3QYFA

Crystal structure of the crispr-associated protein sso1393 from sulfolobus solfataricus
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
FQGMEVHVCSVGTSLLKNSLDDDNVRKEIERLGLKDWDRLKFDDDRQNRIKENFDSLRKMLLKFIRSKGRRASAELDSLFSTFEKLKHNKSEIYVFLYSTNTSNSQLAGEVIRDYLIEEGIRSELVTVKTISSEENFYEGIVDLFDKVIYRILKFKEQDNEVYINATPGLKPESIFLTLAGLLAGADLIYYKYQEFNDVVILPSPPITIRPKYLDWLIRFAISGYTLSEKRAEELGIPVRLLEAKMLVERKGEDAYRLKDWVRKLLGIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-ASSOCIATED PROTEIN
publication title Crystal structure of the CRISPR-associated protein SSO1393 from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
total genus 104
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09651 Cas_APE2256 CRISPR-associated protein (Cas_APE2256)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qyfA03
1.10.196.30 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 1 Regulator of G-protein Signalling 4; domain 1 3qyfA02
3.40.50.10770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein VC1899 like domain (Restriction endonuclease-like) 3qyfA01
1XMXA 3QYFA
chains in the Genus database with same CATH superfamily
4XRSA 4M1OA 1Z36A 4A5SA 1AUPA 2VSNA 5EKTA 3H2YA 1RAEA 1NOIA 4BHBA 2MD0A 5AI0A 1EINA 1S29A 3NFRA 2ECCA 1Z4OA 3R40A 2K7FA 4HRIA 1OFUX 1ISJA 4ZCPA 5DHPA 4R2LA 1SD1A 1GNTA 3RI3A 3KBBA 4XVHA 4UB8C 4KE6A 3BCSA 1REPC 2QQEA 3SZ3A 2E87A 2Z58A 3IUEA 3AVTA 1KO1A 4WCFA 3IHWA 4IIJB 3FF4A 2JA2A 3QNWA 4DA4A 4R2JA 3B1YA 4W1PA 4ZYUA 2BMJA 4DUGA 1KKLA 3IUPA 3QPBA 1I4OA 3A37A 3R3WA 4DYQA 1Q11A 5CG1A 5JNVA 3GFFA 1GUZA 4FBMA 2SHKA 4FNGA 3FUWA 2LRHA 3TLKA 2CMFA 5KMGB 1Q57A 3FDIA 3T0IA 1E7WA 1W8IA 4WFQA 4TWJA 1OMIA 2VUHB 3PNLA 2R87A 4G5XA 2E1PA 4JJ8A 1CU1A 5EG0B 2X13A 5KJCA 5AVTA 2EFJA 2F43B 2NSHA 3QV1A 4WL0A 1HA8A 3UK0A 4NH4A 4C9BA 3AKCA 3TE7A 4YV7A 5JMOA 1N34B 3BHJA 4B4OA 4R7TA 2G9VA 4G37A 1YO5C 1NYLA 2F3RA 2XAFA 1Z2NX 3I73A 2LTAA 5BSHA 1Q16A 3E0XA 5T8KA 5E4FA 4B43A 4NEQA 4Y1EA 2O06A 2VONA 2FG7C 3BPXA 1MVNA 4PZPA 3H9QA 1KJZA 1OW3B 3GLXA 4BMXA 3ZVNA 1NNI1 3WBKA 2STWA 3BR5A 4G01B 2D5VA 3AEQB 3PC4A 1U8YA 4CWAA 4HQ6A 4RJKA 1HF3A 4DJTA 4FONA 1WUHS 3BY6A 1D4OA 2I8LA 3CMYA 2IXTA 4EW3A 2YZGA 4WKBA 3MLEA 4RYDA 3UFXB 1SCDA 2DTXA 4OA8A 1PFQA 3RHSA 3T06B 3KU1A 3RS0A 3WYGA 4BTEA 1JTEA 3PL5A 4CEJA 3V4OA 2OCCH 4CL2A 2ZITA 4GI2A 1B72B 1EJ2A 4ABZA 1TZKA 2K86A 2XSJC 1G19A 4ZCSA 3V1NA 3B1WA 3K7EA 4N4AA 4WCFB 5CLFA 1BIAA 4MS3A 4DA0A 3ZLTA 1YFJA 4U9UA 3SMVA 3HGGA 4K9QA 2R5NA 3ZZMA 1W7AA 4YMIA 3LJKA 1XQ6A 1FRQA 3QFRA 1Y56A 1JSXA 3KUCA 4OXIA 5I7UA 1KI8A 1YQTA 3SR3A 1WVIA 2VRBA 2Y1GA 3UHFA 3FMPB 2KS6A 5K6RA 1JE8A 1JNXX 1W85B 1DAEA 5GAGJ 1CB0A 3ZJ5A 1T9GR 4Q7LA 5AW9A 4TLDA 1Z2EA 2OQVA 3ZXYA 5EIEA 5KX5A 3ABQB 1H0KA 4R40A 2VBYA 1JEAA 3EC1A 3G0GA 1EQUA 1BHJA 4KFCA 1LDBA 1XN4A 1RJ9B 3ID6C 3K05A 3Q9UA 4X3OA 3TVDA 4BC1A 4EG6A 4F1JA 4GKJB 2OHGA 3H9UA 5DXJA 5F4ZA 2Z6AA 1I6LA 1PLKA 3V97A 2CB9A 4R9SA 1E0SA 1SD5A 3TP0A 1DFGA 4O2BA 4AJLA 2H4WA 4PRZA 3C87A 4O6JA 1NUSA 4MV3A 5KNCD 4G6DA 4GG1A 2MSCB 5FUXA 2Z4RA 3P2YA 4TQUS 3MWEB 4TTRA 2AZ4A 3GEBA 1H2YA 3RTCA 3SSMA 4BLPA 1Z1DA 2Q8PA 1N25A 3J7ZI 2F3TA 5EIWA 4W6QA 1F0KA 4L0QA 1KTVA 3PC8C 4D9NA 3Q3GE 2XE7A 3NAUA 4BV9A 4UUQA 2R1TA 5H81A 1NN3A 2BAGA 1O94A 1TYEB 2XE6A 4B3RB 2INGX 1DBPA 3RNLA 3EGEA 4IR7A 2A7QA 3GG2A 1Z2DA 3HZJA 1GGHA 2B3DA 2G72A 3K6JA 4NK5A 2WUDA 5TF0A 3SEQA 2VHZA 2FW6A 2RGYA 3QFSA 4HHEA 4Q1VA 5EJ8A 2E4AA 2QYHA 4BEWA 1VFCA 4URXR 1ZUNA 4OYLA 5DNYB 3F9KA 5JD4A 4RPJA 4LJ8A 1YJCA 4HAIA 3RFTA 3BKWA 3PEYA 2H6BA 1OZHA 4B8YA 2JHFA 5K01A 1B16A 1VP3A 4MQBA 1C1DB 1FX1A 1W93A 3X1DA 4A2PA 3O8OB 3HM2A 1I2BA 4UW9A 2Y31A 1FMCA 4TSKA 1U0BB 4L16A 1S2MA 4BQNA 3FWZA 2JL1A 2EFPA 1PHPA 4URYR 3NATA 3H9JA 3E70C 3N75A 3BWMA 4ZYTA 1Z7BA 1GV1A 2OV2A 3CNEA 1YB5A 3DM9B 1IH8A 5IK2D 5E7IA 1ZTRA 4GYWA 2DA6A 4JX8A 3U9LA 1JLRA 2OSBA 4KN8A 2XKAA 1SFUA 3K9QO 4JGBA 3CO6C 1P5RA 1E9BA 4ZANA 1C29B 2DO7A 2BFDA 5FWYA 5HLTA 2J67A 2BUAA 1GTVA 4FGWA 3MCWA 3QITA 4UHTA 1ISIA 1Q44A 2XDQA 4AC0A 3UAYA 5JQWA 3LA3A 1OLTA 3PD1A 3RU2A 3ET4A 1W0CA 2AF4C 3KQQA 2IQ5A 2QP9X 2WSSD 3FCUB 5LMCA 4PGMA 1EWKA 4OMUA 4R68A 4BNDB 2WTUA 4W7SA 4MINA 2X42A 2ZYSA 3WY9A 1X8LA 1JHFA 4F71A 1G6OA 4M1EA 2O7QA 3TLMA 4BVAA 1OD6A 5LA6A 3UH1A 5DEOA 1MOQA 1XTZA 4HRXA 1T0FC 3H1AA 3BJZA 3KKMA 3FYSA 5J3JA 1MV8A 1OYVA 2W2TA 3CPHA 3LVQE 2PT9A 4GHWA 1R1DA 1MNMC 1FTQA 2W6QA 2ZS7A 2A67A 2NTYC 3K32A 4HB3A 4BBZA 2QSHX 1R0CA 1Z6XA 2RDMA 4EKDB 1EK2A 2QSGX 4PNHA 2IIPA 4ZQIA 3L9FA 1G2QA 2DBYA 2FZCA 3OU6A 1K3TA 3NJ8A 4N40A 2RC4A 3O9MA 2PUFA 2W1OA 3RZOJ 4J00A 2FOIA 2R84A 2V4ZA 4MP3A 4HQNA 1BRMA 3TZHA 1TUBB 4V0SA 4AD9A 4EHNA 2DQLA 4EMSA 1HKTA 3LVRE 3PC3A 2UXCB 1VSVA 3GFOA 2X1VA 4DNXA 1CPYA 2IGMA 2OQ2A 4WQMA 5G41A 2KPOA 2IW3A 2PWYA 1USSA 1WF6A 1LB2A 2Z9CA 3BXEA 2B99A 3OCVA 1JZSA 1SVUA 1BC7C 2JBAB 4D9JA 2V6GA 1NJGA 2HB6A 3DEYX 4MP6A 1YFZA 2PA0A 5KKCA 2DT6A 2ZBEA 2PUDA 3E9DA 5LQNA 4ZHQF 4QTZA 2P0AA 3S93A 2BKXA 1NVFA 1GILA 3IMGA 3FHTA 1JN0A 4MUNA 2ZJ2A 3GTPJ 2XRNA 1E8DA 2X3YA 3OIGA 1O8CA 1Z05A 2CXRA 1R5NA 4BNXA 5HLGA 2LKPA 4IJQA 1GKYA 1OWLA 5F1YA 4MQFA 1I4EB 4OKSA 5F35A 1OCPA 1PL7A 4NOJA 5BWLA 4RIFA 1N4DA 5EZYB 1ETWA 2FE4A 1E64A 4FD3A 4NB5A 1PFUA 1SUPA 2C97A 3IEUA 13PKA 3UCXA 2FWBA 3ZS8A 5JH7A 2G0NA 3EG9A 4YREA 3T5AA 2QRHA 4AURA 2D2VA 3CPJB 4REQA 1REQA 5IC5A 4JLSA 3R0QA 2ZUFA 2A07F 2VBZA 3AU8A 4I02A 3Q2IA 4KTTE 1KI6A 1FPQA 3DF9A 4J1TC 3O2JA 1FSEA 3L01A 2N3ZA 1JDBC 4RENA 3GZ4A 1TM2A 3OG9A 1KEUA 2PD3A 5FPKA 4H6VA 7REQA 1TUIA 2CW7A 3ABIA 4IG9A 5JAOA 2W43A 3C74A 2Q5JA 3PIDA 3QWAA 5BWBA 2WKQA 4BASA 2FW7A 3CT4A 5KOJB 2ZSKA 2CWWA 4OMDA 3T1TA 1C3VA 3A6DA 3ZHOA 5CA1F 1Z39A 3F1LA 3ZJYA 1LPSA 1YDFA 1M2VA 1FMFA 5KUTA 3P7NA 5AHRA 4HRAA 5DCMB 2MCFA 4YWJA 3FNEA 3FSGA 5M3BA 2JIBA 1HTTA 1GVDA 2BFEB 1IO2A 3UYKA 1XTVA 4PO3X 1IAVA 2H4HA 5ELMA 2QRVB 4MV6A 1K78B 3Q0WA 2E3JA 3ENVA 4P3PA 3TVYA 2XUPA 4ZYWA 3MB5A 1GL3A 1S3JA 4OSPA 3DL4A 1G291 2O6HA 3MCAA 4XM3A 4DLWA 2WBMA 2V6BA 2LY2A 5BQPA 4UTNA 2D54A 4N4NB 4N5MA 5DNEA 4PTYA 2MSDB 3AR6A 4IMIB 3G4SI 4LSZA 3Q8XB 3QVGA 4TV9B 1FTGA 2ZIVB 4LK2A 1PYGA 4UCWA 4LRXA 5CDTA 2DWOA 1TJYA 1MNAA 1R27A 2XSZD 4QTUB 4HCJA 2FI1A 2QQAA 2IDMA 4FX2A 3NZEA 1EP1B 3ZDFA 1GU0A 3D02A 1NRWA 3WIBA 5KYUB 2L9NA 1F2VA 2ZUDA 3IQGX 1XGOA 2O8EA 2IWRA 2DT8A 2ET6A 2REQB 3Q7TA 1EG2A 1G5PA 1TKRA 1X3LA 3GLFE 2C9BA 4HWKA 3L8FA 5JBQA 4HX2A 4DLAA 1FUYB 2C2MA 1EGQA 2AGVA 2P3QA 1P2BA 2VDUE 2VPWA 2X40A 3LLMA 4IH9A 3TLAA 3ZOKA 4CF5A 1OV6A 5AXAA 3UMJA 2EP7A 4OF4A 1C5KA 2I66A 4CT4B 4F8EA 4EL5A 1O3TA 5TIIA 2DY1A 2WF6A 4DA7A 2CUEA 1IHUA 1J0BA 4TYPA 5IK2A 1SVOA 1F2UB 1L4MA 2QMQA 1E0DA 3M4YA 3QE4A 4Y0VA 4ZAXA 2L18A 3BMOA 3FWNA 4HR7A 3VVMA 1SB9A 1IWPB 1MRNA 1KP3A 1SMKA 4PRLA 3THXA 4CF6A 2EFWA 3EWIA 2VSOA 5AVWA 4GZ3A 4FYMA 1XC7A 1CZOA 4PXAA 4PR0A 1KY4A 1SBZA 1UBLS 1TCUA 4WXCA 3OZAA 4RMGA 4RTRA 1SRQA 4EPVA 4OQXA 5DASA 2JSPA 3TMYA 3WGHA 3EDOA 1U6IA 3KZNA 4NICA 3VZDA 3CJRA 4YROA 5FFMA 4EGSA 2ACWA 2G70A 3AOEA 3BMCA 3FZVA 5DO9A 3UJ3X 1PJAA 2X4GA 4C14A 5JV5A 3QVGB 3IJRA 3HI4A 4QJ4A 2XGMA 1PQPA 1R4MB 3D4IA 1B6GA 4BXFA 2V65A 4R79A 4OLJA 2AQIA 3LAPA 2CEKA 3IBYA 3TOBA 5CH5A 3WRXC 4NZNA 1M5UA 1Y0BA 3ZMVA 3BQYA 3ZLUA 4AU7A 3FE2A 2BEOA 2EBWA 4LNHA 4UXHA 4G4SP 3CVUA 4LGMA 2MYSA 2GZHA 2KB0A 3DM5A 4XUEA 5LR6A 2CK3D 4GCVA 1U7TA 4UPDA 1NVVR 2HGZA 5EQDA 2RAPA 5LC1A 4HPQA 3T5TA 4M6YA 1I2ZA 1Q92A 3KZKA 1YRLA 1G21A 3P9QA 3TIVA 1PR9A 3ZWKA 1GLVA 1QUEA 3GJQA 2VF7A 3LA7A 1SC1A 2OWEA 1L4HA 4K9RA 4MKXA 3UV6A 2HQAA 2BHZA 3G6EI 3NEPX 4HBZA 1G7RA 4G86A 5C8YA 4DZRA 3CXUA 4TL7A 5CD9A 2WJ4A 3A3PA 1KU9A 4BNHA 4CFSA 2GN4A 2GBPA 4AVYA 1JJ8C 4LJRA 4PZEA 4AJ9A 1YYVA 4CEIA 4PZ9A 4TL8A 5KHAA 2HX1A 2JIQA 1KTIA 1N36B 3CRQA 1XZIA 2FOLA 1W5CC 2FF5A 3THOA 3THSA 2KPMA 5KNLA 3L00A 1RCUA 1XTAA 1XSEA 2DFVA 1U98A 4AC9A 2GFHA 2FLWA 1R0ZA 4WTOA 4DR1B 5KNBA 1JWLA 1B6TA 1D6MA 1WMSA 5F7XA 4WKNA 1KQGA 1I1QB 1AU9A 4Y13A 4Z1OA 4QBIA 4UFNA 4FC6A 1VL5A 3OYAA 1BQ3A 1VPEA 3LUHA 4D41A 2RFLA 3GH3A 4Z1MD 1FW6A 5DM2A 2OKCA 2X58A 3JRDA 3R23A 1POWA 2COMA 1LBHA 5K7ZA 2BY0A 2WKWA 2ZRCA 5EY5B 5BNFA 4L5AA 3UANA 1PUJA 2AFIA 2H07A 4PY2A 5GJBA 2D2FA 3ZY2A 1MRZA 1DHRA 5JY1A 4C0KA 3ZQFA 1OWPA 2IHTA 2E19A 2IHJA 2I2FA 3K70D 3DZHA 4GP6A 3C8HA 4R0VA 2H06A 4IJVA 4Y1GA 1F1BA 1QPBA 1XTSA 1LFDB 2PGAA 1YB7A 4LJ9A 1P6RA 3K8QA 1BDHA 3IURA 3I1IA 4FWIB 3DFUA 1G9TA 4D02A 1WD7A 3ZCRA 2JJ2D 4CFYA 1EFVB 4F5ZA 1T8SA 2JBAA 1N6KA 1YI8A 3GN1A 5JSQA 4FEEA 1RI2A 1SA0A 2PKXA 2X9GA 1UT5A 3CE9A 3NM4A 4FDTA 2W70A 1GAXA 3UH0A 3RLFA 2BOLA 1T1IA 4BMPB 4D9BA 3KCNA 2JQ7A 3DKKA 5EIXA 1R6XA 2Z1DA 1MAAA 4KGDA 1ETXA 2XB9A 1ZXBA 4ND3A 1DXHA 1PNTA 3NHKA 4F2GA 4PXYA 2PK3A 1MH1A 1WP9A 4TOIA 4KBGA 3WZ2A 1SC4A 2ZATA 3OIOA 4BVJA 2FDCA 3EUAA 2ES4A 3ZOZA 2XA2A 3HNRA 3IQFA 4XM2A 2YYAA 3LQFA 4JC4A 4W6ZA 4DWJA 1M2EA 5ADUS 5TE9A 1L7PA 4A6PA 1WXQA 3PZRA 3G3ZA 3UPDA 2PY6A 1UXHA 1OXSC 2P4UA 5IT3A 3ZV5A 3ZH9B 1JBQA 2C5BA 2FX0A 2X6OA 1I4LD 2I34A 3QPDA 5I9SA 1RAIA 3MWYW 1RQPA 3G9TA 2E7XA 1M1XB 1YMVA 2VTEA 3BIJA 1IUKA 1T1JA 2Q46A 1TF2A 3BGDA 2FX5A 3AY0A 1FLVA 2GF0A 1TB4A 2M1XA 4IH4A 3U4MA 1NXVA 5FNVA 3GRVA 5EERA 2CQ7A 4P3YA 2ELHA 4B0PA 3UR3C 1SUAA 1JDPA 1Z6TA 1D5CA 5JECA 4E33A 3KZ1E 5E6RB 1W4RA 1U2PA 5T8KC 1Q3TA 3UKOA 1AG9A 1TRKA 1UBCA 2PSJA 3P26A 4RYLA 3RS2A 3S2FA 2JWTA 3W6JB 4Z4EA 3GZ5A 1STOA 2C4UA 2P9BA 4RD6A 1GPKA 2IZ7A 3L4JA 2C3OA 4G1BA 2DYKA 2QX8A 2PJDA 3ZQCA 1OV4A 4D9MA 3MJEA 3EIQA 3FNBA 4X1YB 3U21A 2JGIA 9ABPA 2XD9A 3RC1A 1RUOA 1NFFA 3I6ZA 4UAVA 3A6LA 2A61A 3OOPA 2IHBB 1A1SA 1YS7A 2MGQA 1CR0A 2YRWA 3GFTA 3KVRA 4XIJA 4KYIB 3NHSA 2QLJA 2WLSA 1W7PA 2LV8A 3ZYCA 4R05A 4N12A 1BFDA 3Q5FA 1C81A 3TEFA 5FROA 2XOKD 1VLVA 3PB3A 3QBJA 2H4FA 4Q7QA 4UTPA 1YQUA 4TM8A 2PXCA 3S1SA 4HNHA 4AYWA 4FB4A 4OQLA 3I32A 2AXEA 1J25A 3N8KA 5I9IA 3WGLA 3GG9A 1X3WB 4JFAA 3ZCXA 4E1BA 4U9IS 5JLJA 3H6GA 3KD3A 4JQOA 2CJXA 5AW5A 3QEMB 1JFTA 4NYIQ 1F5SA 2F1OA 3UNGC 1W5FA 4GQAA 1D2HA 4DM4A 2R68A 1E5QA 2L19A 4K46A 3RC2A 2HA6A 3ASVA 4MWCA 3MQ2A 2ZYAA 4LUCA 1VLJA 3VXKA 2CUNA 1S2LA 2ZI3A 4PG7A 4CI0B 4DC9A 3RFCA 5LSAA 5AHOA 2W4IA 2I78A 16PKA 4MTLA 2XUGA 2R7RA 1BX1A 4AJ2A 4XVQA 4KR2A 1KZ1A 4RXMA 3KZCA 2VQ3A 2VYFA 3PX7A 4WLEA 1DO0A 5F12A 3IMEA 1SUSA 4RFVA 5HF9A 3IP3A 1BJKA 4XLLA 5FLEX 1FLIA 1G5TA 2QN1A 4GIBA 2C1EA 2PQ2A 2R7VA 5AJYA 3Q0TA 2NW6A 2K27A 4GECA 3W5IA 1P2VA 4UVCA 1AS3A 4OB8A 1P7YA 4GXQA 4M8IA 4QREA 4X3CA 2XMCA 1XKLA 3SY8A 5CFRA 4XD7D 3ZXXA 4NNPA 5F1OA 5LD2B 1PVDA 1T2CA 1R0WA 2O8EB 1Q17A 4E30A 2R11A 3PE3A 1XQ1A 5K20A 1K97A 4FI3C 5HODA 5BV2P 3WK7A 1B8UA 1T4BA 1J1UA 1TO6A 3MKLA 4CCWA 3M1AA 4FUTA 2ABWA 2QZ9A 3P4YA 1A7UA 3A1VA 4RK4A 1J0DA 1G5FA 3DL7A 5C18A 2V6JA 2R6R1 4BNLA 4BPBA 2QTGA 4HGPA 3GL9A 2A6PA 2FMFA 4U2GA 4Y2VA 3ZK8A 4DMLA 1BWRA 4F0JA 4Z9XA 4W1SA 4R8HA 2O19A 3NOOA 3SJBA 2M1ZA 3EEOA 3GMIA 1AF4A 1RZRD 3FXKA 1ZK1A 4G7ZF 3SIPA 2C7RA 2OBLA 3HSFA 3JCUC 1VCHA 2CWDA 3RFXA 1RKUA 2YWFA 4G9GA 4HH3C 4OH7A 2E60A 2ZSHA 1TKBA 3JY6A 4WY2A 3WYAA 4C0SA 5JATA 4PFPA 4DSUA 3G68A 3P9RA 1E9EA 2O3SA 2VRCA 2YQZA 3OH8A 1JR3D 2ZJ3A 1XV5A 5B6PA 4PE5B 3ISVA 5HF6A 1T3ZA 4MIKA 4BRSA 1GSHA 4KR9A 2IJGX 3WODF 4RESA 4EY4A 5KOJA 3O8DA 2PN1A 5C4JJ 1B9MA 2C9CA 3CLVA 4E5SA 1O6GA 2ISQA 4BQSA 1IN1A 2Z3ZA 1X94A 4JJAA 1UP4A 4LGYA 4ZQGA 1VPDA 1FDTA 1B0PA 3D6AA 3IRUA 3L0OA 3T3MB 3LPDA 4LE1A 2EP8A 1HLFA 4H60A 4PX2A 1R6AA 2FHPA 3FJ1A 3CCQI 3X44A 1G9XA 2B21A 2CNKA 3WE3A 2Z2ZA 3G8AA 4CG2A 3N70A 2J46A 2D2WA 3RYPA 2HA0A 5TT1A 3AJ9A 5J5CA 4DPLA 4KXFB 2ZO4A 4TZTA 4K6KA 3WA7A 4MWBA 4HDQB 2UUBB 4I1RA 3CIOA 4EJOA 3I52A 2FMUA 2Q1XA 1SCNE 3PE4A 5EWJB 4QKQA 2JZOA 2BTQB 5FO1A 1NBME 5D8DA 3N6XA 5E3IA 1ODJA 1LEAA 1T5DX 2LF8A 4V0QA 4Z1MA 1YW7A 5KOHA 3HPGA 3GMDA 5AVKA 2TMGA 3C3WA 5EG5A 5P8WA 3JSPA 4LXGA 1T3HA 2VDLB 2GFIA 2WHEA 3K9NA 1EA5A 3I9V6 3LX5A 4D4HA 4JOBA 4IJWA 1UBFA 3VTAA 1ZG5A 4B0OA 4WKGA 3AVQA 4BFCA 1WAMA 3AQIA 3FOEC 2E89A 4J3JA 5LZ7A 4CICA 2CLEB 3WOVA 1JDTA 4XSGA 1H4TA 4U2EA 3WMRA 2DQKA 3RU7A 3MOGA 1G1MA 1U0OC 2BKAA 1KBZA 2IP4A 2NQTA 2ZXWH 3D5QA 1E5DA 1G98A 2F8MA 3HWRA 4GWGA 4S1VA 5DGCA 3ROFA 3W8DA 1ZL2A 5JXWA 3V1KA 1ST2A 2IZOA 2BJVA 1BW9A 3TQCA 4LGWA 3VHQA 3MMXA 5IJWA 2RHBA 1UBUS 1MO6A 2QRLA 4NWIA 5A7HA 2PXHA 4IQ4A 4E11A 3FI0A 3VNRA 1D2GA 3NAQA 3X2EA 3IKLA 3HNOA 1PD1A 2GN0A 1E3LA 3AR8A 3L4EA 4MRVA 1V1RA 3I9V2 3DC2A 5AI5A 1M0EA 4C6RA 4YEDA 5EZYF 3HB7A 4DQDA 4M3DA 3E2MA 4C6TA 3O3CA 1BE1A 4P9UA 2I1LA 2HYFA 4JR1A 2ZG6A 3O26A 4N9HA 4TL6A 3PXGA 3DBRB 5KJ6A 4LXQA 3RARA 4AM3A 2COEA 4OUKX 1JTYA 3Q3CA 4LA4A 1G59A 4I50A 3LT2A 4Z4GA 1L5OA 1MB2A 4JYCA 4MYUA 3UHPA 1V11B 3OPYA 4MFDA 3E27A 1Z62A 1KSFX 3DVRX 2RHOA 3F23A 3QXJA 4NDZA 4O02B 1DZ3A 1PAUA 1HQYE 4P2GA 4PLWA 2P1DA 2NXNA 2M4GA 2FPXA 2JLUA 3CUEF 3CC7I 5L7YA 5FBZA 4GX0A 4RQBA 5BN1A 5JZOA 1SBNE 3SIRA 4ETNA 4P55A 4CCMA 2BEKA 4A36A 1FXWA 5LNK6 3G13A 1JSLA 1E63A 1G8GA 2FEPA 4YH1A 1YI0A 2L2OA 1XLTC 2YYZA 3R0ZA 3R6GA 4I66A 3U0VA 3GLGE 3WLJA 1P75A 3KPVA 4TMTA 1C7IA 2JFGA 1D2RA 3C7TA 5IYZA 2ZWIA 2ZJ8A 1SK9A 1X19A 3BJAA 1RWWA 1Y6JA 4H15A 5FDFA 2ID3A 2JI9A 4G0XA 3VC3A 1ZM3A 3VZRA 3NYQA 5MF6A 4AQ7A 2Z0MA 2J8ZA 4PJ0C 1LV8A 3UMBA 1IULA 1ZH4A 2QP4A 4HB4A 1BOAA 3NLLA 5FQOA 4RIHA 1Q0QA 3F8CA 3A6JA 1TU3A 1ITYA 5DSTA 1CQIB 4KAAA 2P4EA 2WWFA 4LV8B 4AIHA 1SFEA 4EKEA 5G0UA 3QVSA 4YIIA 1SVIA 2HLDD 3VKUA 1W4MA 1Z2AA 3HJEA 5CQGA 5IJAA 4KLAA 2JFVA 5D3KA 4O4LB 4BE1A 5FD5A 3P97A 5FEUA 5JT1A 4G5RA 4WZ6A 5DWDA 1KIAA 2QT0A 3N8NA 1JG6A 3N8DA 2RQPA 2XSZA 2P2LA 1ZW1A 3LUGA 4KWHA 1CR2A 4OHKA 1L7NA 1P4HA 4MQ6A 4AUMA 3JQAB 1V71A 4U7BA 1IBSA 2PZGA 2WWVD 3R44A 4BVBA 4EGCB 5IZ4A 1ON2A 1EJ0A 2WW8A 4LE0A 1U3CA 2QG4A 1ES9A 3SXUB 4UE6A 3VUFA 2CVFA 3CUUA 1CR4A 2BMVA 3H0GJ 2VQDA 1H42A 3DE3X 5DCUA 4D9CA 1ZHOA 2Y30A 4INZA 2EATA 5T41A 4IO1A 2PRKA 4ZREA 4PO9A 3GAMA 5DUIA 3CVWA 2IIQA 3SYTA 4LS3A 5DX8A 5LN1A 2R7WA 2H1RA 2VK2A 5BURA 1I3AA 1E17A 3RF7A 4ZYZA 3PSFA 5DSXA 2WSBA 5ESDA 4LCJA 2ZSAA 4JAVC 4C21A 2RARA 4XGQA 1RBZA 4MQEB 4E4RA 4CEHB 5A2GA 4R3UC 2QLMA 5JAHA 2KIFA 2E4UA 5COAA 2FRVA 4NS1A 5LRRA 5E3OA 1HFEL 1HX7A 1KAGA 3CYFA 3RC8A 4QG3A 4W99A 3K20A 3HY3A 1NK3P 3ROGA 1VJTA 1ZNWA 3ZDRA 3ZNOA 2ERCA 4BDYA 3O92A 4FIZA 3T3NA 3K31A 4V0RA 1VE3A 3MTQA 1QVWA 1RKXA 4LJ4A 1CEXA 2CMGA 3LW8A 1CF7A 4NIMA 4MDFA 2HPMA 2CLFB 3IAM6 5AJTA 2H5EA 4C3VA 4DIDA 5AFSA 1U0GA 3HR8A 4OXQA 3K92A 5HIJA 5DT2A 4QXOA 5JMWA 1DBIA 5F7OA 5JE8A 2ZI7A 1ONPA 3DLCA 3OZTA 3GLRA 2C4KA 4AJIA 2DCEA 4JI4B 4WBNA 3HK2A 4JENA 1VGQA 2BUCA 1N2EA 4A5MA 1KAMA 4KDCA 2WV0A 5HGXA 5I4IA 2ZYDA 4PAOA 5A6SB 3Q0EA 1JDNA 5HR5A 4HYTA 4GW3A 4M73A 2C8KA 2UVPA 3OPVA 3R0XA 3VHRA 2E55A 3PNKA 1V5FA 1S5LC 4KUGA 3CCJI 1AKHB 1K7EB 3C70A 2D1SA 1CULC 3I5MA 3OZWA 3NWBA 4XTCS 3WL8A 3CP8A 2NVOA 1P9QC 1HDOA 1YZFA 2FVXA 4W9NA 1IUOA 1YA4A 2HWWA 3WGZA 4H4KC 2WDPA 1DO2A 2HO4A 4Z54A 4K9LA 2V1NA 3HJGA 3NRJA 1G8YA 1VJRA 3EGDA 1JKFA 3KJNA 5IX8A 3E22B 1H8EA 1ABFA 3BL5A 3UK7A 4DOZA 1TTYA 2GZDA 3A6HA 1ZI6A 4B6PA 2L7FP 1A2OA 5FLYA 4D9GA 4U7JA 1J2YA 3ZKWB 1UZUA 3V00A 1E4EB 2GYVA 3N74A 4MTDA 4KFRA 1GLGA 1S2OA 1YD7A 3L7CA 4RDIA 2HEGA 1OCTC 4OIRF 1T1RA 2RAFA 4NQRA 3ORHA 1WRJA 3USZA 3PE6A 1NKTA 4XARA 3ZXUB 3MD2A 4NRDA 5K8CA 3JW4A 2PX3A 3CR8A 3SLGA 5DUKA 1O0SA 5FBVB 1L7VC 2FQ3A 4IHYA 3TRFA 2M0CA 4CNQA 1VG0B 2GSDA 1U9NA 3QKRB 3P0FA 3KPUA 4LDJA 3DUFB 2IODA 3T1HB 3K10A 4PDKA 3WGGA 3ZDQA 3PUXA 3TOCA 4F84A 2VF8A 3DEFA 4IOJA 4EUSA 1VDZA 4ZDLA 2IPAB 4X9XA 5CUQA 1TYZA 3FPLA 1KEEB 2XKJE 3IUOA 5DNAA 1JI3A 5LGTA 1THTA 3ECCA 3M6UA 3S6JA 3BH0A 2ZE7A 4IMRA 4AY6A 4ZI5A 3RW9A 3SDZA 5EMKA 1GZ6A 1DAGA 1HKQA 1PGPA 3LG2A 1GV2A 4BBRJ 2QN7A 3OPXA 4MARA 4E2FA 5CB0A 2G09A 4HDRA 4BFXA 5DHUA 5BUQA 4EB6A 3OQNA 2PX6A 3BGWA 4Y98A 2Q5CA 1ZSYA 5K0CA 3QOYA 4G1VA 3TW0A 4FCWA 1VCOA 2AHQA 3JQPA 2JG3A 1NDUA 2Y1LA 3HH8A 4OJKA 1LVKA 1I3QJ 3W5JA 3D5EA 3B82A 4YUAA 4JI2B 1A04A 2GWRA 1HDIA 4QQKA 1Y5LA 2AJTA 1POXA 1DUSA 2VP9A 3OYIA 2W5UA 3DMFA 1WSAA 4J2TA 2JIZD 3DTKA 4E5DA 5L95A 5A2QK 3DMDA 3L8CA 1Y1SA 2GJAA 3GRUA 1DP7P 1R8YA 2WZDA 3KFVA 1TD9A 2JS7A 4JJKA 4ZXPA 4A5OA 3DDZX 2VL7A 3RVRA 3GMEA 3MSCA 1AA6A 1II0A 2H7XA 4J01A 5GP1A 1JMYA 2VSFA 3LXXA 4M55A 4ZC3A 4EJMA 3OYHA 1CS0A 1G8XA 3DMGA 4CQLA 3ZY4A 4MLDA 1CUXA 3F98A 2AS5F 1Z2CA 2HV9A 3GWZA 3K5WA 3M5PA 3MGCA 4O1HA 1K6YA 5EUBA 3S3TA 4YMTA 4CKEB 1I33A 5JS6A 5K99A 5LNK1 1I5EA 1RHUA 4CTJA 2UYHA 1N6NA 4PLFA 1QF7A 3M6VA 4UEKA 2OV3A 4OHOA 5U4XA 4B45A 3GJ8A 2G6TA 4PZ0A 3O21A 3RIXA 3CS3A 1V16A 2HQBA 3UJ7A 1BXGA 4FS3A 3U7FB 4S1TA 1FXWF 3H75A 2QKMB 4QOGA 4IZZA 1SHUX 3EUWA 2QD3A 3U61B 4JI0B 2PQ6A 4I46A 3EG9B 3JQFC 5TMBA 3W1WA 2HF7A 4CU2A 1LXCA 3MMZA 2ZB3A 4ND2A 5F9MA 2JGNA 3S55A 2WVHA 1JG1A 2P9YA 4LXYA 1U5BA 4CKWB 3ICEA 4D81A 4KN4X 2H1IA 1F8GA 1MT0A 2GD0A 5IJ9A 2ANBA 1QE0A 2XMZA 4WXEA 4KI0A 4CQJA 1SO8A 5KS2A 3THWB 1ZUIA 4QNRA 2YICA 4V39A 3NWJA 3B7GA 3K2IA 2TCTA 4QQFA 5JCPA 2XPUA 2V1DA 2JVHA 1CQJA 1XHLA 2FQ4A 3BQNB 3H2KA 4EAAA 1IQPA 1WBJB 2CQXA 3URMA 4ND6A 2P9EA 1RIIA 2XMSA 1U8RA 3R1IA 1XXHE 1ZD3A 3HU5A 4IFBA 2ZJ4A 2YIVX 2PKQP 3R5FA 1XWIA 4ZRNA 4BAZA 1BH6A 1Q0SA 2R6HA 3CX3A 1RR8C 3F8TA 4F3NA 2Y1CA 2PGIA 1HYHA 4IRHA 2F3QA 10MHA 4M49A 2IEDA 1PS0A 1RCFA 1YZVA 4G0YA 5KBYA 1PIWA 1W75A 4M86A 3MJTA 4R1LA 5EJ2A 4IHJB 1GNRA 1N5IA 1XO1A 2IZ1A 3HGMA 1NV8A 1T39A 3PU6A 1THZA 4F93B 3A31A 3ACDA 3FVTA 2YDYA 4IDQA 2ZI5A 2I3AA 4OLFA 5F7JA 2HBRA 4ZOLB 3ZQLA 1PUEE 3K4JA 2YVAA 4FETA 1QRTA 2DFDA 1WKVA 3EC7A 4YJ3A 4D3DA 3COVA 1OWNA 1VSBA 821PA 3IQXA 3MTDA 2IEBA 5BUCA 3SQNA 1UMCA 3BTCA 2GO7A 5IOZA 1UFKA 2HDHA 1O4WA 4IWYA 4J0HA 4CU5A 4ZI2A 5ALDA 3W8EA 1W34A 3LUFA 5BR4A 1PRYA 3MFYA 4X7BA 3SQDA 3CBGA 4FFOA 4KVGA 4KREA 4MYRA 2GLUA 4N7RA 1AUVA 4B3TB 1HT1E 2JFXA 3AHDA 1USVA 3F5QA 3TJRA 5FFZA 2Z33A 1IEQA 3TLCA 5I8WA 4LITA 3KT6A 2X7JA 5JROA 1PZXA 1EZ1A 2OTCA 3GIWA 4PSAA 4U6QA 4YXFA 5ARCA 2A05A 4N7JA 4R31A 1JPNA 2P5VA 1NSTA 3K35A 4YPFA 1LBEA 2HFKA 3TNJA 4EHLA 2CMPA 2W4MA 2WYOA 4YCLA 2XF6A 4BUCA 2P8JA 1R36A 1QE5A 2CLIB 3QIVA 4JSRA 1XLTA 3EAGA 4JOMA 5J58A 4LB6B 5CLHA 2LNBA 1G6Q1 2WUWE 3HCCA 9LDTA 5IZCA 2XGOA 2J5BA 5DN9A 1DQUA 1I14A 1SIUA 5G4LA 4QLAA 4IQJA 1Z3CA 4RZXA 4G5SA 3B9RA 4U00A 4PR3A 4UNQA 4CMEA 5A6SA 1YUNA 1S7AA 1KY3A 3HSSA 4Y6GB 4BFWA 2DR0A 2VT6A 2X23A 1X0VA 1DC5A 2IUTA 4HEJA 5HP4A 5E4TA 2OZKA 5LCXA 3MPOA 4X1YA 3ABLH 3EDCA 4M1ZA 5IPFA 1J2TA 1I7PA 2PE5A 3HZZA 3ZX4A 2XOXA 2HKXA 2Z5VA 1T34A 3ZWXA 4YJDA 4QC2A 3U39A 5F6FA 3CC4I 1WE2A 1MCZA 3IJPA 3HDDA 2RB5A 3KR0A 3A2KA 2QD1A 4A3JJ 3W3ZB 2E1OA 3QWLA 1KH2A 2WIAA 5DJ5A 4LYYA 3ZU6A 3KP2A 1JS1X 1IXSB 5H4GA 1TBXA 2K40A 1QU3A 3HDTA 1FLDA 1RI4A 1XS9A 3NBAA 4AKGA 3AJEA 4D4MA 1XSXA 3I71A 3AFOA 2OC6A 3V6MA 1WHTA 1VM6A 1ZIDA 1NR7A 2DUMA 3F5SA 3ZWBA 1Z75A 2FTKE 5AOCA 4OXXA 4F55A 2XQIA 4LQDA 3PO2J 2VS1A 4XWYA 3SFTA 2I7XA 3GQBA 1O87A 3KJZA 2BKUA 4XDHA 3A9TA 3TG8A 3W6PA 5HOOA 2R7ZJ 1XUOA 1FC3A 1TQ2A 2GF2A 3S17J 2W42A 3DHVA 2DTDA 4HFMA 3ADBA 1AO3A 4YP7A 1XHFA 4IG4A 1C9DB 2NUPB 4YV2A 5TNXA 1LWOA 4OIOF 3WAJA 2NO0A 4H08A 4LBVA 3T54A 4B3JA 4MUIA 3UB3A 3SYMA 5H4HA 4OAOA 4BIIA 3NANA 5T3UA 2VDWB 2HEOA 3CO5A 3LFHA 3WKEA 4NENA 3IGFA 3K1JA 4KH0A 3I12A 1EFRD 2OC9A 4FINA 4S1NA 5EC8A 3PKJA 1X4PA 4WNCA 4RA6B 3UXHA 3VSBA 1J2UA 3FAKA 5A71A 1BOFA 3GC6A 1WIWA 2K9NA 2RH9B 5BYJA 3L2RA 4NU6A 1XGSA 1QPGA 5DHAA 2P2YA 1HYEA 5AVJA 2EB7A 2GA1A 1I8TA 4I1UA 4RSHA 3K1TA 3DTEA 4H7PA 4M76B 4JBYA 3C5VA 1LEHA 3CF4A 2NU7B 3L0IB 5LPNA 4C2AA 4GLBA 3UKDA 3E81A 2FN7A 4LJLA 2GAOA 3R7LA 3JR7A 1KU0A 3FKSA 4P7GA 2VQGA 4EABA 5JDIA 4YRQA 2I6FA 3EZFA 2EU8A 4LYFA 1FXSA 3K16A 4IVQA 5JEEA 1VGVA 1YR9A 1BEEA 1J5XA 5B12A 1WDTA 2AN3A 2MMCA 4ZK6A 3O74A 4Q21A 1YZQA 3VSAA 3H2SA 3FKSD 4ZCQA 4AO6A 3QEBZ 1EFHA 1ZQ9A 5AW1A 3MEQA 4RF2A 1G5RA 2QQFA 1HNWB 5EE3A 5HW0A 1DX6A 3S7ZA 3OOEA 3EIUA 4EI9A 2P35A 2Z2YA 3W06A 2L9SA 3C3MA 5K2OA 2IPLA 3AFMA 3HDJA 4PV7A 3VOTA 1ZAOA 1R16A 3DKXA 2GCIA 2Q29A 4AG3A 1NAHA 3IVRA 4H31A 3OS1A 1M54A 5CT9A 2KT0A 5FL7D 5A4JA 5M2QA 4ESVA 3FXLA 2IY7A 3HSKA 3I23A 1G6HA 2X6WA 2EV6A 1QHGA 2D4HA 3KJEA 2Z4SA 1ZJWA 2DX7A 1EFRA 3FYTA 4WGGA 1YQWA 1F2DA 1I13A 1T8UA 1W0KD 2BHSA 3FWPA 5J4YA 3G49A 4L1KA 4Y2HA 4KPYA 3AG1H 3O1HB 3VSCA 3RABA 3U4QB 5BMZA 1PSWA 4QOEA 4BL5A 2RH5A 4K9SA 5LZ8A 4MUKA 4XJVA 1U7DA 2HO5A 4I1OA 2M6LA 2WJYA 3K9TA 4JT2A 3S2UA 3TGWA 3VMFA 2ZI4A 3H1PA 4PYJA 3JSXA 3DFIA 4L3VA 1UPBA 3ADKA 2OQRA 3H84A 1AK1A 3KOWA 3EASA 5F0HA 4E7HA 2AE2A 2JLCA 1XF1A 2XIGA 1M74A 2LZ0A 4HV6A 3IIJA 4M1WA 1FP7A 1TMGE 1LUAA 3I4FA 4AJKA 2PZ8A 1QHHA 2B9VA 3DBVO 4HDUA 3KLBA 3DV2A 5B2FA 1S72I 3KSUA 4C78A 3DBIA 4L4RA 1W5SA 4EY8A 1PWZA 1VL8A 4IDEA 1E59A 2ISYA 3ITEA 3PFNA 3BK1A 3AI7A 5FORA 3FNRA 5AO9A 1MJ5A 4FYHA 5SZJA 1NE2A 3A1DA 5LIRA 3MOSA 1H2RS 2IVZA 3ZWOA 4OYRA 2PZBA 1OIXA 3V8LA 1GDHA 1UDXA 3A4MA 2C7PA 3G2BA 4ZJUA 3QU9A 4J2HA 1XYVA 1XKQA 3BSSA 4DVGA 3MTIA 2DWUA 1WW2A 3ZS9A 4QOIA 3U40A 1KFJB 1QQBA 4PZAA 5ALMA 3F74A 2ERXA 5CVRA 5EDNA 3QKSA 3QEAZ 3U48A 3ADPA 4ZZLA 4NG4A 3U56A 1SVWA 1MEOA 2JZNA 3VOSA 2VYND 4PPYA 1RESA 1O3QA 2DPMA 3BWBA 3SZOA 1N6PA 1DTSA 2X86A 2XJ4A 2DMNA 2JRTA 3OMXA 4HB2A 1AQIA 1WCXA 3FNGA 3D8RA 3UY4A 1Z4MA 2ONJA 4NP6A 3A10A 3COZA 3L1VA 3HYIA 2O0HA 2A9OA 4YFNF 1I2DA 2WILA 1B74A 3UUEA 5LHIA 3H87A 4FFBA 1L7RA 1ZOLA 2BR3A 4MEXF 1ZRDA 2R8EA 1FMTA 3CR3C 1UK9A 2BL4A 3LCUA 1ZI9A 2OT3B 3P9ZA 2Q3MA 4FGJA 5C31A 4XOPA 4B4KA 4R7GA 5KPDA 2VWGA 1TF5A 4X6YA 2FSIA 3HCDA 5HEKA 3ZI7A 4OTZA 4ZALA 1J5YA 3QFCA 2PLNA 1O6BA 1IBRA 5CW2A 1FTZA 1XB4A 4OJTA 3RKQA 2BP7B 4XVCA 4XQEA 3K6GA 1OLXB 5B4VA 4BFUA 5EYRA 1VKRA 4GE3A 2I55A 2ZCJA 5HJ7A 1T38A 4KIWA 3DOUA 1LVAA 5HS6A 4CTOA 2HZ7A 4DDWA 5K0FA 3SEFA 4J0FA 4CG3A 3OP4A 2IVFA 3KCQA 2IYYA 2C8VA 3L7IA 4MUHA 1EGAA 4RLFA 1ZGWA 1P91A 3K70B 4KUHA 2E5LB 4S0XA 3AVYA 2H7VA 1IY0A 2ATCA 2W93A 3MD0A 4K28A 1NT4A 2H2WA 3CNNA 5DNUA 1T26A 5LLDA 1D1SA 1Y5MA 5ULLA 1PP8F 1ZW6A 5L7TA 1NHWA 3P7MA 3VDQA 1TQMA 5H16A 3K0FB 4B74A 4EA8A 5IVHA 1EFCA 5J40A 1DAPA 1IHXA 2JLQA 4XWAA 3H5IA 4PHCA 2IUYA 2D1FA 2VKEA 2ZQ5A 4QUEA 4HSTA 5CCEA 1TCAA 2XTJA 3A36A 2KBEA 3AM4A 3GVCA 2A4MA 4NSNA 4CIVA 1FYWA 2B3TA 2CMHA 3ESRA 4GU5A 4D4GA 1IOZA 1M2NA 3PNTA 1RMTA 2L2QA 3PM1A 1BS1A 2PJUA 3JARA 3V2IA 1MRSA 4EHFA 4YT4A 3F6EX 2M8GX 1D0ZA 1GADO 4WOCA 4BC0A 1CUJA 1J99A 3CB4A 3T8TA 1TT5B 1J70A 4NAVA 4R2HA 4RSGA 4YT5A 1GN8A 1TECE 2AOVA 5DBEX 5FA8A 1MZPA 3BUSA 2C5LA 5TGZA 3T99A 2C9ZA 1V16B 1CD5A 2J3JA 1W1IA 1CDDA 1KI7A 5C3MA 4YP9A 4EFLA 3OD1A 1X4OA 1M1YE 4FMCB 1AKVA 4MVJE 3I53A 3WRWA 2QYOA 2F4OB 5KYVA 2B1QA 1FFAA 3LX8A 4FFDA 3ZXIA 4KHZA 4QYIA 4I5DA 1E3OC 1BR1A 1E99A 2VQSA 4RPCA 3GY0A 3JQBA 1W88A 7GPBA 4DMUB 1LLCA 2GPAA 3FFWA 4G3XA 1BGXT 4X62B 1D0XA 1PEDA 2WR8A 4IIYA 5DSZA 3JAMK 4J19A 2EIXA 2RHMA 3Q0UA 4OMZA 1EJ9A 2EEPA 2XXBA 2EL7A 5KAMA 3EF1A 2ZS9A 5GM1A 4LLNA 1G0OA 2I62A 4ER7A 5KQMA 5F9FA 2RGNA 4MK4A 1X86B 1RR7A 4IILA 5L3QB 1VHLA 3DTIA 4DADA 4H4DA 3BS4A 1GA4A 3DEJA 1OE0A 2VJCA 1R18A 1X1AA 2BC9A 2VK1A 5ILSA 3OCJA 4XB2A 1OR7C 4F4JA 5AUOB 4B3AA 2WZBA 3AETB 1JHPA 3A9RA 1Z3YA 2DWPA 5J47A 3F0TA 3PQ5A 4I9HA 4UDOA 2D74A 2WUFA 4KMRA 4WDRA 1E1QA 1FDRA 3D6UA 5IVIA 3WB9A 1IJBA 4EITA 3TDZC 2OE2A 2G9UA 4NC9A 3A70A 5DNWA 1QC5B 3HA5A 1QKKA 3RDIA 3ENWA 2X48A 1B26A 1STZA 3E15A 4ER5A 5AONA 1LLQA 4TTQA 1Q50A 2Q0HA 1WU7A 3DVAA 4UDYX 4LFUA 2QMUA 3CD6I 3UC5A 1Y34E 4IJAA 1IE3A 5JFGA 4MUGA 1GU7A 1RKVA 2PR2A 1EESA 3NEJA 1JIUA 2JA7J 1SOUA 3WKDA 5A5FA 3LPAA 2YJNA 3SN6A 2DWCA 4WVLA 1WJFA 4X6XA 3PO3J 4A93J 1DT3A 1GT91 2BUBA 3MYYA 3FYDA 3LSJA 4GI3A 1G3UA 4PYIA 4D46A 3GJ4A 1O54A 5AJUA 1IBMB 2LNDA 4CHGA 1GHTA 4FYXA 1LPMA 3GD7A 3LPMA 1N0WA 2PL1A 1K9SA 4JBHA 1YFLA 1F8XA 2BGIA 2PUCA 3WDSA 2OWDA 1TNDA 1ZM4A 4BVLA 3OSUA 3UZUA 1TFRA 3TM4A 4UXNA 3MMPA 3HEAA 5C37A 2CRGA 3WWEA 1XMIA 4C7OB 2GZRA 3JYOA 2P6RA 2VP4A 3QBTA 2ADFA 3HUEA 1VQOI 5CVCA 5EJEA 4BO9A 2NQ8A 5JQGA 2OAP1 3QYFA 4KFSA 4LYDA 2R7KA 2HZBA 3DE1X 2Q99A 4G94A 4IGAA 4Q4JB 4FM9A 5H8WA 4LHXA 1UUFA 5FPHA 1Z91A 3HCWA 2IK8B 1A9OA 1E4OA 2CLMB 3DKIA 2NYAA 3O3KA 1VQKI 2J3QA 2NTEA 4LBYA 4MW1A 3UT6A 3X3HA 4C0JA 1N2XA 3RASA 3OSGA 4BXUA 2VP0A 3UAZA 3HL4A 2DDAA 2JLBA 2R65A 4WN3A 3OWHA 2AXNA 3QYAA 2B78A 4WRRA 1ORWA 2NYUA 2R6CA 1LNQA 1U8FO 4KRXA 1WV1A 3OBBA 1KFCB 5JAPA 4LSWA 3PDJA 3K9BA 3BT7A 3LUCA 4KQHA 3NC1C 1R6RA 4C4YA 4PLCA 3QUTA 1SFOJ 1JFFA 1M6YA 4BLVA 5C46F 2YXLA 2Q6KA 4JT4A 1XAHA 4U2KA 3HOYJ 4L76A 3SLRA 2F48A 4M6XA 4E5MA 2ELKA 1SXQA 1UPXA 1VI5A 3IUMA 4KQ1A 1UADA 1B3BA 3ZQUA 1B7GO 1LQ2A 2DJNA 1Z34A 2X4IA 2QN3A 2YNMC 1SZCA 3AF1A 5DZSA 3W7AA 4C88A 2PM8A 3OE4A 1HRDA 2C07A 1X58A 4Z7QB 5AESA 2JCXA 2XAUA 3VQTA 1WOYA 3FISA 1DG1G 3ZGNA 4BVGA 3DCYA 4UBIA 3P2EA 3A27A 3U7QA 5HQ3A 2AC2A 2M98A 4DUZB 4GC5A 4Y6RA 2O7NA 5DYYA 2GKGA 2GSWA 1SFRA 1JJIA 1X7YA 3OTGA 4PAWA 5FTNA 3TIXB 1TOAA 4A3SA 5EEGA 4ARIA 4F06A 3QG1A 5T64A 3QBDA 1XMAA 1H69A 1JIJA 1U11A 2CZCA 3GNQA 1BKSB 1SPBS 4KAFA 4DV5B 1ESNA 3L5KA 3EA4A 3NPMA 4HWOA 2TDXA 1X2EA 3OKCA 4N8EA 4WCVA 1N2GA 2ID6A 4FHTA 1NR5A 2ACEA 2G1AA 3IT3A 3SSNA 4CG0A 3QEJA 5FB3A 1RYYA 4HZFA 1XRRA 3CONA 4E70A 3IAEA 4KXYA 4LD5A 2YVKA 4M89A 4LMYA 1NIJA 2ZUEA 2GZMA 2Q6IA 2O03A 5H20A 4HXFB 3V8BA 3U3ZA 1Z4KA 2FWNA 4ZU6X 1U7HA 3L4BA 5F73A 3W2FA 1NP6A 2HDNB 2Z4TA 3ROXA 4Y2RA 3RYFA 4S05A 1ORHA 4NFYA 4Q03A 3BR1A 5FOXA 2EERA 3WNVA 2NZXA 3MELA 2HYGD 2VAMA 4ZYLA 3VJMA 3R4KA 4LPKA 4MTCA 5T4EA 4C1NA 5INTA 3OR2C 5JNLA 1NXXA 1W19A 2CNNA 1BOOA 4E22A 3Q3EA 3W3CA 1KORA 1V5GA 3H3VK 1V8ZA 3QEOA 5BRNA 2XIQA 4C4XA 1MGOA 3RBZA 4DIEA 3AESB 3L4SO 2W6JD 3K2BA 3V7UA 4KIGA 2G8NA 4LEIA 3D4NA 2X0RA 4XWGA 5LYYA 3T7CA 2EFHB 5HKBA 3AY7A 4BU2A 2OB1A 3F6CA 2H9AA 3F5MA 4PS1A 3ZI4A 3GNLA 1QP8A 4Y2QA 5EGOA 5JS7A 4ZTUB 4JXZA 1X80A 1WZUA 4D7NA 5BRJA 2GZAA 4P3XA 1XTQA 2AQKA 1F3LA 1PI3A 1HLPA 2D1QA 1RQXA 3BKXA 1BI2A 2VF4X 3FPEA 3GEEA 3H17A 3ETNA 2EZHA 2OPBA 2ZEJA 1LV7A 1SK8A 3ZLJA 3BJRA 1KERA 4X54A 3UOAB 1MIOB 3C7JA 4BIMA 3K6KA 3GZNB 2FKNA 3DFGA 1E6UA 1X8JA 4FOPA 2GJ8A 1MABB 2O4CA 2OM2A 3K4KA 3DEIA 3V8QA 5LBQA 4MHGA 1VQ1A 5D84A 1FXUA 1N5KA 3C97A 3ZQHA 3ZN2A 2FOKA 3OEEA 1G16A 5FBKA 3QLTA 4TZ0A 2OPTA 1Q1EA 1VKOA 3C5WP 3FVVA 5DLEA 1MJNA 3NKLA 4HGQA 3OQOA 3QP6A 1DKQA 1NZFA 1XTIA 1QLJA 5DHQA 3LLUA 3RYIA 4RKRA 3WMWA 2DULA 2XCSB 2HWXA 1GG8A 2O07A 1L5RA 2WJIA 3PT5A 4N18A 4M1YA 3TQQA 4UCFA 2I9KA 1FC0A 3KTDA 1I10A 1TMOA 3GQVA 3K1AB 3CLRC 1TEHA 3TL3A 4HF2A 3BG5A 3FMGA 4KEAA 3PJDA 3HO8A 5LBIA 4D97A 1WGXA 2GHIA 2H4ZA 5JVDF 2HRRA 2PEZA 5JNRA 2NVUB 3DA8A 2WNSA 4M60A 2C8JA 2OOKA 1YB4A 1TQ4A 5A0FA 4HXEB 2MOKA 3HCEA 4Q1CA 2N8GA 5A06A 3QU6A 4XTRA 3LBNA 5KPJA 3QPUA 4HLXA 2YWDA 1NVKA 1I1OA 3GUHA 2EFEB 5K1YA 2IUFA 4PONA 3EOBI 4X1KB 5ECWA 3SBXA 3BWCA 5HVNA 1A35A 3H0KA 5A3QA 4U0JA 1VE1A 3W4KA 4Z4QA 4AK9A 5D3MB 3L7WA 1F17A 2ZAGA 4CRWB 1OF1A 2GN8A 4Y9SA 4DCJA 2OZUA 5CA0A 3S32A 3TZKA 3TTWA 5JG7A 1NTOA 1A4IA 4CXFA 3C8UA 4G5GA 1QDUA 1E2LA 2COKA 2JIPA 4CMJA 1RT9A 1WU8A 2NS8A 1XZAA 2E71A 1AUXA 4YASA 4JH0A 2XPWA 2GMWA 1VL2A 4MVJD 2PYIA 2IYAA 3G1OA 1KZHA 2V3CC 1G0NA 3LC7O 3RTEA 1XJ0A 2JFHA 4S35A 1KQ3A 3SXJA 3OY7A 4DIKA 3UV7A 1VMAA 3HO6A 3TD2A 2QL7A 1U78A 4MO2A 5MGBA 1NJFA 4BDTA 5C81A 3MBOA 3CUQB 3Q0VA 3BWEA 2SECE 1LTKA 5A6VA 3PRYA 5JR3A 5DTIA 1I7DA 4LZZA 3PRKE 4E46A 3I5XA 3V2HA 1YAJA 4BDZA 1ND6A 1KU6A 3GLHB 4CCKA 5K6AA 2H54A 1NURA 1G6NA 1AN9A 1I01A 2RI6A 1KJJA 3TL6A 3GVXA 2I03A 2P78A 1INLA 1Z22A 2R7LA 4QHSA 1PLLA 5KYYB 1L4LA 2GO1A 3IT1A 1YK0A 3KTFA 3E8XA 3FUXA 3TQRA 3W3AH 3WQRA 5J4LA 3KR2A 1MX3A 2CS3A 3O8GA 3G5AA 4BTVA 2AYZA 4OMYA 4QUBA 1VB5A 4EKGA 2CMDA 5FJ8J 4J4TA 4UASA 1DEAA 3SQOA 2PUVA 2FFQA 1Z0AA 4UZFA 1RHRA 2K7LA 4UEOA 4LHZA 3F46A 3VI4B 5HZGA 2VHUA 5KI6A 3IQEA 1WXGA 4PC6A 2H2GA 5A4KA 3ZDZB 5B5SA 3EDMA 5D5HA 521PA 2IYWA 3WLOA 1LNZA 1WXHA 1R3UA 1DQZA 3FCCA 3U62A 4J49A 2H8GA 5HS7A 1JHVA 4AN4A 3E9QA 3IPLA 1L5VA 3OF3A 4CDGA 2IY9A 4ND5A 2V7BA 5FP0A 1GDTA 4R9NA 5IVPA 2I91A 4IXAA 4ZXFA 1OUMA 6ADHA 2WVGA 2YZNA 3DXYA 2XE4A 4MW6A 5EUCA 3MOIA 1ENHA 5FUMA 3ND6A 1L9XA 1L8LA 2ODTX 2XTAA 1DMRA 4OSOA 4KKXB 4DCTA 5CDHA 3MJFA 2QM8A 2FPOA 4GZ6A 2A0UA 4IW3B 5E1OA 5HCIA 4A8HA 1GUFA 5TPWA 2GFQA 4M36A 4KO8A 1REQB 3BFPA 4NZOA 4R81A 3RKSA 1XHEA 2CU7A 3A1TA 4EG0A 1U0SY 3EY4A 4XEUA 3ZJTA 4O2AB 1RETA 4NYJQ 3BX1A 1QOPB 2AQEA 2GLTA 3AUAA 1DLJA 2GBLA 4AMZA 3ACCA 4I0BA 2QVGA 4YJGB 4V1CB 4R1NA 4MS4B 3ZGZA 4WW0A 5EMHA 3VH4A 3IWZA 2QE7D 3TW7A 2K7ZA 2Q62A 3I61A 4X5OA 3EDYA 8ADHA 5U1PA 2UZIR 2RKOA 4YMSA 3K4BA 1FQKA 2RNGA 2DUJA 2E0IA 5EMLA 3EXEB 4UM8B 3PDHA 3COJA 4RS4A 3I0ZA 2QZSA 3EFHA 1LKZA 1F1JA 1QGPA 2WIKA 4XFJA 5HS9A 4YRTA 4W8HA 3W2VA 4G63A 3NHWA 3S3OA 1JR3A 1VBNA 2PSDA 2VRNA 1QH0A 3QVTA 4FFWA 4L9SA 1P4AA 2IC5A 3FUUA 4QQ8A 5KJEA 3PNYA 3SC4A 2BGJA 5K3DA 4BBPA 2AN9A 1H5UA 2OCAA 1C3OB 1WL8A 4UUBA 1Q91A 1VHDA 3EETA 1UCFA 2H5IA 2VZEA 4I2NA 4LXIA 3IC7A 2CLKB 3ERMA 2G0AA 2WU3A 3MJCA 3EA0A 3ZUPA 4AN1A 3S44A 3OMWA 1II8A 3MT0A 3KR9A 2LG4A 1XCBA 1JHRA 3PFKA 4JLPA 4U1RA 1X1PA 2X8JB 3OFND 2IYXA 1BH2A 3MCZA 1O96B 1UZMA 5JANA 1QC5A 4G24A 2PBFA 5K6TA 2GCGA 1OU4A 4MYHA 4L7VA 5MGNA 3HHPA 5HVQC 1R8SA 4LC0A 3HKDB 1M0WA 4P93A 5LWQA 1V6CA 1QZXA 1Y8RA 1CRWG 3O2NA 4GFDA 4BJHB 1QX4A 4WWCA 2AWNA 5JFRA 5E17F 2VJQA 4IIVA 4MW9A 4E3WA 1N6OA 2FMIA 2ZJ6A 1AMUA 3L7AA 4Y15A 3DW1X 3JAKB 4UXIA 4BJ1A 2HR1A 2REOA 5F5NA 1FYEA 3ML6A 1UODA 2J9YB 4GP9A 1O08A 1FBQA 2OHVA 3NDIA 5J1SB 1IQUA 4P7JA 1VJ0A 1JEYA 3NUZA 2C2YA 3TIFA 3O1IC 3SHWA 3PIPF 2IYRA 1WWKA 5AIQA 1OTHA 3D1JA 4E5NA 2HLPA 4L3OA 4PFQA 4Q9IA 4L9VA 3ADDA 2A5LA 3AB8A 1FOKA 3M9XA 2B7LA 4QA9A 3SBEA 4A1OA 1TWHJ 1WQ1R 2QI9F 1M8GA 2RK6A 2HMUA 3FD8A 5C1OA 2ATIA 5KVAA 5LU9A 2Y4NA 3BZUA 4UAGA 1HT2E 4BY1J 4UULA 1FYVA 3C4JA 3C6YA 1G7TA 1UKZA 2VH2A 3OEYA 4L8WB 3VOEA 3W7VA 1PDNC 3E35A 1GG9A 5CTAA 1KMMA 4A0YA 2IFTA 4KAJA 2HBYA 4QE3A 3AF5A 3ZE7A 4ZYVA 3P9CA 2ENUA 1LC3A 1E79D 4FGZA 2UVPB 4IMPA 1UFVA 3BWDD 4DB4A 1ETYA 3TQNA 1RXSA 5G0TA 4D0RA 4Z0PA 4ZICA 1ZC4A 1DBQA 2GM4A 3RANA 1EJ6A 2QAJA 3T4XA 3TLGA 1JJBA 2ETXA 1JB9A 5EZ5A 1BE6A 1H6AA 2DK5A 1AT1A 2QJFA 1EK0A 3A26A 4V2FA 1JECA 2BT4A 4LG1A 4PLHA 3L18A 1CY8A 3SU8A 4AY2A 5FUQA 4YXWD 2BGKA 5JYBA 3IHUA 1DUIA 2FZGA 2VHTA 4QXQA 4TMZA 2XUAA 4ZEXA 4ZEWA 1SZPA 5TMDA 3IQDB 2X77A 2WU0A 1RKQA 3UNXA 1ZS9A 2XOKA 1FYLA 3TNLA 1MO3A 2BDTA 2EV9A 1HRKA 2Z5GA 3MWEA 3CHYA 3DCIA 1JTFA 2VHEA 3TCXB 4GM0A 1Z06A 4N0BA 2AQFA 3EXIB 5E3NA 1LJLA 3IOCA 2A4KA 1IL0A 4K6FA 4RGQA 1ZITA 1YVRA 3D4PA 1MC5A 1P2SA 2JAHA 3A0RB 3TG2A 2V6MA 3QQ5A 4ZVVA 4C4TA 4RTQA 1FEXA 1W4CA 1D2MA 3AI2A 5B64A 4X84A 4X7MA 2G7UA 5H5JA 3TOAA 3B1KA 3OX1A 3DXJF 9GPBA 5FWXB 1OBCA 1D1BA 5D00A 1LDDA 4HNVA 3I6IA 2CXOA 1FS5A 1K9VF 1JDZA 1IG7A 1LPAB 2LSOA 1QTIA 2ZVPX 2FP4A 2YWBA 2OVBA 4J29A 2XHEA 1G20A 2ZB7A 1PNQA 4B1RA 2WSIA 4B6RA 1T1SA 5DGDA 2M30A 1E2GA 3BFXA 5LQKA 3O2PE 2WM8A 5BQ3A 3SHTA 1RC8A 2OGUA 4YLGA 4P81A 3T3IA 3TR5A 5I4BA 1U9IA 4AIKA 4FDMA 1NT2A 4YRNA 1C9JA 4RWZA 4PWZA 4HQLA 4KPEC 2YFQA 3A4CA 2DA7A 1XEXA 5IAKA 5EL0A 4V0LA 2Q0SA 4J6EA 2JI4A 4BUPA 3LSHA 3PZBA 2GHRA 4UQLA 3ZE9A 4CZ2A 4HOBA 5C80A 1SC9A 1TZCA 3DC7A 5K3OA 2VNHA 3NHBA 1KZ6A 2BF4A 4GLOA 4TX1A 1DBVO 4ARSA 4E15A 4RPHA 4JL6A 1P2TA 4DLPA 3P9XA 3RWOA 1Z68A 1I3NA 1HKHA 1BJAA 1CK4A 2WTXA 5EJAA 4GO1A 2YJGA 1UDBA 1O7JA 2OENG 2HRQA 1VLHA 1WPGA 2Z09A 3OVMA 2ZSUA 4KQEA 2NO1A 5I3CA 3WGIA 2DHCA 2IXSA 3RC7A 1UBHS 5JHGB 3WLQA 3MT8A 5JNWA 2D13A 3DV9A 4LNAA 3M7GA 4YPVA 5JXIA 3H18A 3DLBA 4BGVA 1QBGA 2FMLA 2FAXA 3GCGA 4RIEA 1ZGCA 4E1AA 1K7CA 4G0ZA 1JQAA 5IKMA 3C1DA 2WIJA 4J8PA 5J2UB 4MVJG 1DAIA 1J0RA 1SC3A 3TZBA 1ZM2A 2VKQA 4WV3A 2PN6A 1JLLA 5DEIA 4U6SA 4E2XA 2ZJPF 2CXNA 4WA7A 3GHYA 3B8HA 3WL6A 3E6CC 2MLGA 4I98B 3ZQ4A 1JEJA 3FGPA 5E1WA 2HVSA 1VMEA 2BW0A 2LCFA 1W52X 3QF4B 4XCVA 3SQXA 2CV2A 2ZJBA 2IPMA 3SD7A 9ANTA 2J30A 5JW6A 4Y1FA 1XNGA 3NCHA 1GAEO 1QB8A 3BWGA 2O8FA 1DIAA 4PUSA 4G7HF 5JSUA 1ZH5A 1HZZC 5DT9A 1N9ZA 4DG8A 1NLZA 2VXCA 3T5DA 1ZMBA 1KNXA 2YFYA 2D00A 1ONBA 2OUKA 2W83A 4AYBN 4X24A 4PZCA 2YW9A 3RC3A 1FOWA 2VHVA 1TEXA 4KRFA 3KPJA 4AICA 3DMHA 4JLVA 4O1MA 2LK2A 1KIFA 2I6QA 2WC2A 1XC5A 4K6HA 4NCNA 4JJ6A 5DYNA 1I94B 3NTOA 3DKYA 4Q3NA 1MZBA 2DU8A 2NZWA 3EVDA 1NQUA 3ZGYA 2G80A 2P9GA 3HGYA 1Y3BE 4ZOLA 3VTZA 4EQ6A 1VIVA 4O29A 4ZV4A 4V1CI 1DQYA 4B8XA 2OY0A 4R0NA 4UAUA 2ZM6B 3BJIC 3PR1A 4FQ7A 2EJTA 2GEJA 3E53A 4ISBA 5EEHA 2UAGA 3FWKA 4IS2A 4J1TA 4MWGA 1QDEA 4W5QA 2EQAA 4L9AA 5AKIA 2RQQA 4YI5A 4ENRA 2W2MA 3HKZN 4MJ3A 2PTGA 4NX2A 4HVAA 4F7ZA 1D3YA 2R7UA 4N49A 1R1TA 2HJGA 3B51X 3CLSC 3JPYA 4L7QA 4QFMA 4ZT4A 4J0KA 2WPDA 5CIYA 2AX4A 2Q5EA 2GH1A 3PXCX 3AR7A 1T8YA 5HIIA 5BQFA 1J22A 2GAAA 2IPOA 3EN0A 3EXG1 4GI5A 3UQYS 1V39A 2FOXA 4X7PA 4EPXA 3GCZA 3PT9A 2OCYC 4KO2S 1VPVA 5TC4A 1YX5A 2ZTVA 2XYHA 3D7MA 4FQ5A 1TLTA 2QBYA 3M82A 5E8RA 1YFHA 3BXXA 3TBFA 5CHEA 4R69A 1NQVA 3NBZC 3UXEA 5JHHB 3D5SC 4KAXA 2W6PA 1N5JA 4RGYA 4CF7A 4BO4A 5T7BA 1NPDA 3D81A 1EV7A 1IZ8A 2M87A 2YBDA 5I5GA 2AA3A 3LH5A 3W9BA 5DCMA 2VJMB 4E32A 1Z33A 5E6SB 1KMHB 3V9AA 1AK2A 1IXCA 1T1GA 5KNDH 2X1DA 1JFLA 2ZMEA 3DPSA 1NF9A 4CR6A 2F67A 2J5OA 5CB6A 2MABA 3KYBA 4YUVA 3EYYA 3I92A 2CLLB 3PI6A 1JBKA 2Q45A 3QE3A 1K79A 2ZJQF 1SEVA 4DFDA 1K3UB 1R5JA 1N5LA 5E8IA 1KDRA 2C2KA 3C4VA 3OUZA 1ISGA 4G1EB 5SV2A 1Y5RA 3N3BC 4IHJF 2HRDA 1KYQA 4Y0NA 5ALRA 3QKWA 1QZZA 1CS4C 3D2BA 3DKRA 1U2GA 3Q6IA 4QUDA 5LQSA 1J2XA 3KZOA 3F6PA 2W2OA 5CPFA 1TT5A 3E3MA 1MIHA 1P7PA 2YH2A 5BW4A 3MWMA 1JKIA 2C2XA 4PJJA 1IMJA 5AVQA 2H2IA 4JSTA 2O8CA 3S8YA 2B35A 1CVRA 1G2IA 5D2CA 1M2VB 2Q2OA 2VYCA 3LIIA 3OICA 2V5UA 4RHTA 4WD3A 4XQ9A 5CXSA 3JD1A 1SU4A 1W9MA 1SFXA 2I2XB 5CPBA 5DWVA 3SZPA 2Z8YM 2IE0A 1XTJA 1JYSA 4B48A 2H2DA 2ZULA 3GLKA 3MTAA 1Y5IA 3MUEA 5EQFA 1YE3A 1DQSA 5IXYA 3ZJ4A 1RRPA 1U9JA 2IPXA 3DB2A 3G8YA 3HMKA 3WI7A 1GGFA 3DG9A 3GT0A 1YVPA 2HKIA 1PDWA 1GZ7A 4BNTA 2Z2XA 3QE2A 3K9CA 1RHJA 2PLRA 4MUEA 1AHHA 3OOHA 3AP3A 4Y2PA 3IVCA 2GIVA 5FT9A 3U6BA 1O96A 3I37X 3DCFA 2HXSA 5K3FB 1O9GA 3L7KA 3RROA 3T12A 3EPZA 1I1HA 1I6KA 1XEWX 2EJBA 1BMTA 4DMMA 2PFGA 2WNHA 2DUNA 1L4KA 3HPQA 3QQPA 4RKEA 3TI7A 3D3JA 3WLSA 2DFKB 1YULA 3GAAA 2ODEA 3I5UA 3HRHA 3QLJA 4CE6A 1CUGA 4UVGA 2UZAA 3CH4B 2CDAA 3A0UA 1DC3A 2WJVA 2P40A 4PICA 4CKZA 2JCYA 2CL6X 4FMPA 4QWWA 3DUFA 4DCSA 1JHMA 4C0XA 5JYDA 5JSKA 2O0KA 2ZPTX 4M4SA 3SC2A 2XPVA 3NTQA 5GTDA 4RF5A 5K1ZA 2TMDA 1ZJZA 3ANSA 5LBUA 1K6IA 1IPFA 2BHNA 2DHQA 3EXEA 3GLIB 5ENZA 4KSYA 2DN0A 2OXCA 3PHIA 5HTOA 4IOAF 3U3MA 2PPVA 2R25B 3OU7A 3HP4A 4QGGA 2EARA 2HI3A 2XC7A 1RJDA 2QYSA 4TLBA 5SZIA 2VF2A 4WSOA 4LPSA 2A57A 2E18A 1K0UA 2C2WA 2HJRA 3MTEA 3ZZ0A 1TLFA 3EZGA 2ZWVA 5A5GA 3OA0A 4J16C 1QF9A 1BIBA 5CB4B 4EZBA 5AVRA 3GRFA 2MYPA 5HZKA 1Y7TA 2X1CA 1A9SA 4XLFA 3L46A 4YR9A 5L7WA 3GTGJ 3CF4G 2PGXA 1C2YA 2QTNA 2P5KA 1S8FA 4PSUA 5DMHA 4B6JA 3BB3A 3P9IA 3M6FA 1G5IA 1BE8A 1U6GA 1YE5A 3A8TA 2M32A 2VRCD 4NBUA 4QICA 2OORA 4BMVA 3PGVA 1FX0A 3FXAA 2VDVE 1B93A 3CB2A 3IDFA 1O57A 4CA0A 3PDUA 1S96A 1TKCA 2QRGA 3HXTA 1R64A 2XT0A 3DZFA 3ABMH 4ESBA 1HCRA 1MW9X 3K30A 2OAZA 2PMZN 1ZWLA 2YWXA 2ZXUA 1CW2B 4AS3A 4D6YA 3O4FA 1C0PA 3LT0A 2NVTJ 3GDHA 2VXDA 4G84A 1MIOA 2P11A 3DF8A 2MR5A 1S4QA 4MKFA 3RVSA 4OAZA 3VX3A 2XVMA 4C03A 5L4LA 4BX9A 1QIKA 4IQGA 2BFNA 3UO8B 2DODA 2X8WA 4TQGA 4XM0A 1SBTA 4OKIA 2QEQA 3G02A 3X1MA 2VJYA 4FJ1A 5IMSA 1ADFA 1CJTC 1VMDA 3NTUA 3DAGA 4GPTA 4BLSA 4TSFA 1RXVA 1A9XA 2PJRB 1K4YA 4HNRA 7ADHA 2WMDA 3HXQA 1W4LA 4WCDA 2VCEA 4HTFA 5E1XA 2B83A 2WEKA 4AUKA 5FI0B 1VE5A 3H1TA 4NHOA 5CLJA 3J7AY 4EKNB 3U4QA 1YX3A 3GFMA 1OCZH 2C59A 4Y67A 3ZK7A 1V4RA 1CY2A 1ZNQO 2LKXA 3QLUC 4Q4ZF 3HJAA 1FBSA 1QK4A 3F9IA 4I3HA 3LP5A 2REBA 3L7DA 3I4NJ 1ORKA 5LMZA 4AKEA 3ZE8A 2R6JA 1MQAA 2HCTA 2QS9A 3HKDA 4UFOA 5I7WA 1X15A 5ELLA 3EUEA 2LKDA 5EE5B 1IBLB 4Z5XA 1W36C 1YZNA 1U9YA 3OM1A 4FR5A 1R9TJ 3DHYA 1G4AE 3QU3A 1CQZA 1R6TA 1Y7HA 4NE9A 3V8RA 2XXAA 4BNVA 1V43A 2IEYA 5EHGA 5A02A 3FUTA 3HUTA 1BU5A 2H29A 3E9NA 3ILHA 3LT4A 1HW1A 2WVAA 4F4FA 2BE9A 1NWCA 4DXHA 5DBFA 4BXOA 5FI1B 4YXWA 1PZGA 4CQNA 4FTHA 1KAQA 4MWDA 4QYWA 3RYTC 3F7TA 4KMOA 4AZWA 1TVCA 3I9KA 1X1TA 1SUFA 5BR1A 2PAFA 5HE9A 2Q5QA 2V7XA 2VK4A 3HFJA 1USGA 2DBBA 1JG4A 1XTKA 2P5SA 4K9KA 3U3JA 2DM6A 3IAS6 4LVUA 4KDPA 3O4VA 3OF2A 1DKUA 3IE1A 1O6ZA 1BX3A 1NOJA 1E79A 4D8YA 1F8UA 2VBGA 3ESDA 3KSRA 1KEPA 2JUCA 3QU7A 2OUMA 3ZCVA 3NX4A 4A0HA 5TSDA 1Z7EA 3M1EA 1ZBDA 2OXFA 2OBXA 1P92A 3QXGA 4LHWA 2PPLA 1OZ0A 2H2AA 2NU9A 4YIFA 1PJLA 4RDHA 5JFTA 4QDOA 1CQTA 2WADA 2QSJA 2WE8A 3W2IA 1OLUB 3RUIA 4F86A 2ZBDA 2FGKA 4LF5B 1USWA 1G8AA 1ZRNA 1JKJA 4MEJA 2EV5A 3QVXA 3QWIA 4ZDPA 4QUGA 4YJ2A 3G1MA 3S2ZA 4P33A 1GARA 2JJ8A 1NI5A 5CFLA 2VSYA 1JVSA 1I30A 3IO3A 3R8XA 1QZUA 1TO2E 3P0EA 4R1OA 4QDZA 3ISPA 4KMMA 1H85A 4PS0A 5TPWB 4B82A 4LY0A 5I5EA 4F9TA 3UYLA 1W94A 2CVOA 3KKEA 2WY2D 2K2WA 4YAIA 2P9JA 4M72A 2JB9A 2CE2X 5TQ0B 1Y8QB 2GA8A 3V1LA 1TQ6A 4KO3S 3NBMA 1R6UA 4BJ3A 5FLXA 5D1HA 5HXAA 1L4EA 4J76A 2DFIA 1WCWA 1YDGA 2IBMA 1U04A 4B47A 1HDCA 2GXSA 4TTTS 3MKYB 1YR3A 2XJ9A 3R77A 3JVUA 1A5JA 2P5TB 3QXXA 4KIFA 3CKKA 1L5HA 2WP0A 5KSZA 1D7AA 4YRFA 4Q3BA 2YXNA 4HGOA 3STWA 3HSRA 1ECGA 4YGYA 4EUKA 1F7VA 5IABA 4XLZA 2XB0X 3BRQA 1K7FB 1NONA 1OBFO 4K86A 4JGIA 3X1JA 4B3HA 3FK6A 4RTKA 3EVFA 3IMCA 1OAAA 3VX4A 3WQSB 2NS7A 3F4KA 3JRCA 4K1XA 2FYTA 4K1LA 5JU6A 4IS3A 3A4IA 2HWKA 4K9NA 2BN4A 2K9LA 3ORSA 1BVYF 3SBOA 5KEIA 3AZQA 3UAXA 4AZ0B 2L9VA 3AP1A 3NM5A 3O6VA 1USUA 2ZTSA 1NVUQ 5J23A 1JLLB 1Z26A 2YN4A 1XQXA 2ZRFA 1SURA 4CV1A 1XLUA 2ZB8A 3U4IA 1AU7A 1RKBA 4P3OA 1V1RB 1VF9A 2QTBA 1W49A 3M8JA 4UE3S 1ODDA 4QO7A 3UMVA 2GYUA 1YQXA 3J81k 3ZZTA 3CDIA 1N8KA 2ZCVA 1K7AA 3OZIA 2QTWB 1WCV1 4RHEA 4H4CA 2ORVA 2V97A 1Z7LA 2IT1A 3LWBA 5EINA 2RHHA 3IP4B 4FT8A 4OU0A 2X9QA 3P9PA 4DIOA 5DTQA 1PZFA 3ILVA 1GGEA 5ER9A 5HUJA 4AN0A 5C1BA 1OLOA 2J5XA 2O14A 5F1KA 5B30A 4M7RA 2QUAA 5LZ9A 5C51B 1F0PA 2QV7A 1A96A 3EW7A 5CIWA 2OFWA 3NH9A 3RIRA 1L7QA 2KRHA 4HBGA 4CFZA 2DETA 3TECE 1YONA 5A0TA 1ESEA 4EMUA 3X0DA 1CEQA 1Y4AE 1P4WA 1PR1A 1EZYA 1YJBA 3KYDA 2ZCUA 4ND4A 4LNUB 3S5JA 2VQEB 5BT8A 2AJ8A 4F45A 2EZKA 1BHSA 2GEDA 1JVBA 4COOA 4DNPA 2DPGA 3JVIA 4FLFA 2DERA 4LDPA 3KDSE 2NADA 4P4UA 1G9SA 1HO3A 1PT9A 2PZKA 3EPPA 3FRIA 1IY2A 3KVYA 4I1YA 1D9XA 2XCUA 2ORIA 3L7NA 3RH0A 1VSTA 2JC3A 3BXOA 3IPRA 4YHBA 5EJ5A 3CTMA 2ZXJA 1QIMA 4DCGA 1EDZA 5EPEA 4A8JC 3WU2C 2XMBA 4EPWA 4ENKA 3HUGA 1S7CA 1R5GA 3GOQA 2C77A 3I2YX 4HPJB 1BX0A 4MQUA 4TWRA 3GBVA 2CFOA 1YXMA 1Z18A 3OIFA 4ARAA 1NXWA 3GP8A 1TTPB 1NR1A 2OFXA 3OPMA 1NC1A 1TK2A 4OJNA 3WMGA 4JJEA 3QBEA 2WMOB 1FP6A 5DYGA 1FDWA 3WKCA 5K09A 1DU0A 4UFPA 4Q9DA 2BMWA 3RHZA 2CYAA 2G77B 4MPJA 5E9WA 3ZKAA 5FPTA 4E1VA 3OYBA 3A6EA 1KMNA 4D79A 3R24A 2BZ0A 3B53X 4C6SA 4C29A 4DBLC 2VYQA 4B6OA 1BROA 1MU0A 2Q5HA 2NN3C 3IALA 3KPWA 2GNAA 1ETKA 3LA8A 3LDFA 4G23A 4J7CA 4M8KA 3WKAA 5A9SA 1T9ZA 1NKSA 4YCAA 4NFSA 3I1JA 2PS3A 2B0LA 4HAMA 5CCBA 2AR7A 2QRVA 1LPPA 2D2XA 4JBWA 3TQFA 3QP5A 2AFVA 4B7ZA 4R6XA 1PHRA 1P3JA 3ZHCA 3GGPA 1BNCA 1G63A 2IQIA 4GMXA 1A7JA 5J5AA 3RUHA 4DXAA 4EHJA 5IUNC 4UM9D 2WWYA 5LQJA 4MKGA 4XLAA 1V5WA 3VISA 4NU0A 2R8PA 2ZB4A 2XBMA 3QYBA 3OYEA 2VAXA 1DG9A 5FKLA 1BXGB 1MBZA 1LCIA 1Z2PX 2AJBA 2BGUA 2G9ZA 3F3XA 2NGRA 4I50B 4LSMA 4NNOA 1DADA 3E7FA 5G0WA 4OGFA 5C8YF 4ZAFA 1DCTA 2VHWA 3ED1A 4FFLA 1NGSA 1AQ6A 4FSDA 2ATXA 4DTCA 4ENPA 3QOEA 1V0JA 3CRNA 4BGEA 4AI6A 2LWIA 2ZVJA 2HSJA 2QVZX 4LHSA 1C7ZA 3RZDJ 3AUFA 3ESAA 4K2HA 1TJPB 3PPVA 1N3BA 3RCBA 3MERA 3G9UA 4OK6A 4EYSA 1UFOA 2JI7A 2FPWA 3AM5A 4H4EA 5C7OO 3T3OA 1K08A 4YJKA 3WK5A 2D7DA 1H8ED 4O59O 3FYUA 4MGRA 3V9PA 1XU7A 1N2JA 1IFXA 3R5JA 4YCSA 1SQSA 1V8BA 3JWIA 1CUAA 5CB4A 1E3HA 3UPTA 1LQ1A 4EJUA 2C58A 1NVVQ 1WUKS 2H0AA 2VTDA 4QBHA 1QIFA 2ADMA 3HLTA 1E9SA 1C80A 1LDEA 5CQEA 1NMYA 4UU8A 4CLEA 4EJFA 3C16C 2BR4A 5EHQA 4Z6KA 1E6EA 1T8PA 5T4BA 2R4QA 4GT1A 5IBQA 3PS9A 1F8FA 4G81A 4K8OA 1J39A 3TZEA 5B2EA 4CM8B 3WE2A 1HDYA 2AXQA 2QMEA 3REFA 3CNOA 2BSAA 3L8ZA 1TVMA 3H11A 4IV5A 1Q0PA 1JXAA 3D31A 2I2AA 2F1JA 2J5QA 4KWTA 3HJCA 3KWJA 4M0KA 5ALPA 1Y6GA 5P21A 5EWMA 3OEED 2VOJA 5ALLA 4MGZR 5EJIA 5CDFA 1TU0A 2J3MA 2Y6UA 4OIFA 2D2IA 1H2FA 1DAFA 1MG0A 1G4HA 3CWCA 4JJ4A 3AIIA 4Z0NA 3VC1A 4B7CA 4OX9Y 5F1JA 4M0CA 3TTXA 4M9CA 4UU0A 4CG1A 4M46A 2I22A 3LUJA 4E03A 4KWEA 4HQ0A 1KO4A 4M71A 2Z57A 1FVOA 5M5YJ 1YZUA 2JASA 5GPCA 2WD8A 3KQTA 3KUKA 4ZCRA 5JJKA 3VZPA 3R3HA 3W6NA 5GADl 1NY5A 3BL8A 3HV2A 4HNUA 1ZI8A 5SICE 3BE6A 1WR8A 3F7NA 5CVJA 4PC2A 4EA9A 4EDHA 5HFJA 1QRDA 1JAXA 3E5QA 4K2EA 1Z38A 1O95A 2BZGA 3BWVA 4RFSB 5GJWC 3JQEA 3RSHA 3G59A 1WSUA 5IDWA 1HDPA 5JLXA 1QWSA 3RRBA 4HJXA 2HNAA 1WETA 4FLEA 2II6A 3C6BA 3JV7A 5LXTF 1O95D 3EVAA 4B9AA 1TC2A 3HVHA 2DXIA 1QANA 2QJWA 2VBCA 1QWOA 2GN1A 3HN7A 3QUBA 4EGQA 1KK0A 3I9JA 1SN7A 7AT1A 3C3DA 1OX6A 2FWIA 1XEFA 2YDXA 3IEXA 3IUQA 4XPIB 3W5VA 3IPAA 4WESA 2PMCA 2IX9A 3F5DA 3LT1A 1OBHA 4A0SA 2BFDB 1SKMA 1SEUA 1NF2A 2Z3WA 4URVR 4EY5A 1EPUA 2RDPA 1SKBA 2G5TA 1T2FA 4W9RA 1V47A 2ZKZA 4M6VA 2DK8A 2EBFX 2DQYA 4Y2YA 1K4MA 2CN1A 3KC2A 1GYQA 1XP5A 4CEHA 3Q4GA 3L41A 1U5CA 2BFEA 5IYZF 1NJ5A 3FZQA 4IOKA 3MXTA 4JITA 4YO8A 2M6KA 4C4RA 1C7EA 5AIPA 1U02A 4P38A 5C3UA 3BULA 3CPEA 5K7SA 1EE2A 3S3MA 4YLYA 3FOAA 2GBCA 4GYYA 2CJJA 1GN9A 1IM5A 4MV8A 2Q0QA 2HL6A 1W4AA 1OR8A 3KB2A 4KMSA 4J9UE 4N82A 1DCFA 2BZ1A 2FETA 1WY7A 5G40A 1VKHA 4B5KA 2CXPA 2LOOA 4DJJA 2WUVA 1SKQA 4DHEA 2G82A 4CKEA 4UM5A 1H66A 4WOBA 5CX4A 3VZCA 3D8BA 4P36A 3LSPA 2GK4A 1D0IA 1YW9A 1KI6B 4OINF 3HPHA 5LRSA 1KA9H 2XGXA 1PD0A 2HXOA 2CL5A 4MQ4A 4Q1FA 3S28A 3HDQA 3CF6R 1LS1A 1YRYE 4Q24A 4LF4B 1FOXA 4F3RA 1JJVA 3H9GA 1FNNA 2JK1A 3L1UA 5AJVB 1ZU5A 3Q6MA 5B5EC 3V4RA 1YQQA 5ES4B 5EXDA 3WGVA 4DUGD 3V80A 3KQUA 5FB2A 3K0SA 1BOBA 5C2JB 5C1PA 2OBPA 1SCQA 3G79A 2P2SA 3NOVA 1C3LA 2P0WA 1KAHA 2ONKA 2B7EA