The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
FQGMFITTEGINAGYTIKDVVEATSSLMLASEDIDKYNMFDQLFDEAKQKLKKKADLLEGDGIIGLKYNTEVVEVNGAPKFLVVHGYGTVILID
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Uncharacterized protein
|
publication title |
Crystal structure of a Protein with unknown function which belongs to Pfam DUF74 family (PEPE_0654) from Pediococcus pentosaceus ATCC 25745 at 2.73 A resolution
rcsb |
source organism |
Pediococcus pentosaceus
|
total genus |
21
|
structure length |
94
|
sequence length |
94
|
chains with identical sequence |
B, C, D, E
|
ec nomenclature | |
pdb deposition date | 2011-01-31 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | Hypothetical protein apc22750. Chain B |
#chains in the Genus database with same CATH superfamily 2Y1B A; 1Y2I A; 2L8Y A; 1VR4 A; 3QKB A; 2GTC A; #chains in the Genus database with same CATH topology 2LN3 A; 2A2Y A; 4EO0 A; 1PAV A; 3TTC A; 2Q3V A; 1TIG A; 3ZIE A; 1RQ8 A; 4FBW A; 1II7 A; 2CRQ A; 3T1I A; 4YDQ A; 3TTF A; 1S8E A; 2H9U A; 3QKB A; 2IFE A; 1NJ2 A; 1H0Y A; 1NJ8 A; 3DSC A; 1NFH A; 2M71 A; 3IAB B; 1NJ5 A; 3IAB A; 3ZIH A; 2P9B A; 1DCJ A; 1NH9 A; 2LXR A; 1Y2I A; 3HZ7 A; 2EK0 A; 2Y1B A; 4FCX A; 1JO0 A; 4K88 A; 1JE3 A; 1H4S A; 3VTH A; 4NCX A; 1UDV A; 4NZT M; 4HD0 A; 2L8Y A; 3ZIG A; 3TSU A; 4HVZ A; 1H0X A; 1Y9X A; 4FBQ A; 1H4T A; 2EH1 A; 4YKE A; 4K87 A; 3TOE A; 2BKY X; 3DSD A; 4OLF A; 1NJ1 A; 1VR4 A; 2GTC A; 2Z7C A; 1XEZ A; 1HC7 A; 4NZR M; 3U6Y A; 4Q15 A; 3TSQ A; 3TTD A; 1NJ6 A; 3IAL A; 3WBM A; 3ZII A; 1JDQ A; 4FBK A; 4TWA A; 4WI1 A; 1VM0 A; 1NFJ A; 4Z9E A; 4HVC A; 3VTI A; 3LVJ C; 4K86 A; 3P04 A; 1H4Q A; 3TSP A; 3LVK B; 1LN4 A; #chains in the Genus database with same CATH homology 2Y1B A; 1Y2I A; 2L8Y A; 1VR4 A; 3QKB A; 2GTC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...