1KO5A 5ANRB 3SEBA 4NFSA 1OJLA 2YQ4A 4OMFG 1BX1A 1PKXA 5A2GA 5HZKA 1CKNB 1JSRA 1QTIA 1VBKA 4JIMA 3B3AA 4KWEA 4LSMA 1KOLA 3V8QA 4EGFA 1NR4A 3COWA 1O7YA 5DHFA 4NXNL 4RPJA 5JOBA 1M2WA 4FOLA 3HKDB 5DBHX 3ZJYC 3KEMA 3NM6B 2IYXA 2O2GA 1ZZGA 4N3AA 1OTXA 3QFSA 4AZSA 5LXTF 5DCLA 5CEFA 4OIJA 1YZNA 3AK4A 1IG3A 2GWHA 3IQDB 5BWNA 4YXWA 3ZBQA 4NOLA 2UUBL 2V03A 5K8LA 3W3AA 1GL9B 3ZUGA 3R3VA 5F5XA 1AKEA 1RKVA 3FIJA 2YQ5A 4DY4A 2XQGA 3NEAA 3QFTA 2ZTDA 1E2LA 1AQUA 2IFTA 3PG5A 3WI7A 1J5EQ 4URZR 4CTJA 3ZGNA 1SSOA 1D4AA 5JMOA 2FQQA 5DI9A 2OO5A 5NLLA 1X14A 3HM9A 4BFYA 4C01A 3D3WB 1JB3A 2QAGA 1IAVA 2VN8A 2F64A 3U61B 5D5HA 3GL9A 4QJFA 2R8YA 4XX0A 5AOVA 4QASA 3ASVA 4LF6L 3L05A 3VR4D 2PRJA 2NN6H 4EHHA 1IL0A 2A86A 2WMYA 4KO8A 4EFNA 1EGVB 2CMHA 2RGEA 3KAQA 4QIWE 1DAMA 2BE5D 2P4EA 2XB4A 3HOWG 3BBLA 4YRKA 1MT3A 2V1CC 2GARA 5CAEB 2J08A 5JNWA 3IT3A 3PQEA 2WKSA 4FF4A 3G13A 1P39A 3LOQA 1QIMA 2H48A 2YFYA 1Z6PA 3PEUA 1XVLA 4WT7A 3S0JA 4DK0A 1F8UA 3E0JA 4IMRA 3CCJA 2JAPA 3KU4A 4D9HA 1BYUA 1CZOA 5JAOA 3CUYA 1X54A 1BXZA 4HXEB 4U2BA 3HBLA 3S1NB 2WAQE 2E75C 4PV1C 2I4TA 3EMDA 3OZIA 3LKZA 1XALA 1L4UA 1SUSA 3I0ZA 1LQTA 2K6AA 4DNTB 2ZK7A 1X80A 3QQ5A 1GD1O 4BFCA 1SIWA 3KUDA 1F6DA 2POCA 4RK4A 2IX3A 1CK1A 1VL8A 1N36Q 5F7OA 5SZJA 3ULJA 3SQOA 1JOKA 3KAJA 4FHCA 1X1DA 2Q1YA 3EDCA 4CFZA 1GD7A 4MWTA 2RK3A 3N8HA 1K68A 3EY4A 3DKVA 2ZSUA 1Q0ZA 1BVSA 3BA6A 4XIJA 2G7MC 3TLMA 3OZAA 3ZE7A 4FJ1A 4KQ9A 3B60A 3CY6A 3O4VA 4FLEA 5K3SA 1C1HA 3GAZA 4XOIA 3EDMA 1F5NA 1QQBA 1I6LA 4A23A 2G5PA 4GEKA 3F2IA 4TM7A 4RVOA 1ODCA 3DL4A 4O4IA 2EZTA 5DGDA 3RYCA 4RTRA 3NTKA 2XZDA 3C41J 2CJWB 1Y6RA 2R86A 4K6GA 3H1GA 5FWXA 1X39A 2P9CA 1VG1A 5JI2E 3G23A 1XJ0A 1CBUA 2EVBA 2R6ZA 4YRTA 5F33A 3IRVA 2GRAA 4QC2A 3BAZA 1VXOA 5J9FA 4BO4A 1QOPB 3UVEA 4H0CA 2X4GA 2WR8A 2QN8A 3EN0A 3K0AA 3VSEA 2Y1OA 2CV0A 2CDBA 2VKTA 4TMYA 5C1PA 3ZEIA 4OB7A 1X19A 1X0XA 3W06A 4I7AA 2FUNB 1UBEA 4PYNA 5DN9A 4JI3B 1I9GA 1C30A 1B7YB 1BMFA 4G63A 1E9DA 5IGEA 3C3PA 1D5WA 3DMRA 2ZSBA 4JEMA 4NU8X 1BMQA 1DUSA 3DLIA 2Q3CA 2XDYA 3C5CA 3T61A 3MC0B 3UYKA 4D9CA 1Z37A 3E1SA 1FMFA 3O0DA 4RK7A 1EH5A 1BFDA 1XEWX 1TU0A 1BQ3A 4LF8B 2BA0A 1CETA 2P6NA 2V0GA 1TF5A 1H6AA 2ZJFA 4FE4A 4LYJA 3UK7A 4E2WA 2V58A 5DSZA 3W5AA 2BDUA 2MU1A 1Z5NA 4DV1L 4HJXA 2J7KA 2YHUA 3MPOA 3EIFA 3PDUA 4OI2A 3WYEA 3FFBA 3MYYA 3SM3A 4WLVA 2GPNA 2PWZA 3OLCX 5FBHA 5CX1B 3ZW8A 4L4YA 4GRAA 3M4OB 1WCIA 4M9SA 2JFQA 3CMCO 3LVQE 1GTZA 3OOWA 4MS3A 2JA6B 2QZPA 4UD2A