3QVVA

Crystal structure of ancestral variant b9 of sult 1a1 in complex with pap and 3-cyc
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
SRQPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFNRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPDPGTWDSFLEKFMVGEVCYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTIPQEIMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfotransferase 1A1
publication title Directed evolution of sulfotransferases and paraoxonases by ancestral libraries.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qvvA00
4CF7A 1SKYE 2CNWA 3T1VA 4BFZA 4E22A 1YE8A 2GCOA 1US8B 1SVKA 2VEDA 2RGBA 3EASA 2B92A 5DN6A 1O3YA 3FDIA 4W9MC 2WPDD 1E69A 1XMSA 4MH0R 5KUTA 3UMSA 5EXXA 3OHMA 1E9SA 4NU0A 4W5JA 3BD9A 3BH6A 2GZHA 2CLCX 3WYAA 4O2RA 1TMKA 2ZRBA 2PJRA 5FPYA 4TLDA 1EGAA 2BOVA 4EFNA 4GZMA 2ZETA 1KSJA 1FL9A 1XCPA 2O8DB 2BKUA 1PUIA 2ZR7A 4B43A 2QTHA 4EJSB 5LBIA 1AM4D 1LW7A 4JVNA 4DLYA 3NDBB 2WJVA 3DPUA 2W2TA 5H70A 3L0OA 3PR1A 2W58A 4KSBA 5JWRA 1VYUA 2AHOA 1KKMA 2QQEA 3Q7PA 4X8MA 3MWJA 4DLRA 2JLVA 3WHKA 4MKFA 2FG5A 4MA4A 4FCVA 4P33A 1Z83A 2KB0A 2QAGB 4MUAA 3LX5A 2X1VA 4IOJA 3A4LA 2IYWA 3FPAA 4GBMA 4LJ9A 4D82A 4LZZA 4TQ9A 1OV4A 1DTSA 2WJJA 3V4RA 1FQJA 5KSOA 2KBEA 4KI0A 1XRJA 3BB4A 3R20A 3X1YA 2HEIA 1JAHA 3D31A 4IDPA 2B8TA 5M04A 2RAPA 4LGMA 1W44A 5FTJA 5LB2A 3CNOA 3GJ6A 1E0SA 3BK7A 1G3UA 3U44A 5BWMA 4DZZA 3B6EA 4YONB 2XSZA 1AKEA 3CR7A 2O8FB 1II9A 3PUWA 4PZZA 4BFVA 4DSUA 5F98A 3THXB 4LCBA 1KI7A 4QJ4A 4RKEA 3RWMB 2JLYA 3X1ZA 2CHVA 3RS5A 3U7FB 3O8CA 4Q4JA 3GFTA 3U60B 3DZDA 1E32A 3FHCB 3TR5A 4YQFA 4CGZA 2PMKA 2BJVA 1R7RA 2G83A 1OXSC 1T5LA 1TF5A 4BPBA 2FDCA 2IW3A 5DYIA 4QM6A 1K8RA 2C2HA 2ERYA 4LV5B 1S2MA 4QXAA 1Z07A 4CYMA 4DIDA 1HUQA 3AVTA 4DCTA 3V4FA 1ESMA 3KB2A 5L3VA 5CIQA 4H1UA 3IO5A 4PO1A 1SQ5A 1D2NA 1XMIA 1KI3A 2MSCB 3A4MA 1W4RA 2H17A 3Q7QA 3PEVA 1X6VA 4Z1MD 4JLKA 3HWSA 1VCNA 4CEJB 5KOYA 2IXFA 1G5RA 4FCTA 1NG1A 4LBYA 5TARA 3SEAA 2KBFA 1Z5ZA 4KV9A 2R8RA 1K5DA 4QNRA 5FOXA 4URWR 3U3RA 2ZI6A 4HLQB 5CB8A 2OESA 1G6HA 1MABB 2VP9A 1UKZA 4D0LB 3ASYA 3TMKA 4WOPA 2GF9A 1KK0A 1OXXK 3BORA 4NHOA 1VDZA 3B82A 2IHYA 1N5JA 4M21A 2EFDB 3CH4B 1NVVR 1R0XA 2N1BA 4IDQA 3REGA 3SN6A 2FNAA 2Q3FA 5FI1B 3TNFA 4Z8XA 2ZRHA 2ZROA 3IHWA 2V8OA 4A9AA 3GFOA 3QKTA 2CL6X 2EQBA 2JA1A 2QL6A 1AGPA 1XEXA 4B44A 1U81A 3VMFA 4XH9B 5HE9A 1CJUC 3EXAA 1KSGA 3SDZA 1C1YA 4ASUA 4XWOA 5H1YA 1P60A 4P31A 5JEEA 3S1AB 3X1WA 3L2OB 4C0QC 1R0WA 3CF0A 3RC3A 2RGXA 5EP1A 1Z0AA 2ZJOA 4RFSA 4LJYA 4BUJA 2WMNB 4LV8B 4PC2A 4IEEA 4JL8A 1D9ZA 2FGJA 3TAUA 3K0SA 2F7SA 5BYKA 4U02A 2QU8A 1NSFA 4OHWA 3CF6R 4H9GA 3SFVA 3RNLA 3TSOA 1UF9A 2IC5A 1H8HD 3EPLA 1H8ED 1ZYUA 1IY0A 3QVUA 2GXQA 4OK3A 1D5CA 3DOEA 3UMRA 2ONJA 1XTRA 2A7QA 2O8CB 1SXJA 1EFHA 1XPOA 1G8HA 1W5SA 5UKDA 3FGNA 5BN3A 5DISB 2ZJBA 4AC9A 2J7KA 1ZM7A 1OH6A 4LYFA 2IF2A 2PZEA 4RKFA 4UXIA 2W6ID 4IFBA 5JSZB 2KWIA 4HDOB 1OE0A 3HU3A 1VCMA 2Z4RA 3PG5A 3W6PA 2ZI7A 3J81k 3SBEA 1MOZA 1R10A 2IUTA 2QAJA 4OK6A 4ERNA 4ACBA 2NO7A 2QNRA 3AVVA 1DPFA 1JQLB 1G64A 1R2QA 4NH0A 2PLRA 3KUCA 5DHFA 2P5SA 1Q21A 4JVMA 4C0HA 5AUOB 4AYXA 3HPQA 3CRVA 1YKSA 3AGPA 2RH5A 2GJ8A 4DSTA 3BWDD 3OIYA 1T0HB 4PQFA 1CP2A 2C9CA 3GCGA 1TQDA 4RSGA 5EQTA 1W7AA 4DSNA 4L8GA 2VP5A 3SHWA 1L2TA 5J47A 2LCFA 1XCGB 4JVSB 2DHRA 3RS2A 1KI1A 2AWNA 1JR3E 4ZCMA 3W6OA 2CK3D 4OYHA 5LDDC 4NYMQ 3IBGA 5DN6D 2OG2A 4NBSA 1O87A 3U44B 1Z8FA 3KKQA 4BLTA 3MCAA 3AVWA 4B35A 3E70C 3OEHA 2W83A 1XD9A 4ZCIA 3C5CA 4IOLA 1N0WA 2J7PD 3MGCA 1G19A 4QBFA 4B3CA 1E2HA 1KI9A 2VYFA 2QI9C 2VF8A 1ZW6A 5FR2A 1N6IA 4L9SA 4QJ5A 3NDPA 5BXQC 4KBGA 3W9YA 4QBGB 1DAHA 1XU4A 2ZSDA 1OXTA 5AJYA 4FMDF 4PSAA 2XTZA 3BXZA 4L9WA 1PLLA 1L7VC 4LX0A 1AA9A 2WWIA 3WRYC 5KDLA 4Y0AA 5EXSA 2YWEA 3K09C 1M74A 2IX3A 3FE2A 4JSYA 5JJLA 4GDFA 3HU2A 4ESHA 1WQ1R 5G3YA 4G5SA 3TGPA 3ZLJA 4F93B 4XJXA 4Q00A 4WVFA 1SZPA 4ON9A 3TQCA 1PLJA 1S9HA 4B3GA 4F92B 4G01B 5GVRA 1KI6A 5EZ5A 1QHXA 2YVUA 3W6NA 4DCSA 4EQ6A 4HZIA 5B2ZA 4KLNA 2OCPA 3PUVA 5E7JA 2V54A 3N2EA 1IQPA 4F4IA 3KJHA 3Q5DA 4IXMA 2ONKA 4TZ0A 1HE1C 2J0VA 4LRWA 1C9KA 4OI1A 3CPHA 3LBHA 3LWNA 1E79D 3I32A 3HU1A 1QG4A 1RYHA 3MMPA 4R2IA 4DLXA 4EJSA 3NC0C 1WXQA 4ZI3A 4Q48A 4Q03A 1OIVA 4RD6A 1XP8A 3PV0A 3GLIB 2WSSD 2NIPA 2IL1A 2IWHA 5FL7D 4M9SA 4S2EA 3RRNA 3GLGE 4QHYA 1U8YA 1NY6A 2ODWA 3AUYA 3SOPA 1J7KA 2OAQ1 3QXHA 4TTQA 4U00A 3KQHA 3A1SA 4WW0A 2ZS8A 1XBTA 1I2DA 2F55A 4X8OA 1N0VC 4JLAA 4ARZB 4NYIQ 3DM5A 1CR2A 1F2UB 2PT7A 4CW7A 2YKGA 3SJCA 1U94A 2GF0A 1EFUA 2FSGA 3QQ5A 3K70C 3D3QA 2HXSA 4JLVA 5B64A 5B58C 1G5PA 5FUXA 2ZAOA 2CCJA 1M6NA 1XJQA 3KDSE 4FW9A 1E9FA 4HLUA 2I1QA 5KSYA 2P5TB 4Q66C 1XTKA 3CNLA 4Q01A 1Q1ZA 3V00A 1WDTA 2I1VB 2BVNA 4HB4A 1YZQA 4IRUB 3QXCA 3FYHA 4Q4JB 1CJKC 1QF9A 2XZLA 2FEMA 3THWB 4AURA 2OILA 1E0KA 5HR5A 4IDNA 2OLJA 2FA9A 1QBKC 1CR0A 2CE2X 3U61B 2B7CA 5TY0A 4D80A 1N3BA 4N3NA 2DWOA 3EZ6A 4NYJR 3CPEA 4Q7LA 1M34E 1Q1BA 1AJEA 5AUQA 4PX9A 2WSMA 1S96A 3HPRA 4P4SA 421PA 1SVOA 5JJIA 3GLFE 1DAFA 1EX7A 3IILA 2REXB 4RJLA 1Z0JA 2WTUA 2PX0A 1M7GA 2ODNA 3MAAC 5AUPB 1GUAA 1ZIPA 4DHEA 4CEHA 1GRNA 1Q3TA 2P3SA 1XTSA 2NO1A 4TLBA 1NBME 4P4SB 4HYYA 3IEUA 2G1KA 5HKKA 3AF0A 2FZ4A 1P75A 1W5TA 5FUYA 1OH8A 1NRJB 4Q18A 1P3JA 1N5LA 2CLSA 3AF3A 3P4XA 2Q3HA 4DLSA 1PJRA 2IA5A 1G8GA 3SJBA 2RHDA 3QKSA 5JS8A 2B6HA 3I5XA 2J0UA 4GOJA 1L8QA 1FNNA 4G0NA 3GLGA 3PEWA 1CLUA 3N2IA 3QBTA 1NN0A 3AM1A 4QGHA 5EE9A 2A5DA 3W3ZB 3FWYA 3SJAA 1IJEA 2QN6A 4MDEA 1NLFA 2OFOA 3NWJA 3M4YA 3KKMA 5EXPA 3VNVA 1E3MA 4Q1AA 1BO6A 2REBA 4NCNA 4JLPA 4GRAA 4NYMR 3RANA 1JR6A 2IBMA 4L16A 2AR7A 3I3SR 2CK3A 4TT3D 2ZI3A 2ORVA 4QGAA 3IQWA 5E95A 2IYYA 4LHWA 3NIBA 1NF3A 1W49A 4IDOA 5CK4A 4NDZA 3SFZA 2F3TA 1GKYA 1E1RD 1XDBA 4FMBB 1LB1B 2NPFA 1QRAA 3R7WB 5IT5A 2FFBA 3K9GA 1XD8A 2QROA 1LF5A 3BH7A 3OEHD 4YMTA 5FBRB 4HAXA 4Q9IA 3TVDA 4JJKA 5GJVC 1DBSA 4IFEA 4JLNA 4QM7A 3ADKA 4XSGA 4NCJA 1COWA 1Z6XA 2IYXA 2WBLC 3R7WA 1OXVA 4OI2A 5G3ZA 5FPKA 2ZRKA 4LBZA 3LAWA 4FWTA 2ZSBA 1OLOA 1GRQA 3MRSA 2RGEA 5GJWC 3NEJA 2RGNA 1AGRA 4G5GA 3I62A 3BFVA 1FP6A 2ZJ2A 4TSFA 1IN7A 3CWQA 3EX7C 2Q9AA 1OF1A 4HB2A 4IEIA 2IEZA 3AF2A 4QKQA 2WMOB 1MKYA 4I1VA 2QMEA 2JJ2D 2QPTA 3GLIE 1F60A 2JIZA 4D4JA 3HR7A 3PUXA 3NH6A 1ZNWA 2P65A 1NVXQ 1HE8B 3E2IA 1DVRA 3L0SA 4LDJA 1G5TA 4DDUA 3SHFA 1OYWA 2WWWA 1ZUIA 2JJ2A 1OIWA 1TUEA 2ZE5A 3P27A 1VCIA 3A1WA 2NGRA 3TIFA 1HA3A 1B23P 4QBHA 3ZVMA 3EZFA 3BRWD 2OV2A 4LYAA 1UADA 5J4KA 1JR3A 5EP4A 5TXGA 2G9NA 1T8UA 2QM7A 4PZYA 1BIFA 1N6LA 4ZO4A 4UXJA 2IHBA 2GVZC 1Z3IX 4DIEA 1XWIA 5CDFA 3AP2A 2RMKA 1ZJ6A 3EZ7A 2ZQ5A 4LHVA 1KY2A 4RZ3A 3DZ8A 1AK2A 3RDPA 2FX3A 1YZNA 2PZGA 4ILEA 3EPJA 2HXYA 4RZXA 4TT3A 2DWPA 3C14C 4OHXA 5LD2B 2GJSA 3K9NA 2HT1A 1VYVA 4UNRA 4Q4AA 4R98A 3F0TA 2W6JD 4DUGA 1KSFX 4D0NA 3M1IA 1HTWA 3P20A 2QE7A 3OZXA 2JLXA 2OO7A 2XZOA 1DELA 2QT1A 4B48A 1ZU4A 4LHXA 1QZXA 1P61B 1T91A 1COWD 5SZKB 1LV7A 1NN3A 4CEIA 1GZSA 1CJVC 2F1RA 4QJ3A 4MKGA 3QPWA 3UATA 1N6RA 2AL7A 3QXXA 4TLEA 4IDHA 1R8SA 5G40A 3GEIA 1E2DA 1YZLA 2XJ4A 3IHLA 1G20E 2ZIAA 4QRHA 1NL3A 1VECA 2K5UA 3G5UA 4O25A 5EUQB 3QVVA 1GDDA 2H1LA 3AVXA 4OBEA 2NPIA 3A1UA 4IOKA 4XWKA 1OB2A 2PCLA 3KJIA 1G3IA 1ZCAA 4DLWA 2GAOA 2W2VA 3BJIC 2O0KA 3IPXA 1RRGA 2WIAA 2ECKA 4P3YA 4XVUA 4BLSA 3LH5A 3TBKA 2KJQA 5HKKD 4OQNA 1P9WA 1AIPA 5A0FA 2QENA 3U2QA 2P6NA 4M4SA 4DC9A 2EVWX 3TUIC 3U7HB 4A82A 3K9HA 2FFHA 3IIJA 3KXIA 1DAKA 1E0AA 3VKHA 1W48A 1ESNA 4KHZA 4MRNA 3X1DA 2ZRMA 2ZRIA 5CIWA 4EPTA 4HZUA 4PZLA 3AV0B 1KNXA 3MJHA 4FWIB 3BS4A 4WXRA 2C9OA 2HT6A 4DT1B 1N6HA 2N46A 3QJYA 3T35A 3KQNA 2BDTA 3K0FA 5CLLA 2VSFA 4R9UC 4HZUB 3AP1A 4OQMA 4AWXA 4EQ6B 3T1QA 1RJ9B 1TQ4A 4PTLA 2WWYA 2ZE6A 2GBLA 1LS6A 3U6KA 1IAQA 2FFQA 4JIMA 1XFAA 2BMDA 4IVQA 1GTVA 4A92A 3MFYA 4XVRA 3R9XA 2VHJA 5AUNB 1VMAA 4M22A 3GFPA 2NO6A 3OF5A 4ZKEA 4LBWA 2O0HA 1GKUB 2CHQA 3FMIA 1E9RA 3GQBA 3D8BA 4JSTA 4LJ4A 4TMKA 4Q9HA 3KZ1E 4JLJA 3SYNA 3TW8B 1R8QA 4XWAA 3FOZA 3ZGXA 1WF3A 2DBYA 2ORWA 2VH5R 1R0YA 2WWHA 4DRZA 1Q0UA 4O0MA 3FKSA 3QENA 1OPXA 4NKRA 4PPNA 5J40A 3MSXA 1H65A 1QHYA 3SBDA 3PENA 2EWVA 4A6XA 1FX0B 2GCPA 2Y8EA 2BHRA 5HTKA 4CEIB 3X1XA 3W3AA 2ZR9A 1NKSA 1QHGA 2IS1A 4XTRA 3REFA 2WIBA 2VP6A 4GMXA 2DYKA 2ZYTX 3I8SA 4Q02A 1V5WA 2IXGA 1ZD1A 1LFDB 1ZIOA 1TF7A 3CX7A 3WP0A 1G18A 5E7MA 4RCZA 4AY2A 1MRNA 4A0GA 1AS0A 1E2EA 1MRSA 4ZCLA 4MGIR 3QE0A 1JNYA 5LD2C 3K1JA 4PSVA 4Q4LA 5CITA 2OE2A 2ZI9A 3ND9A 4BECA 2QBYA 2GBLC 5JBQA 5KDOA 3CZQA 5FI0B 1LY1A 1FNMA 3LY5A 3G0HA 3ICQB 2ZUBA 3FMPB 5JSZA 3EZ9A 1IN5A 2C5LA 1U0LA 2J1LA 1E4VA 1M2OB 3ONWA 3AF1A 3PIRA 1JXOA 2BV3A 3GLHA 2RGAA 2NO0A 3MWKA 4LPSA 2ZRPA 3FFAA 3KJGA 1II0A 2HV8A 2F43B 3H0KA 4HLDA 3W8RA 2ZJ8A 3LO5A 3LVQE 1JAIA 5JHHB 1CJTC 1XD2A 2WKRA 1RIFA 4GI7A 1U0JA 4MITA 4UKDA 5FOWA 1P2UA 2FEOA 2IYSA 2OFXA 2AWOA 2OT3B 4ABYA 4W7SA 5EE0A 1D8TA 3JZAA 1GIAA 4JT2A 3WNBA 2W6JA 4W5HA 4KVAA 2BJWA 4MGZR 4US1R 5C1BA 4CEJA 5CYPA 1NBMA 4PFSA 1RJ9A 2L0XA 3CZPA 4RVCA 3F3YA 2JLQA 4RD4A 1NLYA 3ZVRA 5IRCD 4DDWA 4HUQB 1WB9A 5BN4A 2FPKA 1SKYB 4PO8A 3TLXA 4Q4HA 4C0LA 1UDXA 2O8EA 1HQCA 2A78A 3IKJA 1I4TD 1IXRC 1FTSA 1ZP6A 2XITA 2Q6TA 4HEJA 4TYPA 5CJ2A 4A36A 2XXAB 1AN0A 2AFHE 3ZD7A 4TTPA 5HCNA 4P4TA 1HURA 3I72A 2PEZA 4LJAA 5F3WB 2XTMA 1OH5A 4KFRA 4QHTA 3QG1A 3DKPA 4B71A 2VL7A 1VHTA 2QG6A 3TUZC 2XNSA 1P72A 3NTUA 3BFKA 2ZYUX 4GL2A 5DI9A 2H7VA 1J99A 4GPTA 4BLPA 1EFRA 4A8JC 4M1WA 1TQ2A 2A5FA 1KI4A 2RGGA 2VSXA 2ZI4A 1Z6YA 2X8AA 1MT0A 5C18A 2OSBA 3DL0A 2ZVPX 3C16C 4OI4A 4HB0A 4JT4A 4WAUA 5FFMA 4BASA 2GZAA 3WNCA 1B0UA 1SVWA 4A15A 1NN1A 1JJVA 1U0HC 1FTNA 1DAEA 5L3QB 5SZHB 2P6RA 2HYDA 2QBYB 4BWYA 3P1JA 2CCGA 3BE4A 1D2MA 4Q4AB 5GVSA 1P73A 1AQYA 3KKPA 2D7CA 2Q9BA 4DLUA 3DDCA 5ELXA 1T5IA 2XGJA 2PEYA 2GEDA 4DCUA 1RE0A 4HDQB 2RGCA 3H2YA 2F1JA 2W2XA 4A0FA 3ZVNA 3SQXA 1YVDA 3RVBA 4L4UA 2G3YA 5DSZA 1UKYA 1GITA 3ZIAA 1NSTA 4AK9A 1KAOA 1GL7A 2QRZA 4GP7A 4CDGA 1R5OA 1E1QD 2QMHA 2BBWA 4A2QA 1UBCA 1FP7A 3LXRA 1S4QA 1FMLA 3VTKA 4BFYA 3QG5A 5TB5A 3VFDA 2NG1A 1CTQA 3PEUA 3PVSA 1DG3A 4KO8A 3I4LA 2NOAA 2PZFA 2GDJA 4TWZA 1G1MA 1W47A 5HZKA 5JZVA 2IEYA 3IIMA 1JECA 1U90A 3ZQJA 5FTLA 3Q85A 2QQ0A 1KDOA 1Z6TA 3VR6A 1I2MA 3RSLA 3R9IA 1UKVY 3LVRE 2VP4A 4EPYA 2FSFA 3NHBA 3SNHA 1VG1A 2ZRDA 3LW7A 2ZEJA 2QTVB 3U4QA 3HJNA 4EJSC 3BBPA 5JI2E 2FH5B 1HY3A 4Q5IA 4QHSA 4ZDKA 4DXAA 4CVNA 2JAQA 1GNPA 2CEAA 2CBZA 3O47A 4BZPA 1E9CA 1N5KA 2WSSA 1JJ7A 2R6CA 1EX6A 2ZU6A 4LV6A 4AKIA 5CJPA 5L3RA 3TW4A 4PPFA 1R6BX 3I73A 2D06A 3GMTA 4AD8A 4E5UA 1IN6A 3QF4A 2CDNA 4DJTA 1G8PA 2LKDA 2JJ1A 5JMTA 2MSEB 2XZPA 3AUXA 1DAIA 1C4OA 2XNDD 2GVDC 2WHXA 2QAGA 3CRW1 1M7BA 4K46A 4PAOA 1T3HA 1JI0A 2NZJA 1DO0A 3UG7A 2OCBA 2BM0A 4NMMA 1WE2A 1IXSB 3BB1A 3LLMA 3L0IB 1I4DD 3L43A 1FZQA 2G6BA 5TDHA 4DEYA 2DPXA 5CYOA 2ANBA 3VX3A 1QHSA 2ZRAA 5FL3A 4RFSB 4EIWA 1RZ3A 1EK0A 2RGDA 5KPJA 4AI6A 1DOAA 3B1WA 3WNDA 1M7HA 2FSHA 4CZ2A 1NMZA 1NJFA 1NMXA 1SULA 1M1YE 3CH5A 4DBLC 4GOKA 2G1JA 1W4AA 4LY6A 5F9FA 1P2VA 2BIFA 4ZIRB 3I1FA 5EZ6B 3UXMA 5JRZA 5BQ5A 3RWOA 1HT2E 5A4JA 1S1MA 1RW4A 2AK3A 3U3KA 1E96A 4BEBA 2ZYVX 2VHQA 3CWZA 3A4NA 2CVFA 1XJCA 4M1TA 1P5ZB 4TYQA 2I4IA 2DFNA 2O0JA 4AIIA 4DLVA 4KYUA 2WKPA 4B2PA 2QPAA 3BGWA 1JPJA 1W4BA 1OH7A 4ZI2A 1WMSA 2QSZA 1XZQA 3M6AA 3DKVA 4K8OA 5FR1A 3O8DA 5HPYB 5SZIA 2G88A 1U9IA 1A1VA 1N6NA 2GK7A 2DB3A 2BWJA 3AKYA 221PA 4WBSA 1EFRD 2ZE7A 4H1VA 4F4JA 3MWYW 4MYCA 4I99A 2R6AA 3EPKA 1BKDR 1U2RA 3ZZUA 2FGKA 3CONA 5KSPA 4JMPA 2J7PA 3GJ5A 3KB1A 3ZQ6A 2VP0A 1YU9A 2W6IA 1QHNA 1IXZA 1DE0A 2ZUDA 1ZMXA 3IGFA 3FHTA 3PCRB 2YHSA 2CJWA 4C0AC 5J4HA 2IS6A 3BERA 2Q21A 1IN4A 4NL4H 4AYTA 3ICEA 1RPZA 3ECCA 1CRPA 3VR5A 4CT5A 2J59A 1U8ZA 3C7KA 4HB3A 4NPHA 4XIGS 4GZLA 1KO5A 2HLDD 5CLQA 4AG6A 1Z29A 2F9MA 4BFSA 1S3SA 3W8NA 2GEVA 5F2EA 4F91B 1XZPA 5EXTA 3RAPR 3W5JA 4YLGA 3AVOA 1G7SA 4MRVA 2A9KA 3G82C 1CS4C 3IQXA 1A2KC 4I81A 4TTRA 3THOA 4DCVA 4URXR 2H18A 2DWQA 4QOSA 4OL0A 4HI0E 2HDNB 1S0UA 5JHGB 4D4LA 3V9PA 1KI2A 2QSYA 1T3SA 1W46A 3KKOA 3WY9A 4D25A 2ZUCA 1UEIA 2YWFA 1P62B 1Z06A 2V1XA 4ZV4A 2R6FA 1ETUA 2FWRA 4HSEA 1IOZA 1VKJA 1MO5A 3CRQA 4JZKA 1SVSA 3UWOA 2YINC 1U99A 1Z6AA 3EZ2A 4ITRC 4LYJA 3X2SA 1Q1EA 2WJGA 1G7CA 3AGQA 3R8FA 1X8LA 3VU9A 1FX0A 3N70A 3OEEA 3VKGA 5H8WA 1VPLA 4W5WA 4PHHA 1E0JA 2W00A 3QXJA 2MSDB 2O8DA 4XOIA 4MGYR 2IT1A 1E99A 1XEXB 2WV9A 4LC1A 3Q8XB 1BMFA 1N5IA 2C9YA 1G3QA 3GEEA 5EE3A 2ZYWX 3U7GA 2GNOA 4PHGA 5DO9A 1KZGB 1Z2CA 5IK2A 1TL7C 4HAZA 1ZM9A 5J4LA 4M1OA 2BEJA 4TQUS 1KHTA 3AKCA 5D3QA 3SR0A 4YMSA 2A2ZA 4LJ5A 4U5XA 1YJ5A 4GOXA 2CXXA 2HF9A 2QM8A 4C7OB 2BCJQ 2B8WA 2V6JA 3I92A 2VA8A 2WJHA 1XCMA 1GNQA 2OAP1 3GD7A 5JCPA 5HE8A 1OFHA 1TUIA 1DG1G 3P26A 2JLSA 3F5FA 3ZIAD 4IVRA 5JECA 1NI3A 4M1MA 5AJVB 1DAGA 4EPVA 1XNJA 4AKGA 2FZLA 3U3OA 3DO6A 1J2JA 2J3EA 3CX8A 3UMFA 3HYRA 1S1CA 3T06B 2GK6A 1AS2A 5FUVA 3QKRB 1OHHA 1E4YA 3W90A 4Z51A 721PA 5KTYA 1TNDA 2ZJZA 3K0CA 2BBTA 5LB4A 2WJYA 1II8A 1TAGA 1KKLA 2O5VA 4BFXA 3QPUA 4GSYA 2A5YB 4Q9LA 1G7TA 3B7GA 4LHYA 1X1RA 3QNUA 2PH1A 2I3BA 5E4FA 2A3RA 3CB4A 4GP6A 3WXMA 4B3DA 5KNBA 2V9PA 3KQKA 2E87A 2QEQA 4Q9KA 2FFAA 1S3GA 4HDCA 1OYYA 3SZRA 3BB3A 5DE3A 1KMQA 3C41J 3LW8A 1RC8A 3JVVA 1KMHB 2C96A 4JL6A 2BCGY 4QG7A 4UQOA 3VR3A 3SI7A 4PHTA 3FMFA 4M53A 2C8VA 2ZTSA 4FI3C 4X8HA 2LWIA 4C0KA 3OIWA 4GFDA 2AKAB 3RRYA 5AJXA 4TL8A 4I1SA 3PQCA 5FOVA 5C2JB 1NKTA 2OFWA 3Q3JB 5FTKA 1KDRA 4TL7A 1FOEB 4K81B 4OQLA 2CCKA 2EU8A 4LUCA 1Q57A 5KU1A 2DFLA 2ERXA 4DDVA 2E1RA 2FF7A 4KAXA 5KHOC 1EFCA 3GJ7A 5IK2D 2ZJYA 2WPDA 3B5JA 2IF0A 2ASEA 1WP9A 3MG9A 4V0LA 3U3MA 2J5XA 1L4YA 1XPRA 1E9AA 4KU4A 4OHVA 2KSQA 2QGZA 4JLDA 4O3MA 4PC1A 4PHFA 3EAQA 2J0UB 1KO7A 3CO5A 3OE7D 3P4YA 1G3MA 2EW1A 2AN9A 2R62A 2AD5A 3PFIA 1OXUA 5JWOA 1KI6B 4BZQA 1FQKA 4PC7A 2QGNA 2VBCA 4V03A 1P6XA 4DB2A 2AFIE 4GNKA 2JLRA 4D4MA 1ONBA 4QFMA 2QP4A 4V0OA 4C7OA 4CRWB 4DUGD 2F1IA 4Q7JB 5SZJA 4Q47A 1Q22A 4BLRA 3QIAA 1E1QA 1E94E 2EFHB 2GWHA 4JKYA 1KI8A 2NO9A 4OJQA 4LWZA 3A1TA 4AKEA 5J5CA 3VQTA 1IY1A 3LD9A 1MO4A 3Q9LA 3ZS8A 2JLUA 4EUNA 1GWNA 1T4GA 3GJXC 3C5HA 3O8RA 3FMOB 2DFKB 3QBVA 1N2CE 3B2EA 5JS7A 1OJLA 1GVNB 5JEDA 3Q5EA 4JJZA 4BLQA 1GP2A 3CNNA 2C03A 4TMTA 1JR3D 2GAAA 5P21A 1YQTA 1KIMA 2QORA 1KJWA 5BYJA 3T61A 3EA5A 4Q1BA 2BC9A 2XAUA 4A4DA 2ZM5A 2VHUA 1UAAA 2XXAA 3K9LA 2TMKA 5KDDA 2XX3A 2JASA 3GJ0A 4JYBA 1CF4A 2HLDA 3LV8A 1E2LA 1KAGA 5B57C 5EJEA 3RC8A 1W2GA 5GJBA 3RABA 1P9RA 1UFQA 1N0UA 3LLUA 3QUSA 1PV4A 1W0JA 1IN8A 1ZRHA 1G291 1EG7A 3FFBA 3QF7A 1OIXA 4KXFB 1KMHA 1QDEA 3AH8A 1CU1A 1E2IA 3U4QB 3O8BA 1R5BA 4URUR 3EIEA 3EA0A 2Z6VA 5BW8A 1X8KA 1OKKD 2VF7A 2CNWD 4G1UC 4RD2A 2HJGA 2ZRJA 3R8CA 3EG5A 3QEOA 2QPOA 2Z5FA 2D7DA 1E98A 4KFUA 1CKEA 4JVLA 2VSOA 4X8LA 4B3BA 1GOTA 2ZS7A 2UVQA 2JDIA 1NNEA 2BM1A 2R2AA 1NJGA 4JLMA 3B8HA 5CB6A 3L8ZA 5FH9A 4C0BA 1GL9B 2HCBA 3AQ4A 2J45A 2V7QD 2W0SA 5DI3B 3EWSA 3ZDQA 4CIDA 4KITB 2HF8A 5FPHA 3QF4B 3VKWA 1G6OA 4YMWA 3ADCA 3K0EA 5TVKA 4CEHB 3LBIA 4MKHA 1U8AA 2ZSFA 4N0DA 1F2TB 5FBQB 5AR1A 1R0ZA 3VU9B 2Z43A 4RD0A 1W0KA 1Z2AA 4YXWD 3B1VA 2OXCA 2G0TA 1D6JA 3VHLB 4TMWA 5CM8B 3ZYCA 5KNDA 4L5BA 1NVWQ 1J8YF 3OAAA 2G77B 3LBNA 4BGDA 2BEKA 2ZITA 5L3QA 1YRAA 4NCKA 4DKXA 1FMJA 4LI0A 5KSZA 3EPHA 4TZ6A 2ZI5A 5JWHA 1LVGA 1T3LA 2VTKA 5DNYB 4KBFA 1WBBA 4RD1A 2OLKA 4BQSA 1UBGA 3IDQA 3K8YA 4ZPXA 4Z1MA 4B2IA 3ADDA 1F5NA 3UANA 1E9DA 1SVIA 5JCZA 4XD7D 2MMCA 5JJKA 1XTJA 4JBXA 1G16A 6Q21A 4A2PA 1F2UA 2C98A 4DLTA 4I1OA 1KDTA 2B21A 3CW2A 3DVLA 1DAMA 1XD2B 4B6FA 3LX8A 3K0AA 3PEYA 1DS6A 3I61A 1VYTA 4FMCF 3T5DA 4DWJA 2JCSA 1BYIA 4FN5A 3WP1B 2AK2A 4NYJQ 4C9BA 2WOOA 4KODA 4TLAA 4WXPA 2ZR0A 4ACAA 4Z54A 2WWXA 1J70A 3K0AB 2IUSA 1ZNZA 4UJ3A 2PL3A 3WMGA 1KK2A 4OHZA 4YC7A 2WOJA 3UIEA 1VCOA 3WHLA 4R2HA 3CX6A 3EARA 1JEEA 2D3WA 1YR6A 3HDTA 2J41A 2CMKA 3QOFA 1PUJA 4E03A 1YZUA 1D9XA 3AKDA 1Y3AA 5K8LA 4TYYA 4PQRA 1NP6A 3RS4A 2FJUA 1G4AE 3THYA 2OXRA 1JEDA 4GT1A 2X77A 2Q9CA 3RS3A 2EYUA 1MR3F 4LYHA 3IUYA 4HATA 1HV8A 3KXLA 4E09A 521PA 2DFTA 1XEWX 3W5IA 1FPMA 1UKEA 1ZAKA 1OW3B 4Q1DA 2ORIA 3PUYA 4HLUC 5JRJA 2GEUA 2OZEA 1E6CA 3F8TA 4BEJA 1TTTA 4F7WA 4A1FA 2JLZA 2XEXA 3LDAA 3OIUA 4EDHA 4C30A 2OCYC 1UJ2A 4YDHB 4EPXA 2GXSA 1BYUA 4B73A 1OB5A 2YWGA 1WBDA 1W36D 1G8FA 1ZM2A 1T0JB 2IXEA 4TMVA 5KO2A 4LSGA 4TN1A 1AS3A 4PC3A 1KO4A 2ZPTX 3CPJB 4M9QA 5TV2A 1XB2A 3NBYC 4BFWA 2PBRA 2NMVA 1G4UR 1G9XA 1CR1A 3TK1A 1P4SA 4ZIRA 1L4UA 3ZZTA 3LNCA 5FL7A 1E2FA 4LJ8A 2A5JA 1G3RA 1XF9A 1MO6A 4FMCB 4WZAE 1IM2A 1NY5A 4PANA 1GKIA 2H92A 1XMJA 5JLJA 4JKIA 2FMXA 3KFXA 1NIPA 3B85A 4P0TA 2OCAA 2OHFA 4AKHA 1ZNYA 4KVGA 3WMFA 1XJ0A 2QE7D 1HT1E 5A5GA 1G21E 2VIIA 4TMXA 2JDID 1AZSC 5DI3A 3KUDA 4MQBA 2YZ2A 3NEYA 3GLHB 3K09A 1GL6A 2N42A 5CDFE 2PLFA 4Q9JA 1Z6GA 5J4YA 2F43A 2D62A 4Q19A 1F2TA 1OFIA 1T8TA 4UNSA 1KGDA 2YNMA 2P6UA 1ZM3A 1NMYA 3TH5A 2ATVA 5E3HA 1XMVA 3SJZA 4YMVA 1GG2A 1Q20A 2BMEA 3TKLA 1CJMA 1TQ6A 5EP3A 2NQ2C 3LFUA 3JZMA 3GJ4A 2DCUA 5GJCA 5DYGA 4TLCA 4TL6A 4B3FX 1QG2A 4I1UA 3TR0A 1ZD8A 1H8HA 1ZU5A 4LJ7A 3CR8A 4B76A 4CT4B 4OHYA 1AQUA 3ZS9A 3AKEA 4Q1FA 4HUQA 1E2JA 4BZXA 3L0PA 3VR2A 4IXNA 4NP6A 2IYRA 5L3SA 1F48A 3KJEA 3TSWA 2D2EA 4URZR 2XB4A 3BH0A 1M8PA 3SYKA 1XEWY 4L15A 5FPTA 1EWQA 3KFVA 1IY2A 1VTKA 4KYIB 1YR9A 2X2FA 3T5GA 2YV5A 1UBEA 3VAAA 1NBMD 1ZC3A 2FE4A 1A7JA 3SU8A 1TEXA 3EIQA 4YDSA 2W0MA 1OT3A 2F9LA 2O8BB 4A0HA 4M8NE 1ZCBA 2VQSA 4EKDA 3FKSD 3OFNA 2BMJA 4JBYA 3K0CC 4QGGA 2XTNA 4G5OA 3UPUA 2QUZA 3VX4A 1ZC4A 3WRXC 1Z47A 3H4MA 2V4ZA 1DO2A 3SQWA 1D2EA 1K5GA 5E7IA 4A2WA 1T6NA 3B9QA 2EYQA 4IJMA 5EE1A 3CIOA 5G53C 2WICA 4XSHA 4RZUA 4KFSA 1ZUHA 1W36B 2D4HA 1NLZA 1SGWA 3ASZA 3DMNA 4LJ6A 3PITA 5K8IA 5GADl 1XXHE 2GA8A 5AWFC 3A58B 1AKYA 1E2PA 2KI5A 4LOAA 2HCJB 1K6MA 1E2QA 1GSIA 1KZ7B 1Z08A 2YC2C 3FKQA 3NKVA 4RCYA 3D6TB 2ZU0C 4EFMA 2GILA 2QP3A 4A8JA 2ZRCA 4PC6A 4NZYA 4Q1CA 1S8FA 3IO3A 4M9ZA 4Q7KA 4V0MA 1PZNA 3GLIA 2AX4A 2J87A 2ZAMA 2WWFA 1ZBDA 4QNMA 3WYGA 4JLOA 1X8JA 1UPTA 2X2EA 3OESA 3P32A 2ZANA 3ZJYA 4ZDWA 2CL0X 1HEIA 2GESA 3CKLA 5KPDA 1LNZA 2FSIA 4KLZA 3GLFA 4IHQA 2SHKA 2JJ1D 2F6RA 1SHZA 1XXHB 3SS8A 2GRJA 4F4CA 3AVQA 2XNDA 4RZ2A 4UNNA 1KDPA 1KY3A 2IK8A 3A37A 1QVAA 2V55B 2C95A 1P9NA 5JI3E 1JBKA 1ZUNB 4LK2A 4IW3B 4WZBE 2UKDA 1G7RA 3SE0A 4EPRA 3QEJA 1T9HA 1Z0KA 1KK1A 1HQYE 1KTVA 4NONA 2J9RA 1ZNXA 4JLBA 3NHAA 4PQYA 3RYTC 3K70D 4ZKDA 1KSHA 4TYNA 2C99A 2YOHA 2Z0MA 1G8YA 5AK0A 4NTZA 5FPSA 1CR4A 1E1RA 4ZDIA 5FTNA 5K8TA 2J46A 2YYZA 3M0EA 5EUMA 1TU4A 4QBIA 2RGNC 3B1XA 2H5EA 4B74A 1RFLA 4C2TA 3THWA 3QI2A 3A36A 4P4UA 1ZVQA 3RHFA 2CVHA 1XPUA 3AB3A 1II8B 2DR3A 1Z63A 2O52A 5C4GB 3DM9B 4TL9A 4AYWA 1JB1A 2OBMA 3T1TA 4D2IA 2RKOA 2IYVA 3GJ3A 4HLCA 5CM9C 4BRUA 4DLZA 4QGFA 1FUUA 2B7BA 4KCGA 4D81A 3AF4A 2OEPA 2XSZD 3BAFA 1TX4B 4EFLA 4QC2A 1Q44A 3UKDA 2Z83A 3VNUA 1N6KA 2WZQA 3RS0A 1YZKA 4HUTA 2IYZA 5G41A 1LTQA 3BIFA 5FBVB 3GPLA 3IBYA 4MYUA 1NG9A 2FPMA 1CXZA 2ATXA 3RS7A 1W4CA 3TJZA 1KOFA 4UNPA 2QP9X 3I5YA 2YJTD 2J0QA 2GJAA 4IVPA 3K70B 4FIDA 3DHWC 3FB4A 1TU3A 5HCIA 2WM9B 2ZRFA 2RB4A 3MLEA 1YR7A 1BH2A 4M1YA 2GXAA 4EAQA 3MD0A 4PPQA 4U7DA 1KJZA 4PO9A 4PXAA 4URVR 4B34A 4UNQA 2YOFA 5IDVA 4DCNA 2PMDA 2XJ9A 4OQXA 1Q1QA 3IEVA 1W1WA 3PUZA 1OFUX 4Y0VA 4DVGA 2ZSEA 1S9DA 5EE5B 2BMFA 4JYCA 2QTFA 3BFXA 3KL4A 1I4LD 4OQFA 3GLFB 2R9VA 4PSKA 2QMUA 1BOFA 3A1VA 2F3RA 3QY0A 3VR4A 2O8BA 4A6PA 3ND8A 3DEFA 4NCHA 4UXHA 2JGNA 2V6IA 3B78A 2J0SA 3TVTA 1W0KD 5D3MB 1VG8A 1E79A 3AEZA 4C0JA 1KYIA 2OM2A 1QHHA 3NVAA 3T12A 5KNCA 1W36C 1Z0IA 2WAXA 3GEHA 3NBXX 3LRPA 1PLKA 1UM8A 2VHCA 3CUEF 1YZTA 3CBQA 3BOSA 3E1SA 5D3MA 5JFGA 3AVPA 8OHMA 1R5NA 2WWGA 3KX2A 4ZDJA 3ZH9B 1V43A 1HYQA 2GJKA 2O8FA 3UG6A 3MUFA 5H68A 3U3JA 2Q3MA 2OBNA 3UWKA 4OI0A 2YOGA 4C4PA 2ZJAA 2Q0HA 4C2UA 2A5GA 3H86A 1YR8A 4J0QA 2Z4SA 3EIHA 4B2LA 1X1SA 1SXJE 1IHUA 1NIJA 4TSFD 4DDTA 2IS2A 5DGXA 1QVRA 1SXJB 1XTIA 3EWAA 3AVUA 3ZD6A 1CBUA 1LF0A 1XEFA 4HAVA 4N1AA 3QXSA 1TPZA 1VIAA 3NH9A 1XTQA 4ARZA 4TQAA 1VHLA 3B9PA 4Q4HB 2O8EB 4Q1EA 3Q72A 4MUBA 2CL7X 4OKSA 5FTMA 4E07A 2QAGC 3NBZC 1MH1A 3EW9A 1XXHA 1F6BA 2H16A 3NBFA 4B75A 1CIPA 2MMGA 3FTQA 3NG1A 3OAAD 3AVYA 2UZ3A 4G5QA 4HAUA 2G0NA 2C04A 3N5CA 121PA 3CF2A 3KKNA 2WKQA 1X86B 4ASUD 3GJ8A 3NXSA 4BRWA 2ZSAA 4KFTA 4B3XA 3UK6A 2VPPA 1Z28A 2CJWB 3HYTA 1MO3A 4NYIR 2D2FA 1P2SA 1EXMA 2R6DA 3QPVA 2R44A 5CK5A 4B47A 2EFCB 2QRNA 4B6EA 2GTPA 4BFUA 621PA 2F1HA 4G3XA 1DADA 3THXA 1E9BA 1SXJD 4BFTA 4MRSA 4M1KA 1SVLA 1FUKA 2IWRA 2RHMA 1EFTA 2VP2A 4M2LA 1KJYA 3B1YA 3L8YA 2ZXUA 3CM0A 4JBWA 1US8A 4KSCA 1E2KA 2ZRGA 1GM5A 4LBVA 1P7CA 2AD1A 4MYTA 1SXJC 2JIZD 4FINA 1SKQA 1A82A 2IYQA 2REOA 1ZD9A 5C46F 5FOTA 2HUPA 1Z0FA 2WAYA 4A0RA 4MDFA 3MJRA 3H1TA 3D7MA 4US2R 3TRFA 3B13B 4LHZA 4FD2A 5BN5A 3ADBA 1TEVA 2FU5C 4C3ZA 4WZ6A 2FN4A 2VRWA 4MKIA 1G17A 1HH4A 1N25A 3NC1C 4JS0A 1E2GA 2R65A 3LXXA 4XVQA 3QKSB 1U98A 2FV8A 2DY1A 2ZE8A 3TE6A 5J4VA 1RYFA 2BBOA 1TADA 2GJ9A 1Y63A 2ODEA 2QA5A 3OIVA 1UBFA 4R7ZA 3SYLA 2WVJA 5L3SB 2P0EA 2IYLD 3IIKA 2X19A 1RRFA 1OHHD 3WBJA 5AJZA 2EFGA 4RY2A 3U7EB 1NVUQ 3W34A 2ZREA 2QMOA 2FOLA 2WJIA 1PVOA 3KTAB 1CEEA 1F3OA 5IHPA 1GNRA 1BS1A 4OJKA 1OSNA 2RCNA 2ZRNA 5LPNA 5ANRB 4D26A 3FVQA 3PXGA 3RLFA 1DEKA 4MRRA 2ZVQX 3I8XA 3ZVLA 1FFHA 2GXUA 2CHGA 3KTAA 4US0R 2GCOB 4XD7A 1G41A 1GILA 3DMDA 3FHOA 1QHHB 3EC1A 821PA 1H8EA 1A5TA 1ODFA 1SVMA 4II7A 4D6PA 2PX3A 3GP8A 3QKRA 4MYHA 4NE2A 3THYB 1IJFA 4DT1A 1WA5A 4D4KA 2H8KA 4TMZA 3RRZA 5B30A 4PR0A 2C77A 1WRBA 3ZZ0A 4MRPA 3T1OA 1NN5A 1JALA 1NVVQ 1TF2A 4F38A 3WBKA 4C0SA 3KXKA 3AP3A 3C15C 1N6PA 3TUJC 4D0GA 1A2BA 3EC2A 3C8UA 4G5RA 4Q7MB 3CLVA 1MV5A 1BMFD 3C4JA 1XX6A 4DSOA 3MWLA 2CLDX 3ETLA 2IUUA 1RVDA 3QSYA 1CRQA 4RD3A 2IYTA 3K0FB 1YHNA 4NCIA 1GRRA 4BE7B 5EP2A 2EFEB 3GLHE 3KQLA 2ANCA 2JJ8A 1E9EA 2AXPA 1Z0DA 1VG0B 4M0LA 4V0ME 2PT5A 1FW6A 5DLQC 3WMEA 2JLWA 4JL5A 4PAMA 5DIFA 5C4MA 5FOSA 3KQUA 4OK5A 4QL3A 2AKYA 1J8MF 1N6OA 2PJZA 4POAA 2GKSA 3LA6A 3TQFA 1X3SA 3TSZA 4B33A 5IF9A 1LS1A 1ELOA 2P67A 1EWRA 4M9XA 5DH9A 3T34A 1MABA 2VHTA 2H57A 4LC0A 1JQJC 4B32A 2ZRLA 1Q12A 5K8UA 3BC1A 2GCNA 2IS4A 3OEED 5FOUA 2XOKD 1KK3A 3IPYA 2R6GA 3S1AA 1KNQA 5F9HA 4P32A 4DEXA 1IONA 1EESA 2ZJ5A 4YXWA 2V3CC 4FCWA 5AJWA 5KYKA 2QZ4A 1DARA 1AZTA 2E9SA 2KE5A 1R4AA 4FMDB 4V0NA 2AXNA 3T15A 4PPGA 3A8TA 5L8VA 2YWHA 4XTCS 5FUWA 3R9WA 4KJZA 4RFVA 3WYFA 2CE7A 4URYR 2LKCA 2O8CA 1UDWA 1GAJA 2NTYC 3GLGB 1ANKA 4AG5A 2BBSA 1CULC 3B60A 2JATA 3LQQA 4UJ5A 1WCV1 2QT0A 4R71A 4A8JB 3K53A 3RSOA 1Z22A 2JEOA 2VO1A 2V7QA 3DOFA 3A6PC 3L82B 3OFND 4V02A 1ZM4A 2XB2A 2P2LA 1E2NA 2NZ8A 1U9IC 4N0EA 2QY9A 3VR1A 1RRCA 5HZHA 2VLIA 4YMUA 1RKBA 2IYUA 3HR8A 2EWWA 1KO1A 3H84A 1JPNA 4S35A 4GMDA 1YRBA 1QHIA 4WA7A 3VHXA 4FXPA 4TYWA 3RRMA 1W2HA 2UZIR 2PCJA 2A30A 4EPWA 3PJRA 3JVUA 4PAQA 4WIAA 4ESVA 2OUKA 1W0JD 2BKEA 1Q3HA 2GHIA 3LQRA 2HJVA 2GETA 2V1UA 4LPKA 3TAHA 1OFTA 1JXMA 1YZGA 3SC3A 1VG9B 5TMPA 1KO8A 4O2LA 4IKEA 4HAYA 1OKKA 3OE7A 2C78A 3B1ZA 2HYIC 1UEJA 3CRMA 2ODBA 4BLOA 1A4RA 1IBRA 4IOMA 3U6BA 4I4LA 4Q21A 4HAWA 3U5ZB 1SHKA 4V0KA 5FBWB 3QKUA 5FBLB 1J90A 1VIYA 3E5HA 2ZS9A 1ZINA 2OBLA 1P2TA 2FPLA 4DB4A 1E2MA 4Z8YA 2XOKA 1GFIA 2GZDA 3HP1A 2D74A 4M1SA 1RRPA 2YC4C 3CRRA 4MGKR 5DHAA
chains in the Genus database with same CATH superfamily
3DGEC 3M4JA 2XWQA 1UXKA 4GEKA 4KJXA 4RLSA 3ZU4A 4PE5B 1NZJA 2G28A 3I6IA 2RGBA 2JB9A 3EASA 3P9KA 4OGKA 5DN6A 3WGYA 2C7OA 2HRRA 2PO5A 2HMYB 1STOA 5JMPA 1TZBA 3UXHA 3L46A 4W9MC 1LWNA 4BP9A 2IGTA 1JU3A 1OFGA 2VHYA 4ZZ2A 3OHMA 2E55A 2HSWA 2Z3WA 2NXNA 1U8XX 3K9QO 4CM8B 3P52A 3CLTC 1E9SA 4IINA 4NARA 4NU0A 3F1LA 4X92A 2PUGA 2GZHA 4TWRA 5KKNB 3LM8A 3M6LA 4OJMX 3C3WA 2B0JA 5FPYA 1ZFNA 5A6SA 1WUYA 1O0SA 1KR2A 3BXEA 4NK5A 2OM6A 4GZMA 3RR2A 1FL9A 1XCPA 2OPHA 4DIUA 2O8DB 1PUIA 3H1AA 2C7BA 2QTHA 3NJ8A 3OLWA 4GMFA 3R9KA 4EJSB 5HQTA 1KGSA 3KT0A 1AM4D 1LW7A 2L82A 1Y3HA 2ZWMA 3IP3A 5ENVA 1E63A 4YP9A 5BUZA 2GM4A 5IBQA 2I78A 4DQUA 5KTKA 4NESA 1T8WA 2QX4A 1U3FA 4MKRA 1VMDA 2EC5A 2W58A 3A10A 4RNDB 4MVJP 9ATCA 1E7QA 1VYUA 4HXYA 3Q7PA 2XVZA 1I3LA 4X8MA 2ALJA 4E1BA 4WCFC 2YHUA 1WXHA 3S2GA 2ZT8A 3D1LA 4P33A 3RYHB 1O57A 3CSUA 4YPFA 5H02A 4WMLA 3UCEA 2NVUA 3UOWA 4AJHA 1PEAA 5LU9A 4GBMA 1DRUA 4D82A 1ZK4A 1CUCA 1DTEA 4RADA 3JWPA 4OQDA 2KBEA 4FFBB 1IVNA 3KTDA 3OZWA 1XRJA 1JEQA 4L5JA 4MDHA 2JLBA 3EY9A 5IUNC 5K8CA 3R77A 5IVKA 1NF2A 1K08A 4N03A 2HEIA 1JAHA 3BMCA 5F2KA 5HMMA 2ZZKA 4JAVC 1TT5B 3D31A 4WN9B 2B8TA 5M04A 1D3AA 2CT8A 1FP4A 1MGPA 1EHIA 1W44A 3BIWA 1V2HE 1IIRA 2GN8A 1C14A 3GJ6A 1E0SA 4ZO9A 3X2FA 3BK7A 5B6PA 3KELA 5BWMA 5KYVA 3O31A 5HUQA 1P2BA 4XVHA 3U3ZA 3LPLA 5TC4A 2G08A 4BFVA 2HNAA 4CCSA 1YC2A 4LCBA 1KI7A 2XCUA 4AVYA 4DRXB 3AEQA 3X1ZA 3THXB 2CHVA 1PNTA 3RS5A 2NACA 2F00A 3RC7A 1P2DA 4Q4JA 4CUZA 3EQ2A 4PAGA 4EMSA 1N7GA 3VR4H 2PMKA 3IFSA 3JD0A 1Y5MA 3KALA 3GAFA 1QX3A 3PR2B 1T5LA 2IUEA 3KZVA 1ES9A 2D1YA 2WYUA 4M46A 4TLLB 5A4FS 4NF2A 1A9XA 1F9AA 1K8RA 1XRNA 1I1HA 2C2HA 1S2MA 2ERYA 3C45A 3M2TA 3I2IA 3O9MA 3V6LA 4ARAA 4DIKA 3AVTA 4DCTA 2A6PA 3V4FA 3KB2A 2R8ZA 4UVHA 2IHKA 1CQJA 5CIQA 5F1OA 3IO5A 1XMIA 1JLKA 1KI3A 2MSCB 2X3YA 3PLRA 1CY4A 4RLQA 3WVNA 1ZXXA 4YTEA 2HMSA 1MRZA 2PD3A 2UVPA 3H7IA 4I6EA 5C5IA 1KOGA 1Q0ZA 1R50A 1VCNA 2EV9A 4WHMA 5KOYA 5K3DA 1AMNA 3TF5A 1ZGJA 2Y3IA 2A9OA 1WUJS 3EAGA 4LBYA 1LK7A 3KTOA 3RUIA 3LQ2A 3Q9NA 1HZZA 4DIBA 2G1AA 3P5SA 4K0KB 5FOXA 3F6CA 3U3RA 4A2CA 2ZI6A 2B36A 3NTOA 4Q0MA 2H5JA 1G6HA 1UAGA 2W2KB 4RJJA 4P4LA 1OTXA 4RA6A 4AJIA 4D0LB 3KKEA 3A9UA 1HT0A 2K2WA 3GZTB 2M2IA 2OORA 1KK0A 1MA3A 2A84A 3DEZA 1OXXK 3DBRB 3HHEA 1E1LA 2AN1A 3SDBA 1HFEL 1ULSA 3ZHBA 2V0GA 3QU4A 1D04A 1WKCA 1CUDA 2F17A 2HCRA 3WGTA 5HZGA 3N7AA 3R0JA 4RA6B 1NVVR 4IDQA 2JA2A 4MTCA 3REGA 4S3MA 2FNAA 2NVBA 5FI1B 4B6RA 1SCNE 2VPZA 1ZOOA 4Z8XA 5DHTA 5REQA 2X8LA 1N78A 2ZROA 3IHWA 2V8OA 4A9AA 2O3JA 3GFOA 4C6SA 4D02A 4XUCA 2JA1A 2WIJA 1DO8A 1V9LA 1XEXA 1U81A 3VMFA 4XH9B 3P9CA 1HGXA 1KSGA 5CPFA 2GN4A 3F4BA 4ASUA 3FDJA 5LP1A 4WCVA 1N8TA 1ZH0A 2FR0A 2BN4A 4P31A 3W7BA 4LVOA 3HGTA 1KBOA 3L2OB 4E2YA 3CF0A 3W7VA 1N0IA 3RC3A 3QLVA 1I5OA 3ICVA 4I9NA 1ECGA 2ZJOA 5I7UA 3TPFA 4A6EA 2FGJA 3K0SA 1YA6A 4LZOA 2FCAA 3L4BA 3TKAA 1SIUA 3WLPA 1NSFA 4OHWA 5IAGA 3RKSA 4NBVA 4UU8A 3QE3A 4FHZA 2IC5A 3UW1A 1PVDA 3EPLA 1H8ED 4CDNA 1IY0A 4IUBS 5IEJA 2GRAA 3D3WB 2JIBA 3DOEA 5JJCA 1UK9A 4F3TA 4F4UA 3EGXB 2HK7A 5GWXA 5BURA 4IIFA 1LLDA 1CUIA 4MARA 1EFHA 1CUHA 1SBYA 2BAGA 1PZMA 3AEQB 2QLFA 5DISB 1IBSA 4AC9A 3LPAA 4MPDA 5C3MA 1ZXLA 5AI6A 4MVJD 2XNHA 4RVUA 3ILYA 3RFXA 1I30A 2OCXA 2YNMC 4IPTA 4RKFA 1OUMA 3A9CA 2E4UA 3HNPA 5AKHA 2KWIA 3R8XA 1E20A 4II2A 1OE0A 4RGYA 1NXXA 2DLNA 1N7HA 3SBEA 4HH4A 1VJGA 4ERNA 4ZICA 1C9EA 2QNRA 3DD5A 1DPFA 3WL8A 4NH0A 2PLRA 5D5QA 4D3SA 4C0HA 4AYXA 1KERA 2JGFA 5AW6A 4C0WA 1WXDA 3K20A 1M6EX 3I42A 2D7JA 5AKLA 1CP2A 1ZXBA 2P2ZA 1E3DA 3DJFA 5E2BA 3QKWA 5I7SA 1BVUA 3SY8A 4A73A 1Z18A 1SBNE 5BNIA 4UBJA 2XT6A 4XQGA 3SHWA 3G8BA 2HNKA 4JR0A 3MC1A 4ZO7A 4EUSA 3N2GB 2YXLA 1L4HA 1ZD5A 2BZGA 3IXLA 2XQGA 3O2SB 3W78A 4ZN6A 5AVJA 2OTCA 3OQVA 3AR3A 1L7MA 3A9VA 1YQXA 2WF6A 2ZYGA 4J90A 4CM1A 4ZYTA 2GAJA 3W6OA 1KWKA 2B9VA 3ZJTA 5DN6D 5KHLB 1O87A 3U44B 1U4NA 2PH5A 3MCAA 5CNKA 2A1IA 4YAIA 1DUSA 2P2YA 4ZCIA 1XD9A 1U2DC 3C5CA 2OKCA 1N0WA 2OQIA 4QBFA 2W6QA 1E2HA 3D4PA 4MO2A 4BNWA 3JQDA 1MEEA 4GIBA 2VYFA 4Q93A 4UDYX 5CT5A 4L4SA 3U4IA 4YRTA 3BCSA 3G49A 3I30X 3PQ5A 1X0VA 4QJ5A 4RV9A 5B3JC 3V7WA 1M6HA 4KBGA 5BXQC 2PLNA 2Y1OA 4EEXA 4YYEA 1OXTA 1C7EA 1CDDA 2YN0A 4QDJA 4QFCA 2XTZA 4L9WA 5CW2A 3UV7A 1L7VC 2HI0A 5AVVA 3EZNA 4M1ZA 3MFQA 4MVCA 5THKA 4Y0AA 1M74A 2P8SA 4KN9S 4GDFA 3RNOA 1M0WA 2IYFA 3BGSA 1ZSYA 3L7BA 5T3YA 4YO8A 3TGPA 1GGNA 5TJ9A 1SZPA 5JC1A 4ON9A 1ZK3A 3TQCA 3Q6IA 4F92B 2WU0A 4G01B 1E5DA 4CKWA 2FXVA 5EZ5A 1QHXA 5AVRA 3W6NA 4QD3A 1BWRA 2H4HA 3EK2A 3FNRA 1OU0A 2CUNA 2OCPA 1NHGA 4IJVA 2NUAB 1VKHA 2IDMA 2HF7A 2QNIA 1IQPA 1BXGA 1DQZA 1RBZA 1UZUA 2VYNA 3KJHA 4IXMA 3TXYA 1HE1C 2J0VA 3ZG6A 3ER8A 1K7YA 2JAXA 4ERXA 4R2IA 5K0JA 1OFUA 1LNSA 3HU1A 4NV0A 3ZHUA 3OG9A 4UD6A 4DIFA 4DLXA 4ZI3A 4C3UA 1MNAA 2CXRA 3C1UA 4Q03A 4N82A 5BT8A 1YMUA 1OVGA 2IIQA 2PH3A 4IJUA 3TRJA 3PWKA 2XB8A 3IL2A 2JBHA 1E4EA 3RRNA 3V9AA 1T9BA 1VBMA 2W2OA 3NV9A 1RRMA 4QHYA 4AF8A 3VAYA 1WHTA 4BV2A 3AUYA 4FXOA 2FWAA 2OAQ1 3LXUX 3QXHA 4TTQA 5DIZA 5FIUA 3OSZA 3SOPA 3KWMA 3PE4A 4X7RA 4ZQCB 1ODCA 2CXOA 2PFGA 3GLTA 3W4IA 2F55A 3ESQA 4X6XA 1OD6A 3PGXA 3UCFA 2PWYA 4O2BA 4QDUA 4NNOA 1U3TA 1ARZA 1HDZA 2YKGA 3CU5A 5EG5A 3SJCA 4XLZA 1U94A 2P91A 3GFBA 3QQ5A 4H6VA 4J6EA 2HXSA 4JLVA 5KAMA 4D44A 4NAHA 2Q1SA 4MJ3A 4S1PA 2JC3A 2PJDA 3OQNA 1Z2NX 1P5JA 2J6CA 2X5OA 3KDSE 3N5KA 2QT9A 4FW9A 4E2ZA 4GKVA 5AW0A 2I1QA 1H6DA 2GHRA 1Y89A 4Q66C 2PR7A 1XTKA 1ZMOA 2IY8A 2YZNA 4Q01A 2IVZA 1Q1ZA 4R5MA 5JBIA 2CBGA 4C0XA 1LFAA 2I8AA 4I9HA 4R8VA 3CW8X 5D1NA 5D87A 1DC8A 4OA5A 5L53A 3OM1A 1LX6A 2FEMA 2Q2NA 3BDIA 1ADJA 5M7EA 3MHTA 5H3LA 3DDNA 4KMSA 2WWVD 1C9DB 2FA9A 3DOIA 3EPPA 4L50A 1QBKC 1P81A 3DF9A 1CR0A 3FX2A 3R6LA 3HS3A 1HMYA 3U61B 3ZDCA 3JV7A 5C8YA 1N3BA 3G85A 3VH3A 3DZHA 4BS9A 2DWOA 4RL6A 3UJ7A 1GRVA 3NOOA 3FY4A 3UUGA 3VH4A 1M34E 1Q1BA 2V6GA 2NQTA 4LC9A 2FPXA 3QX8A 4PX9A 4EYGA 1S96A 3HPRA 4P4SA 5FV7A 5FI3A 5LZ7A 3EEFA 4BUCA 4N47A 5H9WA 3QX3A 3OZAA 3GLFE 2QUJA 1P1RA 1Z0JA 5BYBA 2PX0A 5AUPB 1W2WB 5JNUA 3M1LA 1GRNA 3L0YA 5DTQA 4AZ3B 4QJBA 3RUDA 2QD3A 7REQA 2NO1A 1XZDA 2VKTA 2C1ZA 1NXQA 3LT1A 2CWDA 3C7TA 2QQGA 3F6BX 4CMJA 4RQBA 4ZYUA 2EF1A 1LDBA 4NJEB 3A2LA 3DQPA 4YRKA 2H63A 4KYTA 5FQNA 3FRJA 4FQ8A 4MVJI 4HRXA 2WIFA 3QE4A 4Q18A 1N5LA 1W8DA 3PQDA 4C5CA 5IANA 4X62B 2IA5A 2ZBQA 4LQLA 3QEBZ 3CLHA 3LF1A 4R69A 2FPWA 5K45A 4RV5A 5DGTA 3I5XA 6NULA 1E7YA 1CEYA 1BROA 3IQEA 1NFRA 1FEZA 3N2IA 4L8YA 3GRPA 1SVNA 3ZWWA 2Z2YA 1NN0A 4IO0A 3UAVA 1B7GO 4QGHA 2A5DA 1A9PA 3ZDEA 4ZVNA 1QFMA 5EJ5A 2OFOA 3DNFA 1ID1A 3NWJA 3OTIA 3AEKB 4Z5XA 5EXPA 3VNVA 1X7WB 3H2SA 1SU8A 4Q1AA 3ZC3A 3OZ7A 3L18A 2VDJA 4A6DA 4DADA 3NTLA 1W4LA 3FR8A 4GRAA 2PBZA 4AQDA 4DGQA 1TW3A 2MYTA 2RG1A 5MF6A 1TCUA 2IBMA 4KR7A 4L16A 2AR7A 2ORVA 1LPOA 3NM6B 3P0JA 4FPXA 3V8BA 1ZVVA 1A9TA 2YWCA 1NF3A 1YT5A 2ROQA 3SFZA 2IQ5A 6YASA 1GKYA 2J3JA 2FQXA 1Z9BA 2OR3A 3I6ZA 3K31A 3P9IA 4W99A 4JI7B 1W85B 2FFBA 2R4TA 1LPBB 3K9GA 1L5WA 1LF5A 3BH7A 5FBKA 4BVBA 1FJ2A 1KARA 4DYDA 1TJ4A 3AFNA 1NYTA 1YFKA 4MV0A 1PL6A 1N1GA 4WINA 2WFMA 3MT7A 1H9CA 1NVBA 4DM3A 4XSGA 4YP0A 5KJ6A 2IYXA 2AJ8A 1X9IA 4OI2A 3PJGA 5FPKA 4LBZA 2VEOA 2E6UX 3KXDA 4WXHA 1PQWA 3R24A 2ISCA 4ZODA 3OC6A 1DKNA 4MZDA 2CYAA 3MRSA 1FFWA 1T43A 2RGEA 1IHOA 4XSVA 4NE7A 5LIRA 2BR3A 1AGRA 4G5GA 1QYDA 4PSCA 2D6FA 3I62A 1JG6A 2BR4A 1SU7A 3E84A 4TSFA 3S2UA 5CVVA 2OSVA 2NUPB 3CWQA 4NZNA 3EX7C 2Q9AA 1ZUD1 2IEZA 2DUNA 4Q9AA 4ATNA 1MKYA 2GEKA 2RBEA 1GSAA 2QMEA 4I1VA 4F06A 2QPTA 4J76A 5BMOA 4RTKA 2JIZA 3NH6A 4UC0A 2AW5A 1OLUA 1R6AA 1ZWKA 2P65A 1HE8B 1M2JA 3I9MA 1P91A 4LDJA 2FUNB 2X42A 3JPWA 3RRBA 2VBIA 4B8ZA 1OYWA 1DCFA 3LLSA 1DWUA 5DCWA 1ZUIA 1YD7A 4YN3A 2NV2B 3P27A 1UMCB 1A96A 2CVZA 2OHGA 4IILA 3T7IA 5ITZA 5LMNB 4HWTA 4YCDA 3SZLA 1Y6RA 2GPJA 5TQVA 2YZ7A 3A2NA 1NWCA 5BP7A 3ZVMA 3AJ8A 3JR3A 3PDIA 3O75A 5J4KA 3LSYA 3E1KA 4YT2A 1RXVA 2WQ7A 5D5HA 1U1EA 4GF5A 1N6LA 4DY4A 1M10A 1VOTA 3D5TA 3F6EX 4KAJA 4UEQA 1H0SA 4UXJA 4ZO4A 3OFJA 1L8AA 2IHJA 4G5YA 2VJKA 5CDFA 4HGRA 1OOEA 1NUAA 3L04A 1RXUA 1DRVA 3EZ7A 5SY6A 3S81A 4YLEA 3V97A 2OGZA 4RZ3A 2XYRA 4R3NA 2XUAA 4POOA 5BR7A 1NDHA 1QFZA 1Z33A 1XDWA 2FX3A 2PZGA 2TS1A 3P2IA 4JK3A 4N9QA 5B7PA 1E2BA 2HXYA 3OA0A 1LBSA 3OOYA 4IJWA 2DWPA 4RZXA 3EUEA 2E82A 3GJZA 3M3PA 4KZPA 3WWOA 2CSXA 5ICFA 2Z08A 4WK2B 4ZAGA 3W7AA 1VYVA 1TT7A 4UNRA 2HT1A 3C6ZA 2HMWA 2QX6A 4Q4AA 3QOWA 1ORVA 3HCRA 4R98A 2HA5A 3EQ8A 1USGA 1LLQA 1EE2A 3GJSA 4L08A 2WB4A 2X9QA 4KQ9A 3NPAA 1YS1X 4O4JF 4S2UA 3OZXA 3V4OA 3TL2A 1V6CA 2OO7A 2JLXA 4FFVA 1RPTA 4QAJA 3T7CA 3WLJA 2QT1A 5CCEA 1K4YA 1LBTA 4PNEA 2XUZA 2BPOA 3FWHA 3OX1A 3QUTA 1EVIA 4EI7A 1T91A 5HGXA 4UVEA 1BH6A 1NN3A 2NYAA 1PIWA 3OT1B 4CE6A 5LYJB 4CEIA 4F46A 1RAFA 3DDZX 3S29A 1PVVA 3CURA 3G5LA 5IH3A 3CO0S 1VZ2A 3QPWA 2AL7A 4RPHA 3H5RA 5K2MA 3ZE2B 3OP4A 2JHGA 4IDHA 2HSGA 4KXUA 1QQ5A 3GEIA 1UFRA 4N7JA 4BLVA 1E2DA 3I52A 2XJ4A 3VPAA 2W2NA 2QXUA 5LQDA 2UYOA 1JSCA 3F6YA 3QTBA 1DJPA 3IHLA 3MK31 4H17A 3WGQA 1VECA 2K5UA 2PX4A 4WRRA 1GDDA 2H1LA 4E11A 3MT8A 2WKSA 4HD8A 1NDQA 3QP9A 4FX2A 4H35A 4IOKA 4LYYA 4CCWA 1ZCAA 1BVRA 3ZCUA 2CXPA 1XVLA 3IP9A 3UHPA 1PFVA 1I10A 3BWEA 3IPXA 4S0XA 4X94A 4Y2JA 4MVYA 4GOOD 3FUUA 3D6UA 3HG7A 3ETGA 1L7QA 2KJQA 3LH5A 1QXSA 3TBKA 3TXAA 4HWKA 4CFZA 5A0FA 5LP6B 2P68A 3ZKAA 2QENA 4IV0A 1SG9A 2P6NA 5CRIA 2HQSA 4JVOA 2YXPX 1XZNA 1SOVA 2DKNA 3AUTA 5ALWA 3ZDYB 1YZVA 4KO3S 1MAWA 3K9HA 2FFHA 3KXIA 1DAKA 4Q3DA 1E0AA 1JIJA 3R76A 2DXIA 3K30A 2RI1A 1Y80A 3QIVA 2ZRMA 3DC7A 1IRIA 3EOZA 1DDIA 3NFRA 1WY5A 2AQHA 3LHFA 2OECA 4NX2A 5AQ1A 2HSJA 2IFTA 3E23A 4LTDA 2HLPA 1HORA 4NEQA 4FWIB 4RGBA 1R37A 3MGGA 4WXRA 1GARA 1JDZA 1F9EA 1OZGA 4GLJA 4GYKA 2HT6A 1RADA 5BSWA 4YCBA 3RYFB 3QVMA 3VYSB 4E46A 1Z4JA 1VHJA 3LOPA 2XI4A 2BDTA 2Y9MB 3K0FA 3WLTA 4G1VA 3H42B 2VSFA 4LYDA 1RM4A 2VJDA 3T3HA 2Q1XA 1AQLA 2XF2A 4OQMA 4DWVA 4EQ6B 3RIMA 1GG8A 3PQ8A 3KG2A 1JA1A 1RJ9B 1TQ4A 2MOKA 1YJQA 5G0SA 1QIFA 3T6KA 1Y37A 2ZE6A 1ZGHA 2R8XA 3QOXA 1RCTE 4IVQA 4A92A 1I6MA 3N3BC 1VMAA 1PQPA 5DSXA 4EYKA 5HZMA 4YRCA 2O0HA 3T4PA 4OX9Y 1GKUB 2CHQA 4TMKA 2NNWB 3IUPA 4EG1A 3K72B 1G60A 1PR6A 1CERA 1IEVA 1GSOA 5EN4A 4EITA 1WF3A 2CXTA 2DBYA 2ORWA 4UATA 3D7RA 3I58A 4RIFA 3CUVA 3D4IA 1H65A 3EEQA 3G9XA 1QHYA 4I3FA 4RS3A 4QYIA 3SBDA 2G8NA 1FX0B 2GCPA 2XDQA 3KYJB 2Y8EA 3OKCA 3PX2A 4M1EA 1RAHA 3HXTA 4ML3A 4EI9A 2H0RA 3L6CA 5HTKA 3ZY5A 3R0IA 4JFRA 3PVZA 4ZU3A 3PD0A 4BX2A 1QHGA 2C5HA 1K88A 3N8DA 4D43A 3CEMA 4F4FA 1E3LA 2WIBA 4C01A 1L7AA 4MMZB 4D3DA 2DYKA 3I8SA 4PINA 3RVKA 1ZQ1A 3VSBA 4L75A 3AERA 1NV8A 1O94A 3U7RA 1ZIOA 2AQ8A 3EFOA 4HOYA 4Y2VA 5TS3A 5DXJA 1HG1A 2X6TA 5E7MA 3UAZA 1XMXA 2XPCA 3WP0A 4A0GA 4KR6A 1H2WA 1AS0A 4ZCLA 5IEBA 2ZBEA 3QE0A 4MGIR 3GGOA 3F98A 3TTSA 4F7DA 3JQAA 4LCJA 1T1IA 3ZHZA 5ECWA 4CIYA 3RHZA 4DR5B 4KKVA 5DTEA 1N34B 2OE2A 3DF7A 3F4KA 1NRIA 2TMGA 4RBNA 4BECA 5JBQA 5CT4A 4RX1A 4AF6A 5CUQA 3DW3X 4R8MA 3DLBA 1K6XA 2FLVA 2HFJA 4CHTA 4E13A 1YCFA 4YDQA 3SX2A 1EDOA 3FMPB 3G0HA 1Y48E 5D86A 1UDCA 2H2GA 1CNMA 3RVQA 5JSZA 3BHNA 2EF0A 4NMLA 1FRNA 3WK7A 2PQ6A 1U0LA 3JVIA 4TKZA 1M2OB 5FKJA 1CLEA 2I2DA 3MQFA 1BSVA 4GECA 3AF1A 1NDUA 2B8NA 5IKEA 4K40A 4HQ0A 3FNEA 3MWKA 4J49A 2QSJA 1MB2A 2ZRPA 4J1SA 4QPNA 3TTVA 2HV8A 4YPOA 3H0KA 2FWIA 3AU9A 1HWYA 1NBIA 1ORRA 4JQSA 1NR7A 2ZJ8A 3D6NB 3LO5A 3LVQE 4FR2A 2WJ6A 5F5LA 1JA0A 3RTGA 3GL9A 3UHAA 5AW5A 3CEAA 1EUZA 4L6CA 4RPIA 2O7RA 4XFDA 2ETXA 3C1TA 2GN9A 4EL5A 1I51A 2CUZA 3N2GA 4ENRA 2X0NA 2W6JA 4W5HA 3KQYA 3VTZA 1M1ZA 3ZWVA 1I2BA 5C1BA 4US1R 2AHRA 4O3FA 4QPZA 1NBMA 3NHWA 3LYHA 1RJ9A 5BW6B 3RC1A 3REQB 2CB0A 2Q5LA 4QWMA 3ZD8A 2J67A 3GX1A 1L5OA 1NLYA 4OUKX 5L3ZA 2FPKA 3ABZA 3FZGA 4D9MA 1A4UA 4Q4HA 3HE3A 5EZQA 4OQYA 1QGUA 1IXRC 1A95A 1ZP6A 2Q6TA 2XCTB 1QHFA 2DSNA 5I7FA 2H1FA 3DBIA 2PX2A 3B20A 1BJKA 1J0BA 5TQJA 2I7CA 2AFHE 2WD8A 1PWEA 1V8ZA 4TTPA 1QKKA 1X13A 1ODTC 1E77A 1TUBA 2GLTA 1SY7A 2P27A 3GI1A 3I72A 4LJAA 4XDYA 1ODKA 4ZANA 1W0CA 1IZ7A 2WA1A 1KORA 3MCTA 4KFRA 3SXUA 4CNQA 1Z82A 2Z2JA 1V26A 2N75A 2PT6A 2AFHA 3TX2A 1KZYC 1O94D 4CMIB 4YACA 2VL7A 1VHTA 2QG6A 3GUCA 5B1DA 1KMIY 3JATA 1P72A 5T4BA 1N9GB 4Y6LA 1WHSA 1RLUA 2D0DA 1F6WA 4I1PA 4JLWA 2X22A 4FHGA 1SCKA 3W6ZA 1EVLA 2CNLA 1V1JA 1J99A 1SBQA 2HZBA 3FFXA 4OHCA 1NBAA 1P1JA 2A5FA 4CG3A 2RGGA 4BO4A 2ZI4A 4EECA 4IIEA 5MDHA 2X8AA 1T1JA 2ZGVA 3DL0A 3WQSB 4CODB 3DB1A 3NTQA 4HB0A 4PBSA 3ROQA 3P0FA 1SVWA 4DMKA 3PUHA 1EBFA 5EPOA 3UHFA 3R6DA 2GCGA 4S12A 1G8MA 3O3MB 4MVJF 4OXNA 2R751 2P6RA 3Q11A 1QGYA 3Q9SA 3GUUA 3I9V6 2VHVA 3LHSA 5I9SA 1P73A 1DWPA 1H66A 3PLNA 4DY6A 1KFKB 3DDCA 4KQJA 3HKBB 2XBLA 3OPYA 1V3QE 4B82A 1PW7A 3NYQA 1RE0A 2IHUA 3NWPA 1NYQA 4YJFB 4MQ6A 4ZJPA 3X1KA 2LXNA 4CTJA 1QU2A 4R41A 4FKBA 1NW5A 2HO4A 3R0VA 4J29A 2G3YA 1FU4A 2PN1A 3H5WA 1B8PA 5ALUA 4MJLA 4AK9A 5I7WA 1KAOA 2QQ5A 4GP7A 3PWSA 1ZDMA 1CNEA 3HUFA 2QMHA 3MERA 5EJGA 4C20A 4E0BA 3RGWS 4A2QA 1S2DA 3LXRA 4FU0A 3N0TA 3Q3HA 2JANA 1J5EB 1AGYA 4UOZA 3LRXA 1Z36A 4BFYA 1ZIXA 2M6LA 1X9GA 2NG1A 1CTQA 2YV2A 3IEKA 1UP7A 1E7SA 3EUWA 1H94A 2CUKA 3OICA 4QUIA 4XX0A 1WUTA 3QVLA 3X43A 2VRCD 5BV7A 3EG9B 5JNWA 3R4CA 3I8OA 4C1NA 3IAM6 4CLRA 2VJNA 4UTZA 2H0QA 5HFAA 1G1MA 1XOIA 4JELA 3RREA 4CFSA 5HZKA 5BSUA 2HHCA 4EGAA 1JECA 2BELA 3AIOA 1JZQA 2XLCA 3ETCA 2XNJA 3Q85A 3EDQA 2QQ0A 5DK4A 2IU0A 3NAGA 3VR6A 5CDGA 4WGFA 2I66A 3RSLA 4EGCB 3NT2A 2CV2A 1IAVA 1XGKA 4EPYA 2QRJA 4JASB 4UM5A 2R84A 4FI3F 2QD5A 4RTOA 4TKUA 5IFKA 5JQGB 2ZRDA 1UQTA 3VDRA 1X77A 4GNRA 1QZTA 3MTEA 4N49A 1W93A 4GMGA 4Z1OA 3HJNA 4EJSC 3BBPA 5EJ8A 5JI2E 2FH5B 1E66A 1HY3A 3EVGA 1J20A 1JRLA 1L7EA 2NN3C 3LDHA 3R3ZA 2VA9A 1I1QB 2H65A 2JAQA 4G8DA 4BN4A 4G4IA 3GNQA 4LXUA 4WERA 2AIRA 2O2ZA 2V5AA 3ZHQA 2V0NA 2JI4A 2RD2A 3OHSX 5CEFA 2CBZA 1QQBA 5JW6A 3S5UA 1E9CA 1M6VB 3WNZA 2C7GA 1EX6A 4RZQA 5CCDA 1M6YA 3WAJA 4PSDA 5CJPA 2AGVA 3AL3A 4AKIA 3R7SA 3S68A 2WAOA 1USWA 3I73A 1MAVA 2OO5A 4EY4A 3V32A 5AD1A 3QTTA 4AD8A 4EO4A 3MTQA 2H1SA 4Q3CA 3S0JA 3K94A 2BRUA 1Y34E 3TWOA 1REQB 2RHOA 4YRJA 4OTZA 4XDGA 5T5QA 3B7PA 3VYWA 3V4PB 1AN9A 2JLAA 3T3GA 3JS5A 3N6VA 1RQNA 3QOYA 5K6TA 4ALJA 5BN1A 1C4OA 4OMCA 2CFTA 2OOSA 3N8GA 4HFJA 5JFOA 3ONFA 1LRKA 4OOEA 4PAOA 5LZ4A 1R9JA 1DO0A 3Q0EA 1Z7BA 2QWXA 4RPLA 1IXSB 3BB1A 4IIBA 4FDVA 1I4DD 3L43A 2XDYA 4LRTB 3K9CA 3PI7A 5HM6A 2RHHA 3JRWA 1L8LA 4EKIA 4P4GA 3EF0A 3DV0B 4KIUA 1X87A 4KGVA 4HS9A 2QRHA 5F64A 5E9JA 1IEQA 3WNDA 4HQRA 4EATA 3AHCA 3CLSC 4UUBA 1M7HA 2VNJA 5TT0A 2FZWA 4QG3A 1SULA 5AJHA 1M1YE 2ZULA 4ZOAA 1KYYA 4LY6A 1EK6A 4KMMA 1G8AA 1EYZA 1IVSA 4ZEWA 5EZ6B 1Q7EA 4H7DA 3HVKA 3F7NA 4JGIA 4KQ2A 4Y9DA 5B2EA 4URFA 7YASA 4AW9A 3NGLA 5CLIA 3UMGA 5E6UB 3UCXA 5JROA 4FW8A 4ARCA 3D6VA 4M1TA 1P17A 4TYQA 2I4IA 2QIPA 1R4NB 1G6Q1 3NRBA 3JVDA 4DLVA 2WKPA 1XZCA 4B2PA 4BQFA 2DH6A 2HUNA 2VR1A 3BGWA 3DCIA 4EB0A 5M5BA 3NBQA 4YRRA 2O54A 3G2PA 3O21A 3BWMA 4PXSA 2QSZA 3HB7A 4M8KA 3MD9A 1XZQA 4IJ5A 2CNKA 3HCAA 4JEIA 4UVIA 1CR6A 4DL9A 5C7LO 4IMRA 3O8DA 4Q4CA 2P2NA 5DBOA 5D3KA 2VDPB 3IOBA 5HIMA 2DB3A 2BWJA 4L0QA 3PPWA 2WM2A 1EFRD 2R1VB 3N59A 4H1VA 5FT9A 4I99A 1YBVA 3L4EA 3MUEA 3QTLA 5AOVA 4EA8A 5FUMA 3EPKA 3DLPX 4JR1A 1DFIA 5KSPA 4LDRA 2CLKB 1EDBA 4EL0A 4JMPA 1K0UA 2J7PA 4RV4A 3CCCA 5HNKA 1YU9A 2W6IA 9LDBA 5BY2A 1MJGA 2ZTVA 3AHGA 5E2AA 1PR4A 5HF6A 4YQZA 4B7UA 3CVVA 4UTXA 2AEMA 2EG5A 3F2IA 4OGGA 4BKMA 3IELA 1J4AA 1S7GA 3TLBA 3AXTA 4W8HA 1IMJA 3GRYA 3ZV3A 3D6AA 2VQDA 1J1IA 2NUPA 3QBEA 5FFFA 5M3BA 5IT0A 4AYTA 2AFIB 2Q5CA 4X7MA 4CT5A 1VGRA 5B53A 2FW1A 3C7KA 3BTUA 4G0ZA 4ZHSA 3O4RA 3AV3A 4HX5A 4BFSA 1AMUA 1Z29A 4WV3A 1S2IA 3LGXA 1TKAA 2C92A 5F2EA 1H5NA 3A4YA 4F91B 3RAPR 4ZFNA 4B81A 4GLLA 3AVOA 3DR3A 3K2IA 1B76A 3G82C 1CS4C 3MM4A 4TTRA 1T36B 4QOSA 1I24A 2ZTLA 5KQMA 2Z6QA 4HDKB 2CJFA 4JP8A 1Q50A 3DT8A 4PG8A 3MSCA 3HFGA 5F23A 1ZY2A 2IZ0A 1JSZA 3D5QA 1NW9B 3R3VA 1WCIB 2JHAA 3WY9A 4BZZA 1V7CA 1JHAA 5C81A 2ZUCA 1H85A 2WP0A 4CQMD 2YWFA 5KJCA 1KVRA 1EK5A 2Y2UA 3OQBA 2V1XA 1JBEA 3PFKA 4ZAVA 3U4AA 1ETUA 3PQ3A 2GBPA 4HN4B 4HSEA 5ALMA 4LOIA 1MV8A 3EGCA 1IOZA 1QV9A 1VKJA 2YXBA 4WI1A 3UWOA 1SVSA 4IKPA 4R05A 4JJ7A 4E5YA 3ZZNA 5LXTB 2ZWVA 4IDEA 1Z6AA 1V8FA 4KREA 2WJGA 1PG2A 1G7CA 3ZY4A 5CJJA 4X71A 3H2GA 4LDPA 1X8LA 1WXXA 1UPXA 1FX0A 3DMTC 4JQZA 4BMYA 1DLIA 5ADWA 4W5WA 4K26A 2O06A 2XOXA 1E0JA 1JXQA 3QXJA 3FPHA 4QOJA 3CVUA 2PA0A 4MGYR 1XEXB 2FN8A 3LCCA 2O5CA 2OHHA 4N3AA 1GCAA 3Q8XB 1TAHA 4V0QA 4DOMA 1N5IA 2X4DA 3GEEA 4KIFA 5DF1A 5EE3A 2DG2A 3OOHA 1MFPA 4LSWA 1QTQA 3BFJA 3KSDO 4FNOA 1HNNA 3OIDA 2WUDA 1Z2CA 1QH8B 2OZLA 4HAZA 3E0XA 3GP5A 3GH3A 4MUYA 1YOVB 1ZM9A 1W75A 2BEJA 3V46A 4ME6A 4TQUS 3U7QB 5KMGA 3OETA 4XGKA 3AX6A 3KVVA 5JADA 1K7FB 3T5AA 3PXXA 5BNTA 4GOXA 3H8JA 3OZVA 1BKYA 1NJ1A 4IWNA 5E1DA 3UT5B 4EBBA 2HF9A 2ZIXB 2R48A 3HBNA 3U49A 1K86A 2FWBA 2QM8A 3PNYA 3I0ZA 5LP6C 2BFFA 3HP7A 1E1CA 2BCJQ 4BIIA 5JNSA 3I92A 4D3FA 1ZIDA 5LSAA 5EJAA 1ML4A 4Z49A 1Z5PA 2RARA 2X8JB 1U3WA 3E9YA 1TUIA 5BSHA 2HRCA 1OWPA 2NZVG 1KH1A 4FHDA 4IBOA 2H2FA 4M38A 5CDYA 1RZRD 2NU6B 4M1MA 5AJVB 4EPVA 2I7DA 2WJPA 2CVPA 2UYYA 4QT4A 1XNJA 1NRWA 2YQZA 3U3OA 4HPWA 3B3FA 2J3EA 2QX8A 3CX8A 1DKRA 3I53A 8AT1A 3SKYA 2EARA 3DPIA 5LYJF 1TCAA 4YT5A 2QNBA 3R3HA 4KXVA 3SICE 1LBQA 3AUSA 1J2UA 3QKRB 1TLFA 3T4EA 1UWKA 1Z35A 2PAFA 4KDEA 1OMOA 4XQ9A 5LB4A 4KNVA 4AO7A 1VM6A 1M8JA 4PYLA 4BHTA 1BS2A 4Q9LA 1D1SA 3KUKA 3PPIA 3NKFA 1L9XA 1AGXA 1GQRA 2FZEA 3UM9A 2AH5A 1S3IA 1E6KA 4L4YA 5CA0A 2XIJA 3E3LA 5AM2A 4Q9KA 3SEFA 3CVOA 1G8KA 1IPFA 1S3GA 1VDMA 3PQ2A 5EIFA 5IP5A 3STXA 4BGEA 1NMQA 3BB3A 4U5QA 3FDFA 4F12A 3IB6A 4OU4A 1V1RA 1RC8A 5AESA 2C2GA 3OE1A 2X4IA 5JU6A 4QG7A 1E5TA 4XGNA 1RAIA 4CGYA 4PHTA 3FMFA 1J1UA 2C8VA 5E4YA 2LWIA 3I09A 1OXBB 3OIWA 5BXYA 1FIUA 2H2DA 1DZIA 4J0JA 1TD9A 3A2KA 1T6ZA 2OFWA 1NNI1 5KEIA 4YMHA 1Y8QA 2EU8A 2FG7C 1Q57A 5KU1A 2DFLA 2GO7A 1KAEA 2E1RA 4ZCTA 5IASA 4K05A 4KAXA 2DPLA 9LDTA 5KHOC 2AOTB 3GJ7A 3OKAA 2WPDA 1YS4A 1C9NA 1Y3BE 3B5JA 3CKKA 3EXG1 3NZEA 4W1QA 3S44A 4Z0NA 4AICA 2XUPA 3IQIX