3R3VA

Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/fluoroacetate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
297
structure length
296
Chain Sequence
LADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIASAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluoroacetate dehalogenase
publication title Mapping the reaction coordinates of enzymatic defluorination.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 113
structure length 296
sequence length 297
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r3vA00
3G0GA 4QZVA 3AUKA 2B4KA 4CCWA 5DYTA 1LNSA 4DYHA 3ESAA 2QRUA 4Y2XA 3M3DA 2QZPA 4LKOA 3BXPA 1ORVA 3YASA 4X3CA 5C7YA 1EVQA 3C5WP 2BUCA 1VKHA 4P9NA 3C87A 4MQLA 4GLBA 1ZICA 1JFRA 2EDAA 2O2IA 3QPDA 2VATA 2XMQA 2HRQA 4Q82A 4N8DA 3F97A 4J0IA 4BP9A 4CCYA 2WSLA 3OURA 1UKCA 2QJRA 4UBLA 5JATA 5F4ZA 1JU3A 1U65A 1YSCA 4U2FA 2Z3WA 1CPYA 4GBGA 3RM3A 3WMRA 3DJYA 2ECFA 4OU4A 3CXUA 2V97A 3DLTA 4QDZA 3NOXA 2GBCA 1QIDA 1ODTC 2H9YA 4FFVA 3D3NA 6YASA 1YB7A 1ACLA 1C4XA 5ALNA 4B85A 1A8SA 1XZIA 4PV7A 3PFBA 4QEKA 3E1GA 2OXEA 1WM1A 5AI6A 5ALZA 3QMVA 3WZMA 5JZBA 1UT6A 4LXIA 4OUKX 4U2CA 1QO9A 1ZJ4A 5BV7A 5AKIA 3DYVA 3FOBA 4G9EA 3ZV7A 4M0FA 4IH9A 4MYSA 3O9VA 5C8VA 1R9MA 4KJXA 5AK6A 4BVKA 5LYYA 3MVEA 2PSEA 2OPHA 3DL4A 4UHBA 1IMJA 3DDUA 1WB5A 2HA6A 3I6ZA 5D3ZA 3C6YA 4UBJA 1XQXA 2HM7A 3JWEA 4QWWA 4FLFA 4AZ0A 4C4ZA 1F0PA 2WUGA 5LKAA 4Y2SA 5CBKA 3W04A 1LPBB 4GI1A 5FUMA 2OCGA 1PV1A 4AO7A 5AM3A 1XQYA 2OCKA 3FVRA 2XQGA 5AK3A 1YA4A 3PF8A 2BJHA 5HFNA 3QMMA 5J3JA 5FV4A 3KSRA 4ROTA 1P0MA 1YCDA 4KAAA 4MWSA 4CFSA 1XLVA 3AIKA 4G4GA 3VISA 3QYJA 1ACJA 3FLAA 5AHXA 5ESRA 5JAPA 3O0DA 1CUEA 5ALUA 3K9BA 5EHZA 2C7BA 3Q0TA 2HFKA 1G4HA 3MUNA 1LPNA 4QDXA 5AKYA 4IQ4A 4UPDA 2ZVDA 1MJ5A 3SX4A 4IHAA 5ALVA 3O4IA 1A7UA 2ZSHA 3W9UA 2C58A 4FKBA 4WJLA 2G63A 3BDIA 3QZUA 4BDTA 4UBNA 1JKMA 5AIAA 3OM8A 1XLWA 3R0VA 1MO2A 3S2ZA 3WKBA 2PX6A 3STUA 4FHZA 5KWIA 5A6VA 5JALA 2FJ0A 1CUBA 5ALEA 2ZYHA 1DQYA 3TRDA 4UBIA 2JF0A 2O2GA 5LP1A 3WIOA 5HF9A 3ESBA 4ZRDA 2JGMA 2H7CA 2PUHA 2WJ6A 1QIGA 1CUAA 1TQHA 4W1RA 3WK7A 4EA6A 3AFIA 5HQ3B 1ZOIA 4Q3KA 5K3CA 1NU6A 2XMCA 5EIAA 4CCYB 1HLGA 2CUTA 3ANTA 2QUAA 1CQWA 2PPLA 5HQ3A 3D7RA 4YASA 1GGVA 4Y2QA 1J07A 3G9TA 2XUJA 1DQZA 4H0CA 1BS9A 4B83A 4BRSA 4UBMA 4Z49A 2DFPA 3G9XA 2OGTA 4GHWA 2GBIA 2BKLA 4OB6A 4A5SA 3DCNA 1AQLA 2VJDA 2WU3A 2PU5A 4DMCA 3H2JA 2VJAA 2QXTA 1DWPA 1E89A 1ZD3A 1CUJA 2OCLA 4B81A 1E8NA 2HDWA 2UZ0A 1LPAB 5FPQA 1JJBA 1W6RA 2YH2A 5AI4A 2XUPA 1LZKA 3EQ7A 3W2TA 4AMZA 1HL7A 2ZYSA 2RHTA 2O2HA 2VSQA 3G9UA 1YB6A 1SCIA 1VXOA 3I2KA 3AZQA 3QVMA 3DQZA 2BUBA 1IVYA 4U2DA 4AMYA 3O4GA 4Y2JA 5JADA 1U2EA 2Y2VA 1CUGA 2WFLB 2CKMA 3BJMA 3HACA 5AP9A 4H7JA 3FNBA 3L1IA 2RHWA 3OTQA 3H2GA 4NVRA 2WJ3A 4UFPA 2R8BA 1H2ZA 1VOTA 2GYWA 4JUIA 5LZ7A 1QZ3A 3WI7A 3Q8WA 3QM1A 5CXXA 4K2AA 4DNPA 1L7AA 2GZSA 2CZQA 5HF8A 3UUFA 3ZWQA 1RP1A 4G8CA 4EY6A 2VA9A 1BCRA 2JEZA 4N5IX 1ZGCA 3E3AA 4DTCA 1X2EA 2ORYA 4WFJA 1FSSA 5ALTA 5C8XA 1H2YA 5ALXA 2WUFA 4X6UA 4X93A 4J0CA 4MWTA 4P92A 1LZLA 4HXEB 3IVMA 4PNZA 1K63A 1XQWA 1OXMA 2WIDA 3EQ9A 1LGYA 4UBKA 2VJCA 1IUNA 2I3ZA 4NMWA 5HKBA 3H2IA 3VXKA 5D7BA 3H18A 5CH5A 1YS1X 1C7JA 4AO6A 4P93A 2PU7A 1CUIA 2OGZA 1XFDA 5DYYA 1WOMA 3H17A 1UK8A 5CT9A 1PJAA 5ALRA 1BRTA 4C01A 1QIMA 1ZD4A 2WIKA 1IUOA 2ES4A 4KEAA 1QIJA 4QE3A 2C5FA 2QMQA 3I6MA 1BROA 1T2NA 2WU4A 4XX1A 2X8BA 4B9AA 2XT0A 4X6YA 4G8BA 1D07A 3L1JA 1GQSA 2G4LA 3HLKA 3PE6A 3CN7A 5ALGA 4CI9A 3WZLA 5DJ5A 1VJ5A 5BOVA 4G9GA 5ALQA 5IH7A 1N5MA 2IX9A 5AO9A 5K3EA 5A2GA 3F8SA 3SC2A 5KBYA 5EIEA 1HDEA 1ODCA 5LZ2A 1R1DA 4L0CA 3LCRA 2CJPA 2J3QA 4Y2VA 2H1IA 5HKAA 1CVLA 3L1HA 5FXMA 4BC1A 4ZV7A 2HIHA 4LXHA 3RLIA 3D2BA 1EDBA 2XMBA 3I2HA 3HZOA 2JGLA 4H7EA 3W06A 4N5HX 1GPKA 4Y2UA 1QLWA 3I2FA 2WG2A 1QOZA 2K2QB 2WM2A 4BAZA 3ESDA 2OQIA 5CT6A 2DHDA 2YYSA 3R3YA 4HRYA 3WKDA 5DTIA 1HQDA 2JEYA 5IVDA 3AJAA 4K6GA 5A7GA 3LIIA 1R4ZA 2VAXA 3ILSA 2VQ6A 3STWA 2XE4A 4Y2PA 1OCEA 2BGRA 2WTMA 3C45A 1BN7A 4QDOA 4Q34A 4QLOA 4C4XA 1QIHA 4DM7A 5AM4A 5IVHA 2XMSA 4DNFA 5ALJA 4X6XA 4FDMA 2XQIA 3LLCA 3GBSA 4EUSA 4HXFB 4B82A 2RGUA 3AILA 1K8QA 2XLCA 5K3AA 3WWEA 4F60A 4G4IA 2VT6A 5ALHA 4QA9A 2QXUA 1QIIA 4QDTA 3KD2A 1H23A 2OG1A 4CIBA 5JIBA 5IKXA 4KE7A 1L7QA 1F8UA 3EBLA 3ICVA 4AO8A 2HRRA 3FLEA 4H18A 4O08A 1CEXA 2Y2UA 2BCEA 2PM8A 1UZAA 4EY5A 1K4YA 3SWWA 1Y7IA 2X5XA 2ZYRA 1UOPA 2WTNA 1EH5A 2XUFA 5SYNA 3BWXA 4D9JA 4F0JA 2YXPX 1SOMA 5H3HA 2RIPA 4C88A 3VVMA 1ZI6A 5AKXA 3DYIA 4X97A 5BWCA 3D2CA 4XJVA 1B6GA 4G5XA 4MEBA 3W9BA 5CXUA 3QBJA 2VAVA 3NGMA 1Q0ZA 2Y1KA 1UOQA 1ETHA 2B61A 1R3DA 3WIBA 5LZ4A 5ALMA 2HA7A 4Y7DA 3G0IA 4HRXA 4IH1A 4N8EA 4CG3A 1XRNA 2EDCA 1QFMA 5FP0A 5LZ8A 2W6CX 4KYVA 5AKEA 1MU0A 2JIDA 3K6KA 1F0NA 3IA2A 5DWDA 1JJFA 1XZAA 1L7RA 3QPAA 1LPSA 1MN6A 4LYDA 1XZMA 5DTJA 3WQHA 4X7BA 2D0DA 3NUZA 3DNMA 3WK5A 5K5EA 4AB1A 3FYUA 3B3QA 1X2BA 2Q0XA 1E8DA 3DD5A 3V1LA 2JGJA 5K3BA 4EY4A 1CUFA 4OD0A 3PICA 5HFAA 3I2GA 1X70A 2RAUA 2ZSIA 1H22A 3HEAA 1MX1A 3IURA 2WKWA 3FSGD 3AZPA 3BIXA 1WCYA 2WJ4A 2O7VA 3OPMA 5JASA 2C0QA 2WILA 3DL7A 1Z68A 2PSFA 1LLFA 1I6WA 3STYA 2JGKA 3WL6A 4C4YA 1GKLA 1Y37A 1A88A 1B41A 5LIPA 4UHFA 4YK7A 1UXOA 1IUPA 1TRHA 5LZ5A 1CFJA 4M0MA 1XRRA 4ITVA 1S8OA 2PSDA 4DIUA 5LKRA 2GZRA 2VF2A 4A16A 2C5GA 2HL6A 1CUUA 1GXSA 3MGAA 2R11A 2XMZA 2J3DA 3HRHA 2QUBA 4H7KA 2QKYA 1DINA 3T52A 2GBGA 1O6GA 1EINA 4RPCA 4ETWA 1H2XA 5DLPA 1XKLA 3FCXA 3I1IA 4TPKA 3U0VA 1G66A 1THTA 3BF8A 2WFLA 4BCDA 4KACA 4RNCA 1BCSA 3R3VA 4BE9A 4GEGA 5K3DA 3WK4A 4W1PA 4J0DA 2C0PA 4B0OA 5YASA 3MUOA 1WHTA 1AURA 1DX6A 1KEZA 1Q84A 3D5EA 4Y2RA 1DT3A 4DNQA 2B20A 1F6WA 5IVIA 1GQRA 1JU4A 5JZSA 1DWQA 3HI4A 3M83A 1GZ7A 1UK7A 2XUOA 4BP8A 4EZIA 3G02A 4ARAA 4E46A 3IDAA 5I7UA 1M33A 3QMWA 4V2IA 1ZD5A 4UFOA 2OLEA 4OCZA 5AM2A 5AI5A 3QH4A 2ZJ6A 1MTZA 4AXBA 2XLBA 5I9IA 3HYSA 1QONA 5ALPA 1XQVA 2JGEA 5FKJA 4MYDA 3K2IA 2HA5A 5CURA 3BL8A 2HA2A 4HZGA 4CG2A 1K5PA 3DOHA 1R50A 4BRZA 1ZIYA 5E2IA 2Z8XA 3FWHA 4GWLA 3D59A 2AJ8A 4OU5A 3VJMA 3H1BA 1KU6A 4C6HA 3WLAA 2BUAA 4X71A 2CB9A 4S0XA 3HC7A 3H04A 1IZ8A 1AKNA 3E0XA 1PFQA 4J0GA 5LZ9A 5AIBA 2HADA 2VTVA 3W05A 4MQMA 5CT4A 3F98A 1XRMA 5HZGA 3G8YA 1MNAA 4PW0A 4GDMA 2PVSA 3V48A 3R40A 1H2WA 3BDVA 1AZWA 3KOOA 2ZYIA 2WHPB 4FMPA 4FLEA 2WLSA 2ACKA 1LPPA 4U2GA 1CUXA 3SK0A 3KWFA 4AN0A 4FLMA 1JI3A 5ALWA 3AIOA 1A8UA 4AN1A 3NWOA 2J4FA 4W1SA 1ZI8A 5CT5A 1MAHA 3T4UA 1E3QA 3QPCA 4CIAA 4GXNA 4Q3LA 5AM1A 4L9AA 1BEEA 4H7FA 1FFDA 5EHNA 1QGED 2OAEA 5JANA 5ALFA 4DMFA 4AZ3A 5A7FA 2O7RA 7YASA 1MNQA 5A7HA 5AK4A 3B5EA 2WG1A 4K6HA 3EF3A 1J06A 4J03A 1LBSA 2QVBA 4OSEA 4X85A 3IUQA 5AOBA 2VEOA 5ALSA 5CH8A 2DHEA 1VA4A 2XI4A 4HVTA 1G42A 4KAJA 5LLSA 3EIOA 4KE6A 2XQKA 3TEJA 3I28A 1Q83A 3ED1A 2V9ZA 2GYUA 1VZ2A 1DX4A 4ZV9A 5T4HA 1TKRA 1FJ2A 3C6BA 4H7IA 4N8SA 2HU7A 4HAIA 4W63A 3RARA 5T4BA 3WWPA 4UFNA 3C6ZA 3D0KA 3ZI7A 1XRQA 4WFKA 5CRIA 1VLQA 4Q1VA 1WPXA 2CMFA 1WB4A 4XWGA 5ISMA 1MX9A 2HU5A 1Y7HA 3D4LA 4C89A 5EHXA 4E11A 1T4MA 3V1MA 3LS2A 4J0HA 3S8YA 1QIFA 1TCBA 1A8QA 1CUDA 3C5VA 1ODSA 4Q05A 1UKAA 2HA3A 5JAOA 3AINA 4FWBA 2WQZA 1QTRA 2G5PA 3A2MA 3G9ZA 2WFMA 4X94A 3A2LA 2Y6VA 1QFSA 3ZLTA 4W1QA 4WY5A 3I1YA 4L3WA 1E66A 1XZFA 3O4HA 5DYWA 4KE9A 1XKTA 2H7XA 5DNUA 1CLEA 4BE4A 5I8PA 2AJCA 1Q0RA 2I78A 5AKLA 2XUKA 1XROA 3CCCA 2XQFA 1CR6A 3R3XA 3GZJA 3PI6A 3WWDA 5JZ9A 1FFAA 1MT3A 3STTA 4BAGA 1WPRA 3WYNA 1XRPA 3DKKA 3BF7A 1QE3A 4TVKA 2H7YA 3GA7A 5JYCA 5EGNA 2ROQA 3FYTA 3LP5A 1WB6A 4BC0A 2JGIA 4ZXFA 1TCCA 3A70A 5HK9A 1E5TA 5AKJA 1YA8A 2ZJ7A 3FYUB 1IZ7A 4YX9A 1ZD2P 4L72A 5SYMA 4FTWA 5AICA 1XZKA 4C87A 3IUNA 2OAGA 5EI5A 5KWJA 4Q3OA 2WUDA 3WL8A 4M0EA 5EFZA 3LIPA 2XDWA 1XZHA 3PDCA 1ISPA 5JAHA 5T4EA 3WL5A 1CV2A 1WHSA 5FOQA 2QTBA 4I4CA 3WL7A 4LXGA 2HFJA 2QOEA 5A62A 2X76A 5EHQA 3WJ2A 4J0KA 2D5LA 2CBGA 1XZGA 2XUHA 2QT9A 3M81A 3FLBA 4DMKA 2QM0A 1XZLA 1NX9A 1BU8A 2OCIA 2XUDA 3H2KA 4Y2YA 3V1KA 2LIPA 3IBTA 2J4CA 4B80A 3I2IA 2XUAA 4F21A 1BN6A 2E3JA 4U2BA 3R3UA 3BIWA 3WKAA 5JD5A 4E15A 2HU8A 4X95A 3WK6A 3IUJA 4FOLA 1AX9A 4QWMA 2OGSA 1FFCA 3FSGA 4JEIA 3OG9A 3R3WA 2AJLI 5C81A 5ALYA 4PSDA 4H7DA 1DWOA 4WDRA 4UHCA 1QO7A 3UMJA 3DOIA 5CH3A 1KU0A 2QJWA 1OILA 1BEZA 1XZDA 2NW6A 4OPMA 3ESCA 1ZIXA 2V98A 3ZLVA 3ZLUA 1W76A 1EVEA 4KR0A 2YASA 4W9RA 4KRYA 3ANSA 4LIPD 1EA5A 2Y6UA 2WHQA 2OQVA 4ZGBA 3DKRA 3E4DA 2XUIA 3OOSA 4MEAA 5BWBA 4ZREA 3O95A 3IUMA 3N0TA 1K6EA 4FNGA 3IIIA 3M82A 5IVKA 1R9NA 2WHRA 1MX5A 4JNCA 5ALOA 5K3FB 5EIHA 1UWCA 1EB9A 2XMRA 5CT8A 2DR0A 3C70A 1XZEA 4QDUA 1JMKC 2DCMA 4RE6A 4RGYA 1HBJA 1EDEA 2AJBA 1SCQA 4BYMA 4HS9A 3GELA 5E4JA 4A23A 3GROA 5FDFA 1CIJA 1C7IA 5AK5A 2CEKA 4FNMA 4WY8A 1ORWA 4QLAA 5AI8A 5DNVA 1ZJ5A 2QR5A 2RONA 1XRLA 4K5QA 4B9EA 5AKHA 2VT7A 3WA7A 4EHBA 2G5TA 1VA5A 4E14A 4DSZA 5HCUA 4UHDA 2PL5A 2JGFA 4I19A 4J0JA 1CUHA 5ALKA 3FAKA 4B0PA 1YS2X 3KWJA 1UK9A 4U2EA 3H2HA 3FVTA 4X92A 3DS8A 4LYEA 1UKBA 3HXKA 3AZOA 4JYPA 3PUIA 4OB8A 2WHPA 1YAHA 4TGLA 4DNOA 2WFZA 3H19A 2EEPA 3O4JA 2HA0A 2FX5A 2HHAA 3R41A 4BZZA 1MPXA 2WIGA 2PKYX 5FPPA 4OB7A 2FUKA 1VE6A 1QJ4A 1SC9A 4B84A 3RK4A 3STVA 2QS9A 2ONCA 5T4FA 2JBWA 4RE5A 1DT5A 2ACEA 2PUJA 3F9CA 2WUEA 4EBBA 3N2ZB 3R3ZA 4BTVA 1QIEA 1UK6A 1XZJA 3BJRA 4BVJA 3G0CA 4PF1A 2DQYA 5AM0A 3H1AA 3PFCA 5HK8A 1QTIA 3FBWA 1EK2A 1BE0A 4Y2TA 4BVLA 1NU8A 4K6KA 1TAHA 3WKEA 2ZJFA 4JYMA 4EY8A 3QITA 3O9MA 4UUQA 1J2EA 3VVLA 2IIVA 4PO3X 2FJPA 2DSNA 2VJBA 3A6ZA 4BDSA 4G8DA 4YPVA 4IH4A 3H0CA 4G1FA 4QNNA 3G0DA 4BCCA 3C8DA 2BGNA 2XQJA 3F96A 4IO0A 1W52X 4MJ3A 5AI0A 1YR2A 2V96A 3I2JA 2I3DA 1YAJA 4P08A 1THGA 1AUOA 3WKCA 1CUWA 3WK8A 4NS4A 1CQZA 1GPNA 3I6YA 1U8EA 1JT2A 3IB3A 4BCBA 2DHCA 3CN9A 5E4TA 1EHYA 1G5FA 1DU4A 1HPLA 4HXGA 4HTAA 4EY7A 3P2MA 5DNWA 5ALDA 5FRDA 3PF9A 2XB6A 1RYYA 3RKSA 1QIKA 4WFIA 3TGLA 5K3FA 1LPOA 4LHEA 3OC0A 4J7AA 4XVCA 3B12A 5CTAA 4BATA 2PSJA 1HKHA 1N8SA 4BAUA 4ZI5A 1P0PA 4BTLA 4PSUA 2BFNA 4BBZA 1EB8A 1FFBA 3D2AA 2RI6A 4DGQA 1LBTA 1AMNA 3G0BA 5ALIA 2AJDA 3HJUA 2IITA 4X91A 2PBLA 2WG0A 3FYUC 3U1TA 3WK9A 3UUEA 5D3KA 3EQ8A 1XZBA 5CW2A 3FCYA 5AKZA 4X90A 1GPLA 5AKGA 1VZ3A 2W22A 1JMYA 1EX9A 4BB0A 4F5ZA 1FFEA 3WA6A 4ZWNA 2PSHA 1SFRA 2XUGA 3KDAA 2BAGA 5AKKA 1ZGBA 2XMGA 1P0QA 2XMDA 1TCAA 1EI9A 4Y9SA 5HF5A 3STXA 3HABA 1AGYA 4EB0A 1ZI9A 5JAUA 1W75A 4WCVA 4FBMA 3HSSA 5KREA 1CUZA 1SCKA 1W1IA 4BZWA 2C4HA 4FBLA 3ZPXA 4ARBA 1TK3A 3ICWA 1UFOA 4X00A 3F67A 3VJKA 1EK1A 3A2NA 1CUYA 1UOOA 1P0IA 4OYLA 2I03A 4GECA 4DSAA 3V1NA 5AH0A 3V9AA 2AXEA 4KAFA 1EDDA 2Z5GA 1GKKA 4XIIA 4PQEA 1O6FA 3WYDA 1LPMA 3CCBA 5ALLA 3GFFA 1USWA 1EXWA 2B9VA 4FFWA 1GT6A 5E4YA 3JYHA 1N5RA 4B7ZA 5JD6A 5AJHA 4KE8A 2GBFA 1VE7A 2GYVA 1R88A 2WIFA 5AI9A 5A71A 4KRXA 1CRLA 5AOAA 3KXPA 1JJIA 3WWOA 5JD4A 1CUCA 3JW8A 4H35A 4WDQA 1DTEA 5C8ZA 2P8SA 4B6GA 3VDXA 3G7NA 1AC5A 1VXRA 3C43A 5FLKA 5HF6A 1TIBA 1CUSA 1YASA 4MXDA 3GUUA 3DEAA 4JH0A 4NZZA 3X3HA 3IULA 3BE8A 3WJ1A 3C8HA 1W4LA 1U4NA 1MAAA 3PUHA 4PSCA 5AM5A 4DLNA 2XUQA 4INZA 1CUVA 4CG1A 1XLUA 4DMHA 1XZCA 4J3JA 5D6OA 4OYYA 3AIMA 4UHEA 3C6XA 2HA4A 4I3FA 5AOCA 2DQZA 3VKFA 1E8MA 1N1MA 2WIJA 3VJLA 4H77A 4H7HA 1RWQA 4UBOA 4AX4A 5CMLA 3WWCA 5JARA 4GW3A 3TJMA 4UHHA 2Z3ZA 2Z8ZA 4AQDA 4G4JA 1J1IA
chains in the Genus database with same CATH superfamily
4QZVA 2OV3A 3AUKA 4FPXA 3TSAA 5LP6B 4BQFA 3MWGA 5DB4A 2Y1CA 1J33A 5DYTA 1FLDA 1GQ2A 1PJTA 1VBNA 2Y1WA 1SB8A 2YFYA 4LOJA 3RVQA 5ICCA 4G0NA 3LUDA 3PYMA 1QYRA 3BD7A 4RK0A 1KJJA 2C9YA 3AUAA 2E1RA 4TVOA 4QU9A 4IQ0A 1NWCA 1RE0A 2CDCA 3BXPA 1IG3A 2FWAA 1E4EA 1JSZA 4PEVA 5DM60 3GLFA 1AH2A 1LNQA 1TM7E 4J91A 1YKGA 3HJAA 1OH8A 1O94D 1O77A 1YQXA 4X3CA 5C7YA 2EW8A 1V8PA 2EWVA 2BGLA 2XYQA 2FLVA 4R1OA 1IHOA 4P9NA 4XIYA 5IAGA 1BQ4A 1SCBA 1IRXA 2PRSA 4BNGA 1XEXB 2CB0A 4MQLA 4GLBA 2VJYA 1A4UA 1U3DA 4U9HS 1JFSA 1U8CB 3O26A 3QPDA 4II2A 5IDWA 3NHWA 5EJ4A 2VATA 3AM3A 4R41A 4D9BA 1PJCA 1QK4A 4Q82A 1EUCA 5IFKA 4ON9A 3ZZ1A 2ODAA 2R4TA 3BGIA 1LLUA 1GDHA 4MR7B 4MAMA 3CJTA 2CUNA 5IEBA 1PKXA 5F51A 5IEJA 3SD7A 1IPHA 3T15A 1AN9A 1JIJA 4C0BA 2XA1A 3ES9A 2QQGA 2Y0CA 5LU9A 4MQUA 4IRXA 5JATA 1E4VA 1I0ZA 1JU3A 2HOQA 1YSCA 4XYEA 4J4BA 1NJ1A 1U8XX 1QB7A 2F7SA 2X23A 3JRWA 1VGRA 3F5SA 4OBXA 4DXDA 1S9HA 4K2HA 3DTVA 4KIUA 3LBHA 4CTJA 1XRSB 2D2VA 4MUAA 3V4PB 1XWIA 4QODA 2IE0A 1Y6JA 3PNSA 3VI4B 2PEZA 4MVJP 3SBEA 1N57A 2D7DA 3FWYA 3Q1KA 1RBZA 2AWNA 4JQZA 4O2BA 2IYTA 4CKWB 2BMEA 5AW6A 1KBOA 1BGXT 3KAQA 4XB1A 3U7QA 2YRXA 4Q3EA 1NSFA 2I6TA 2GBCA 1QIDA 2H9YA 4N18A 3C8UA 4OXRA 5U4XA 3UAYA 3WDLA 4Z1MD 2XXJA 5FL7A 4KZPA 1ACLA 4DJDC 4ETNA 3BWDD 3CLTC 5E9WA 2H4JA 1OWMA 1TFRA 3WYCA 1M5RA 1KI4A 1YDEA 2XEXA 1ABBA 4PHCA 1RRMA 2IYEA 2YWRA 1Q3KA 5AJWA 1WXEA 4FJ2A 4YRTA 1N2CA 3QRWA 4I9UA 5JWHA 3M5WA 4LY3A 3NIGB 3RUEA 3WMWA 3GGJA 3TQOA 5CA1F 1A76A 4I4TB 3GXBA 5AI6A 3AEQA 3WZMA 4BNDB 5JZBA 4K81B 4M7RA 2E18A 1DXHA 4FYMA 4C0SA 3IR5A 1ZK0A 3T4EA 2ODEA 3FHJA 3LLMA 3PHLA 4OUKX 4WESB 2OL4A 3C3YA 3NB0A 3RSLA 4ZHQF 4RENA 1C5KA 1EGAA 4WGGA 3I34X 5L9AA 1BHSA 4LRYA 5KYUB 4JLOA 3A06A 3PGA1 4HX9A 5KJEA 4HWTA 4QYWA 1KK0A 4XZ3A 3V8NA 4YPFA 2AS0A 1E5DA 4WXMA 3PPIA 2NT4A 2XNHA 1SUPA 3EZFA 1R9MA 1MLDA 3UV7A 1DKOA 3L0PA 5GV8A 4FFOA 3I01A 2WTXA 2J0QA 1JQDA 2AI2A 2PA0A 3W6UA 1BWQA 2PSEA 3EGVA 5TJ9A 4OEHA 1L3BA 2EP8A 3DL4A 4IQGA 4DZTA 1JG1A 3H9QA 1UBFA 4L22A 1FLNA 1B15A 3Q3VA 3K0FA 3N76A 4KR2A 5BN4B 5CA0A 4KFTA 4R4JA 4TXHA 3IUEA 3ZCXA 3O5AA 1Q1QA 3C6YA 4UBJA 3NHZA 1XQXA 2C2GA 3AM5A 3HBMA 5D3ZA 3TZEA 3CPSA 4QWWA 3EK2A 1II8A 4DILA 3UMYA 1X92A 4ND6A 1VDZA 2WUGA 5L4LA 1HG1A 1HF3A 1NQXA 5JSUA 3PDJA 1Y33E 2GN4A 1A9TA 1O6CA 4M6WA 3DOEA 1TU3A 2ACWA 3N9IA 5BSKA 1K5GA 4UOZA 1WZ2A 5DM1A 1K3FA 1U2QA 4GMFA 2A9PA 4Y98A 1IXKA 1MVNA 2PXAA 2C31A 3VU1A 1K2WA 2ZGVA 4Z1MA 3UO8B 4YUZA 4YAGA 1RSZA 1QM5A 1Z12A 2XDQB 1XAHA 1Z4JA 3PG5A 2IBMA 3MFQA 2X0NA 1OJ7A 1BSVA 3DC2A 5D3MA 4Z99A 1NVEA 5ER9A 3UGKA 4UXIA 2V9PA 1YGPA 5AM3A 3FVRA 1PFKA 4E7PA 1H8HA 2X77A 4DQVA 5CCEA 3ESZA 3VTAA 4K9RA 1V2GA 1LBIA 4JLWA 1UKYA 5AK3A 4HAWA 3PF8A 1NFQA 1PDVA 2AFIB 2BISA 2BJHA 2C1XA 2J5BA 4F5YA 5FV4A 4JXXA 1UZUA 2DKNA 5CFQA 3THWA 3KSRA 4NYIR 1DV1A 3L5OA 3MCVA 4KAAA 4NEGA 1NN0A 1JQLB 1R0YA 1R37A 1XVUA 3EHEA 5EOVA 4CXMA 4KYUA 3HXQA 2EOAA 3FPCA 3FUCA 3KQUA 4URHA 2VA8A 3HN2A 3NEJA 2B82A 4HNRA 4JR0A 1O3YA 2PX2A 1IDOA 1SXJE 3HY6A 5EWMB 1ACJA 4B6RA 4HGQA 5AHXA 3NT2A 3B6ZA 3IJEB 5DKFA 1PL7A 1AG9A 3H5IA 3OE5A 4XRRA 4GICA 1CEQA 1NWHA 3SX0A 3RVJA 4HP8A 3CUKA 4FNAA 4I5DA 3IEIA 3QXJA 3KJFA 1YOVA 2Q3DA 1GSHA 2R751 3AEYA 1XCBA 3O8QB 4UQPA 3DH0A 3AO0B 1SN7A 1UFQA 2QZSA 5LMNB 1R0WA 1G4HA 3TD6A 4IQFA 2P7HA 1LPNA 3IDZA 1E1QD 1I1NA 1KY5A 3AF1A 4OQNA 3WOVA 3UTCA 1N78A 1NP3A 2F62A 4MB2A 4UPDA 3H99A 4CIXA 3P2YA 1G5HA 5L3ZA 4RIIA 2UZ1B 4FK8A 8GPBA 2EKPA 4IHAA 4NOMA 5ALVA 1T91A 4GL4A 3AH8A 2B83A 5HUJA 2QWXA 2OORA 1NMYA 3TXAA 1Z5NA 4QQKA 2XF2A 2X8WA 3M6IA 1UM9B 2C58A 2IZZA 2YDXA 2BEVB 3EXIA 3HP7A 4FKBA 4GZ6A 3WHKA 2G63A 3LT1A 3UJPA 4C3VA 3FHCB 4BPBA 4QOGA 4GLFA 4MWGA 1KO5A 2OQ2A 1RNLA 1HEIA 1V6CA 4JJ6A 2E0IA 4D92A 3TX6A 1EJ2A 2X4GA 2CZCA 2GXSA 2PL3A 3R0VA 1GTG1 1CZNA 4U7JA 2L18A 3CGWA 3OPNA 2FCAA 1BTOA 1NMEA 4IGIA 2DTEA 5KWIA 1WXHA 1GCOA 4UTRA 3BKXA 1UT8A 4KVZA 5JALA 2X5OA 5C8YB 2QPOA 1L4YA 2MSNA 4FE7A 3IQWA 3PDIB 2ZJYA 2ZYHA 3G79A 2DWCA 1DQYA 1U5BA 3M4JA 4LMPA 4UC0A 4URFA 1Z2CA 3AV3A 1NULA 1QXSA 3HRIA 4BLTA 3OPVA 4PZUA 1DO8A 2C4WA 2I80A 2MMGA 4KYTA 4UBIA 4K7JA 4QSHA 2O2GA 5IJ0A 4PC2A 3FRHA 1RMYA 3CURA 2V5UA 1W34A 3M8KA 4FW9A 5JPIA 4DANA 5KQPA 1P1IA 3G8AA 4WESA 3ESBA 4ZRDA 3MQ2A 4YB8A 2PUHA 3QVKA 3HKDB 1QZTA 5K0NA 4ZOLA 1TMKA 2XGMA 3UT0A 4L3OA 1LQ2A 4YAOA 4W9NA 4ZCPA 2ILVA 5C37A 2VL7A 3PGXA 2EJTA 5KU7A 3EG9A 2J85A 3BD9A 5CM9C 5KWEA 3PR3A 4Q3KA 1C7FA 2XRYA 5EIAA 2V6BA 1LQTA 2CKDA 4ZTBA 3TEFA 3KVVA 4N0EA 2O59A 1P5FA 3GRPA 1ZN2A 3HKEB 4CM8A 2FQXA 5AR1A 1JQAA 1R3UA 5BR1A 2EYQA 3FUWA 4REOA 3PEWA 5HQ3A 1QQ7A 1L1EA 2JFNA 3NT4A 1L5ZA 1GGKA 1H1LB 4QU5A 3AVVA 4CUZA 3FE2A 4EX7A 4DYDA 3ZC3A 3VNVA 5EERA 2DLDA 1SXJC 3RVKA 3JYPA 3S6JA 2UUCB 2YZGA 3FWNA 5FFMA 5ENZA 1M2OA 3RASA 1DQZA 3AGQA 4OUDB 3ZBPA 3L0SA 4GR5A 1ML4A 2B1JA 2C59A 1RFLA 3U9TA 1AKRA 5I7WA 7MHTA 2MIIA 4Z7NB 4U7GA 3BWBA 4MJ7A 2V54A 1ILEA 1K8RA 2IF2A 1EBUA 2OZEA 1ZH8A 1KNXA 3PD1A 2EFJA 4HTFA 4PICA 3V32A 4LBZA 2CUZA 2Q2NA 5D7NA 1D7OA 3MGKA 2Q1SA 3DHYA 1DIRA 3LTEA 1AQLA 4M7OA 3CEMA 3JD1A 4XPIB 2Q21A 1A98A 3C98A 3BREA 4P3KA 3JZDA 2FSFA 2PU5A 1QRRA 1IVSA 4JA0A 1MDFA 1QHNA 5HGJA 1OXBB 1L5LA 5KYTA 1O6ZA 4ZGWA 2HZBA 1WPQA 3LX6A 1L5HA 5BW8A 4FHFA 1DWPA 5I9NA 4IVPA 1NBHA 3LSYA 4L4ZA 5K6AC 4XOUA 1RZ3A 2C8LA 4UZSA 4EG0A 1ZD3A 3N7TA 5EE5B 1RI3A 1T4DA 5A9SA 2DM6A 4PS1A 1U2DA 2OBFA 4B81A 1CZOA 2HDWA 4UOQA 4AY6A 5FPKA 1KYZA 4C0AC 1M75A 1ZITA 5FPQA 2J07A 3PRYA 4TN5A 4J7CA 4P3NA 3FD8A 3HKBB 4QTZA 1YFJA 1X7HA 1LZKA 2FK7A 2A58A 2FU5C 1MHPA 2ZSDA 3W2TA 1NQ5A 1XT6A 3QE9Y 3PNLA 4AMZA 4GWKA 1LSOA 3KOWA 1NJ6A 2UZ4A 2ZZKA 2ZYSA 2PMWB 2RHTA 3R5KA 1YDHA 3Q3GE 2P6RA 2HSWA 1NJ2A 1E9CA 3A14A 2XSZA 2JI7A 1YB6A 1VLJA 1FP2A 1SCIA 1VXOA 1Z45A 2RGAA 2VCHA 2Z2KA 3QFCA 1PLJA 2QSYA 2ZUVA 4JJKA 4NAUA 4KRGA 3TSCA 3UMGA 4HDOB 4D4IA 1DZIA 5LIRA 2NO7A 3U56A 1S2NA 3AZQA 2OB2A 1FPMA 1SIOA 2VAWA 2WWXA 3DQZA 4LGVA 4GUAA 4M53A 3RBVA 3PJEA 3R4CA 3RS8A 3T12A 3U6BA 1XCPA 2EGHA 2RGCA 1PJ3A 3VPHA 1OFGA 4AMYA 3PNMA 5IP5A 4EMTA 1YHZA 1RRKA 3H4MA 4J4TA 1UKEA 4LCEA 4FOPA 3VR3A 3B2EA 2H9IA 4LQ4A 2XXAA 2I2XB 1QHYA 3VH3A 3LHDA 5EJ9A 1E2DA 1P6UA 2CKMA 4YCLA 1Z4OA 1QHFA 2CXPA 4N6NA 3VR2D 1NI4B 2CL5A 2Z6VA 3DT6A 4K1XA 3GA0A 3GT7A 1HDCA 5AP9A 3FNBA 5SZKB 4XWKA 4RF3A 4TL7A 2IS1A 1TK9A 4UFPA 2WJ3A 3VZDA 2X40A 2YHIA 4KQWA 1VOTA 4GMHA 1R6DA 1V16A 1FU4A 1YB5A 2P5TB 2PO7A 2Y1LA 3H8WA 4BNIA 4HVCA 5G4KB 1UMCA 1XF1A 1ESNA 1G5QA 4LSWA 3FIJA 3KKKA 3TSOA 4GM1A 2PVCA 3WLEA 1FRVA 2I6QA 4NPHA 3EX7C 1J0EA 1IHDA 2HJRA 4C0LA 1AO0A 1U28A 2VT2A 4J16C 3HL4A 4C5CA 2GZSA 2CZQA 4X8HA 5HF8A 5B3KA 3DMYA 3A3YA 2A88A 3PPXA 5JO0A 3V4FA 2YL2A 3GPDG 4PPFA 3HCCA 2VF4X 2ZQYA 4N9QA 4RZ3A 5K1ZA 1C4KA 1H66A 4Y1FA 4EY6A 1FK8A 2VA9A 3IOBA 1NLUA 4PLPA 4CTKA 4JI4B 2VDUE 1BJKA 3BJIC 3ZK7A 3RW9A 1XLTC 3GW8A 4V0ME 1ZGCA 2BV3A 2WWYA 3ESYA 1X2EA 1IVNA 3QOYA 1J09A 2ORYA 5BP7A 1Z5OA 5H82A 1UFKA 1VG1A 3BFKA 4FJ1A 3T1QA 1UPCA 4C7XA 4G37A 1ESCA 3KE9A 4HTFB 1Q1BA 4QM7A 3D0RA 4X6UA 4ZI7F 2O06A 4O3MA 4X93A 1A9RA 1PUJA 5DSXA 3T7SA 4MWTA 1RD4A 1Y34E 1J24A 1P19A 1LZLA 1YUMA 5EIWA 2Z08A 4BVEA 4BLQA 2C9DA 3KXLA 4URVR 2FQQA 4HNAA 2NMVA 3EPHA 2XB9A 1VJRA 3GFTA 1KS9A 1C81A 3OM1A 4WNYA 2ZSAA 1QO0A 3WMFA 1L3CA 1U7UA 3VYTB 3E7WA 4H4CA 3FCEA 2XH8A 2ZI4A 2I3ZA 4NMWA 2ZEJA 5EHGA 3PHBE 1TO1E 3VXKA 4RWZA 5LQUA 2XB2A 4HZUA 5D7BA 2ZFUA 3HL0A 1YS1X 3R23A 4ZI2A 4KBFA 2F3TA 1U5AA 2JBAA 3D1LA 1E58A 4P93A 4L9RA 1QS0A 3ZWKA 2VDRB 3E7PA 4I1RA 1LFAA 1GUZA 1OLSB 2PU7A 2RGWA 2VPIA 5F2OA 4B5LA 3TI9A 4TTTS 4Z6KA 2VP4A 1B00A 1WDMA 3FTQA 1UXIA 4JDPA 3OOWA 5HZMA 3G0HA 2GA9A 3P5BA 2VLBA 3GZNB 3MUEA 3BK2A 3WQSB 2W98A 1ZNZA 5BW4A 2ERXA 2I66A 5CT9A 3V4VB 3LM8A 2OQRA 5BN4A 5JCPA 3LH5A 1BRTA 1EE2A 2MSWA 4GGPA 4RUKA 4WSOA 4C01A 1GPMA 5AVQA 1IBCA 1JEQB 3S68A 2ZWMA 1QIMA 3DT9A 5HJEA 4YV0A 3PL1A 1ZA2A 5IWCA 2CW5A 2XXBA 1CJSA 2HQRA 1TJNA 3LQ1A 4C5AA 4EHJA 4ICIA 4D43A 2VDLB 1IUOA 2ES4A 4J0EA 4Y9DA 4PYRA 5AJXA 3IAM6 2X0RA 1XGKA 2QQEA 2N1BA 2GWHA 2C5FA 3AHEA 3HBFA 3URKA 1TGVA 2FETA 3VTKA 4B6SA 1OYYA 3TBHA 4XX1A 1IJBA 1XE3A 2GEUA 4YT2A 4CKWA 3GBVA 3SOZA 5P8WA 4I9FA 4B9AA 1JILA 1H94A 1NVMB 2ENWA 3AOGA 3OOEA 4G8BA 1IJEA 1D07A 3CLRC 3QOXA 3QW2A 5C5DA 1WULS 1R4NB 1ML3A 3LQFA 1T4CA 3HN6A 3THRA 1HDOA 3FWKA 4TV8F 1RZRA 3GGPA 4LGYA 3ZJYA 2QMEA 4HG2A 2RKOA 4EIWA 3MD9A 4D9FA 4IW3B 4LMRA 4DSOA 4BV3A 5BOSB 1VJ5A 3BSSA 1Z6QA 3D8RA 4AX8A 5A4IS 1M2FA 1ULZA 3L4BA 5ALQA 2I6XA 2IEIA 3OECA 2DQKA 2COUA 4TWRA 1KVUA 5CX1B 5KTYA 4I50F 2ICAA 3EWSA 3STHA 4PTLA 3B85A 3DEIA 1CS0B 2C4NA 1DAKA 1O9GA 5LZ2A 1QV9A 3T3NA 1K66A 4W82A 4C2UA 3CB4A 4IP0A 2CJPA 4YWJA 3GRZA 5JNRA 1P2VA 4DB2A 5HRCA 2WQ6A 5FUQA 1OYWA 2R4QA 2IEZA 3NCTA 1VPTA 5DM0A 3HVJA 3JATA 4LXHA 2O8EB 3IMGA 1NAHA 4MTCA 4EJ0A 1GG2A 3D2BA 4M0LA 5JH7F 3OZIA 5FHQA 3P97A 4LZAA 3HZOA 4I2NA 4O8ZA 1GGHA 3TR0A 2JGLA 1ZOPA 1IHXA 1ZVJA 4RPKA 1USUA 3W06A 1CHNA 1VCHA 2W5UA 3AFGA 4WOJA 1GPKA 4H3VA 1RADA 3RHSA 3ISVA 3GYBA 2JG3A 1ZW1A 4BAZA 1DEXA 2LCIA 3O38A 2CJWA 3RC1A 4CKEB 3DHNA 4EQ6A 4NXNB 2YIVX 1LEHA 3KVNA 3ESDA 4RQAA 1XNQB 3CHYA 1BRMA 5ITZB 1Y6ZA 2FPPA 2Q9AA 4I08A 4EL0A 5BWOA 2YYSA 4OO3A 4A8TA 3VJRA 4G2TA 3RTEA 1SHKA 3WKDA 4DWOA 2IDKA 5DTIA 4FFLA 3TLYA 2D1YA 2BKUA 4WK4B 2Q7OE 1SKMA 3GJ5A 3GJYA 2BEWA 1H93A 4IYJA 1GNQA 3AJAA 2RHBA 3DDZX 1U3FA 2PGNA 3CWQA 4P98A 5CVTA 5A7GA 1E4YA 5KJCA 3ILSA 1VJCA 3VNAA 2OSVA 1LI4A 1M5TA 2VQ6A 5HG0A 2C4KA 3STWA 2W2LA 4ARVA 4DGSA 4ENQA 5IN4A 3C45A 4K9MA 1BN7A 4G5YA 1DC4A 3LPAA 5CFPA 3N70A 1QAQA 4MWCA 1XWWA 2GEDA 2ZUTA 1OH5A 5A02A 4TWZA 9LDBA 2G82A 3E9CA 4BNLA 3CVJA 3TGWA 4UTXA 2V7QD 4E51A 5ALJA 3T34A 3A6FA 2B4RO 2Q3HA 2Y8EA 1NONA 4TKZA 4FDMA 3UJ8A 2XQIA 3FSEA 1WQ1R 3AR3A 3RROA 3QFTA 3IDOA 1Z2AA 1WOYA 3LLCA 5B3JC 1Q77A 4A6DA 4BS9A 5BQ3A 3GBSA 4EUSA 2Y0DA 3EW9A 3MRTA 2DBQA 1OGIA 2GYYA 2H17A 3DBRB 4OFXA 1DAIA 2FRXA 3HKDA 4U3JB 3ZJ5A 5DOVA 521PA 3HWX1 2IEGA 3B51X 4D96A 2XLCA 2XRZA 3DOFA 4WIAA 1GYRA 1W93A 2G0TA 5C46F 4G4IA 1KOJA 2I1VB 3T3MB 4LMAA 1E0DA 1EQUA 1N2OA 3AVWA 3CV3A 2XIJA 4QA9A 5ALHA 3TM4A 2ID4A 3G9UA 1ZKMA 3GLHE 3ND8A 4KBYA 3KETA 1UCFA 2L82A 4D3FA 3DQPA 1KDZA 4B47A 4DM3A 2DHQA 4ZVVA 1PSZA 4IDHA 2ID9A 5JIBA 1XDBA 1QDEA 4HNGA 2ASEA 1FFWA 5ENVA 2OV8A 1F8UA 4XYLA 4DR5B 4US0R 1SXJA 4ZJYA 5CEFA 2R6ZA 4OG2A 5DX0A 1X3SA 3R6LA 1PZHA 4PHTA 3UK1A 5AUOB 1IHYA 5I9LA 2Q45A 2R8OA 1ZUD1 3CZRA 1DC7A 3NH9A 2R65A 3Q0IA 4H18A 4O08A 5EIXA 2BCEA 2H3EA 2OO3A 4EY5A 3ND9A 4AJIA 3NXSA 3HDVA 4G3XA 5DF1A 4EHDA 4O1MA 3SWWA 4PC3A 2P9YA 1KI7A 5EG5A 2IPLA 4O8CA 4HO1X 2PIDA 3R0ZA 1ZKDA 3QPBA 4YP1A 3FUUA 3VO8A 3LVQE 3IDFA 3BWXA 1C80A 2QF7A 5SYNA 4LOHA 2AOUB 1ORDA 4NSNA 3WIVA 3TD2A 1DRJA 1VPLA 4DPLA 3CPEA 1OBOA 4IIHA 4PYLA 4FYPA 4H1WA 4Q4JB 4EEXA 3DO6A 2LVBA 3ZQUA 5F1KA 3QEKA 3S28A 4BP3A 2GAFA 3T9EA 1TMOA 2EL9A 1ZI6A 3D4OA 3M34A 2GHTA 2CHQA 2CMKA 1PLLA 1KYWA 2YY6A 4F3RA 1MB4A 3ZGNA 1VKZA 2WWGA 3D7LA 4JXKA 3CXRA 4LMBA 3QBJA 2VAVA 3PWZA 3IQXA 1EMDA 1ECCA 4LK3A 3ZXSA 1MQ8B 2RHMA 3DCYA 3DUFA 3ASVA 2QAGA 5D3QA 4F6RA 5KNBA 4TS4A 3THXA 1MH9A 2XODA 3GARA 1ETHA 2HYDA 4R2WA 4W5RA 1SXPA 2P3SA 4J1TC 3MTIA 5CB0A 4Z0HO 4ZZ3A 3NHLA 3Q7TA 4HV4A 3CFYA 4MKXA 1D4FA 5C3UA 1YK1A 2GF9A 3TOZA 2ZLBA 2OUKA 2C29D 1NBMD 3ZU6A 1VHWA 4K6CA 1DTSA 5JCJA 3TW0A 1T5HX 4HLUA 4Y7DA 5JAZA 4PZPA 5B12A 1KYTA 4B46A 1HV8A 4UTPA 3OM0A 1B6SA 2P40A 5C7LO 5F2NA 3CKKA 4OX9B 4IH1A 4IZHA 4N8EA 5FWXA 5DVZA 1XRNA 3CE6A 3DAPA 5DBOA 2O0HA 3G89A 4YMWA 5FP0A 4CLDA 2B4YA 4PLTA 5AKEA 4PPNA 2EF1A 1C29B 1D7AA 2Z58A 4HGYA 3JQGA 3VU9B 2C96A 4KI0A 5I5GA 1RXUA 2BP7B 3KYCB 3KVRA 2J9FB 1PEKE 3U60B 4F9TA 1U8ZA 2VUSA 2NLOA 4G8JA 1YTUA 3T9AA 3BA1A 1SVKA 2PYZA 4WADA 1DP4A 1MV5A 1Y5RA 3KKQA 2ZAOA 4KQXA 3WQHA 5AVUA 1GU1A 1OH7A 2ZWPA 1VCMA 4X24A 2JLYA 2VDQB 3UW1A 2NUTA 4C21A 4B76A 3CVXA 5K5EA 1ZH6A 5DASA 4EA7A 3GJSA 1EE9A 3PV0A 1X2BA 4FONA 3PHCA 2FPPB 3HM9A 1E8DA 1RYBA 3LA6A 1M1NA 4FD3A 4LJKA 3SZUA 4L5YA 2BGJA 2HHLA 3ND6A 5H7XA 5CFZA 1RLUA 3P9YA 3G17A 1P1KA 4IJQA 3RUFA 4DHEA 4YTEA 1U94A 5BMVB 4IDQA 2HCTA 2ZBUA 5F23A 2X1HA 3JSXA 3OP4A 3N5CA 1JA0A 1EPUA 4IWNA 3A1FA 1L5RA 1XUOA 1E61A 4QL3A 3HGQA 4R1PA 5T3UA 3RKRA 2B7LA 1BNCA 1CQXA 3CW8X 1ID8A 3PUXA 2ZBGA 3COWA 2Z9CA 2Q6VA 3L18A 4IMJB 1NMSA 2ABWA 3D31A 2DBRA 1OJLA 3IAS6 4FCWA 3O0TA 4Y1RB 1PLKA 4P5DA 5KSZA 3CLRD 2H52A 2ZAMA 1OFTA 1MX1A 5FTKA 2WAOA 2BGUA 4MPTA 1OPXA 4YRPA 5DGXA 2OORC 2WKWA 2IU4A 2VS1A 3IS3A 3B8HA 1Z6ZA 2EW2A 3BIXA 3LRTA 2ODWA 1XA0A 2X0IA 4LWQA 4NF2A 4O59O 1GUDA 3AG5A 4RXMA 3BGSA 5C8DA 1JIVA 2O7VA 5FAXA 4IILA 2XNSA 4AF7A 2PKWA 2VH2A 4HB3A 1SUIA 2GRJA 5K0SA 3U4DA 5JASA 5IDQA 2INGX 2SCUB 3UGTA 2WILA 5EEHA 3O21A 5K0EA 2PSFA 2WA2A 4GXQA 1C50A 3SHFA 4DJFC 1ZK2A 2G9QA 1DXQA 1T2CA 1C9KA 3STYA 2JGKA 5EZ5A 3U4QB 1M9NA 1JT9A 5IXJA 4ERXA 1UPXA 2IHVA 1M8FA 3ZWMA 4C4YA 3KTDA 1TM2A 3NM4A 2R8YA 3ZCVA 2FSSA 3A9RA 2HB6A 1GFSA 2W90A 4AZ3B 1UQTA 3K70B 2PRKA 4O2BF 1IUPA 2AC7A 1IBRA 1KMQA 2GPTA 2WVGA 3A25A 4GPTA 4M4SA 4KVFA 4RZHA 3HRKA 2J87A 1YBHA 3OQ1A 3F2VA 4FXPA 1QPBA 3WAKA 4C4SA 2GAOA 5AHWA 4HNTA 5DW3A 5KDOA 3ETLA 2JRLA 4DR2B 1KMNA 4ITVA 4MDEA 1S8OA 1UM9A 5J59A 1KY4A 2VO1A 2GZRA 2VF2A 3CX6A 3NI2A 4B43A 1YMQA 1SZDA 3MWJA 3OFJA 2JFQA 3G88A 2FPRA 3CMCO 3D54D 1F2UA 4R7TA 3KQWA 3QEMA 1OKKD 1MD9A 2DFTA 2A78A 1U7XA 2QUBA 2WYWA 2QKYA 4L8WB 4DG9A 3FPGA 4E2FA 2AOTB 5BWLA 3FDIA 4GIBA 4GPZA 4P86A 1S96A 5GOZA 1SKAA 3ZI0A 3DE6X 4D5EA 1E32A 4LOAA 3OPXA 4RY2A 3PK0A 4G5HA 2GUWA 5AVXA 4DA7A 3OU2A 1K6MA 1S8AA 4Q3CA 1SQSA 3IOYA 4JZKA 1C3LA 1G6HA 1RAAA 4RPCA 4ETWA 4CF7A 3DTVD 4DV1B 1H2XA 4ILKA 2Q1YA 1YR8A 5DLPA 1MV8A 1TO2E 3ZD6A 2IL1A 2C2HA 3LFTA 2GJKA 4DEXA 5JU6A 1EUZA 2HH9A 2NTNA 4MVJF 1G66A 4YI5A 1SVIA 1Z4KA 1YGYA 2LDXA 4O1IA 4EW2A 4MW6A 4YMHA 2X2EA 2WFLA 2DBYA 2FSVA 5EQFA 2BR4A 4MW7A 3TW8A 1YZQA 3R3VA 4LPKA 2IQIA 3T1YB 4BQNA 1L7NA 4GEGA 4DKXA 4NYMR 5KTMA 5DXAA 2HPVA 3WK4A 2FOIA 2WKPA 3RRNA 3AVYA 4PVDA 2C0PA 3DB1A 5CVCA 4B0OA 5HIKA 5YASA 2VN8A 4ZI7A 4P83A 2BRUC 4RTLA 1GITA 1Z2PX 2I7DA 4BGVA 3W5HA 3OEHD 1JKFA 1WHTA 5JCJD 1DX6A 2QE7A 3D3QA 4GKBA 3OQVA 4ENTA 5IDYA 1CRZA 1ZFNA 4K28A 4LI3X 2X19A 2BHRA 4DNQA 4AZSA 2I91A 2XYGA 1F6WA 1ONSA 3N8KA 3DDNA 1Z2EA 3F74A 3L3BA 4YALA 5IVIA 1RYZA 5B3AA 4CHGA 3AXTA 1VL5A 4J49A 3HI4A 1TFUA 2IODA 1G21B 1Z28A 2Q5CA 1JG2A 4EZIA 3WQRA 3PUWA 3T1NA 3FTNA 1UMDB 3DM9B 4TUYF 5CFRA 2CNWA 5CU7A 3BH6A 3CINA 3QLUA 4IBOA 3MYYA 3JVEA 4XUDA 2GTHA 3D81A 1M33A 1PWXA 3OEWA 4GLOA 1AKMA 4V2IA 3MM4A 3COZA 1S2IA 3TJRA 5G4KA 2DAPA 4UFOA 1O96A 4Q18A 1TNDA 1YKFA 4X6LA 1NN1A 3W77A 2QTNA 2ZJ6A 4MKGA 4MVWA 4YIKA 4ZVSA 4AXBA 2XLBA 1WRBA 4U7TB 3F78A 5AVJA 3KHKA 4NEQA 4PO9A 4ZALA 3LKDA 5TC4A 2DQ4A 3HYSA 3TZLA 3LLUA 1QONA 5GZ1A 3AJDA 3IPXA 3FKSD 4BPRA 4ZDWA 4Q0MA 2O2ZA 1UMBB 4K8RB 1ZNQO 5FKJA 2J3LA 4I5EA 3GOHA 2GCPA 3UM9A 4HS4A 1OV6A 4IDGA 5G3YA 2OXTA 2LRHA 3KUDA 5L6MB 4MH0R 4O0MA 3QA9A 2P67A 3BL8A 2GPWA 3TRHA 4F4DA 2GARA 2ZI7A 1M2JA 4PQFA 1K5PA 2W0SA 1X38A 1WMSA 4O4IF 2G8LA 3ZVNA 1II9A 3IP8A 3DOHA 4QBFA 3WB0A 1O4WA 3TYXA 3LPMA 2ZTVA 2BMJA 3TE6A 5JY1A 1R50A 5K0GA 3ZGLA 1CU1A 2JB9A 1RJWA 3EGIA 5JSFA 4AKGA 1SHUX 4RM3A 1XTQA 1TEHA 4KQ2A 4ZYVA 2E4YA 4MS1A 3IL2A 1WXGA 3LTNC 4ZYZA 1NG1A 4JT8A 4ETMA 1W44A 3C3JA 1ZAYA 4NONA 1HE3A 4LKRA 3K1ZA 1SKBA 4J7XA 1DEOA 3A1UA 2R8PA 1KU6A 3CH5A 3UYKA 4C6HA 2XWPA 1Q92A 2ZCVA 3ZXIA 3P1JA 4S0XA 5AQ1A 1KYYA 3TMKA 2D00A 2QL5A 3ZWDA 1AKNA 1ADYA 2ZR9A 3E0XA 5CNKA 2FWBA 2IJGX 4J0GA 2ZUWA 4BX9A 4TRNA 5LZ9A 3RWOA 2PKXA 1BX1A 1DV2A 3KUUA 5ITSA 1T8RA 1TKBA 3BTSA 3ZQ4A 4BMPB 1U80A 3GA5A 4BMYA 1KNQA 4Q47A 4S1WA 2OVBA 2QTGA 3CWCA 4O4LF 1GPDG 4JMLA 4CKCB 1K8ZB 2QRQA 4DCJA 1CVRA 5IABA 3LP8A 5BV2P 5L51A 5L45A 5CIYA 2ZJ3A 2OFPA 3HGTA 1U9IA 4W8GA 5CT4A 1QQ6A 3F98A 1LVUA 3IJRA 3OFNA 3TW6A 4TS3A 3ONWA 4DLKA 2SNIE 5JH7A 4ZRMA 2RGGA 4ZI7B 1Z2DA 2C2BA 1PDWA 3TVYA 1DKPA 2EF0A 2PVSA 1VL8A 2HDOA 3E3MA 3TCXB 1KEVA 3C8ZA 3NKLA 1MF7A 1I3LA 2H1LA 2JIBA 4H4DA 1ST3A 1NJ8A 3LC7O 2A35A 3WNZA 1X9IA 4HEQA 3EFOA 3SYMA 4GP9A 2WHPB 1XPJA 1FXUA 1RC8A 3JASB 4FLEA 1BE8A 2IY9A 4UUBA 4KLRA 5FBVB 3PVSA 4U2GA 2M6KA 4PLWA 1CUXA 4UAVA 1GTL1 5BPHA 4WXHA 3W3AH 1SBTA 1Q7CA 2AN4A 3LO5A 1ZZGA 5F5NA 3SK0A 3C24A 3TUJC 1HK7A 1JTFA 2WSSD 4AN0A 2Z6QA 1C30B 1UPTA 2VHZA 4WKOA 3AB8A 1FU8A 4YCBA 2GBPA 4NZ9A 4CU5A 5KOHB 4OFWA 4P81A 1W0KA 3AIOA 1B43A 4AN1A 1OBFO 5FV7A 2IUUA 3E9MA 1EFHA 1JLKA 1U31A 4MUBA 4W1SA 1ZI8A 2QAGB 3KZVA 4A8HA 5AVKA 1MAHA 3T4UA 2Q5JA 1E3QA 4EJSC 4G65A 3ZW7A 3RU3A 2ORIA 2XEDA 3EF1A 3O73A 3O82A 1X74A 3QY0A 3V4SA 1FDOA 1H2EA 3BCSA 2ZYVX 4GQAA 2ODNA 5F1PA 3FTPA 3UV6A 3R7WA 1GAJA 4CGZA 1J2TA 1W73A 5EIBD 1TW2A 5ELMA 1UMBA 1DTWB 3Q1LA 4CLOB 2AD5A 3KQOA 4WINA 5EKUA 2BMVA 2QTAA 2VFAA 1FW8A 3JY6A 4HNAB 5ALFA 1JAIA 1T36A 4F1JA 2JBHA 3IKTA 1M2NA 4M8IA 4B3CA 1PR1A 1ISIA 5JVDB 1ZM4A 1SBZA 2FRDA 3DA8A 3O2SB 4LYAA 4ZAFA 3TAXA 2GZMA 4MRPA 2OT3B 3K96A 5B1DA 4TM8A 2Z9DA 4G2NA 4YRDA 5AK4A 1K86A 2WM9B 4QUAA 4V0SA 4QQFA 1TYCA 5IMBA 1Y8QA 2QM8A 3F6CA 1T8UA 1RQXA 1VMIA 3RSFA 4WCDA 1J06A 5KOIA 4X1IA 3SC4A 5JISA 4BRUA 1K2VN 1SU7A 4F71A 1L3IA 2FEWB 3IUQA 1NBMA 4JGIA 3H0KA 3FRJA 3ITEA 1P3JA 5AOBA 5CLIA 4N6GA 4B7XA 2H2FA 4CL3A 3K92A 1GJRA 2ZRHA 3UKJA 2ZUFA 2JAWA 1YCFA 2PGDA 2YMPA 1GUYA 1L5GB 2H5EA 3R7NA 5CDFE 2QJFA 4C9BA 4MHOA 1RXYA 3MFYA 4GH5A 1XVLA 2XDAA 2XI4A 2CE7A 3BCUA 1NNUA 2XZTA 1WV0A 2PT9A 1K7SN 2PH3A 4Z8XA 1MC1A 2FVXA 3GGSA 5DP1A 4XX0B 4B2PA 1Z16A 2FFHA 4TM7A 3SHVA 4M98A 1PGOA 2ZITA 4U9UA 5JC8A 4P8RA 4B3IA 1FUEA 1C0IA 1FSFA 2RBGA 3KKZA 2P0AA 5TB5A 1I1OA 2XNKA 2GKGA 4ZYUA 3GG2A 3JD2A 3TEJA 4D3YA 2VBCA 2WSYB 4GGOA 1CK4A 2IVFA 2HNBA 4LOIA 5EGSA 3LOPA 5DW0A 1KR2A 4TTVA 1JTVA 2V9ZA 3ED1A 4QATA 1VZ2A 2RI0A 3SFVA 2VP2A 1MEOA 4W99A 2Y1EA 4FCCA 4IDAA 2JLWA 4S2UA 3CT6A 1WKBA 3RS0A 3GMIA 1J0AA 2GCOB 5DM70 1SC3A 4I0WB 5T4HA 1KZ6A 1ZCFA 3C6BA 4MMZB 4P7FA 4TQ9A 4I50B 4LG1A 2L17A 4A2CA 4W63A 3G5UA 4J9UE 4B6JA 2WF8A 1GLGA 2XA2A 3TNYA 5T4BA 3C6ZA 5C7IO 2OBXA 1P7YA 4D9KA 3E5NA 3PXGA 3T7AA 4KGVA 1E79A 1PHPA 1U5BB 4HQKA 3UMCA 2P4UA 3EUEA 4WFKA 3SHOA 3UFXA 3CGGA 2PS0A 3ONVA 1VLQA 2G5GX 4Q1VA 4D56A 4XWGA 2CMFA 4CEJA 1J8FA 2A0UA 5ISMA 4QPNA 4MQEB 1Y7HA 3RRJA 3GJ8A 4PRKA 2RK3A 3CX7A 3IILA 4M9RA 1RWPA 4F46A 1V71A 1X1RA 2COEA 4W7HA 5F1OA 4JBLA 4E11A 3V1MA 3LS2A 1ONBA 4H9GA 2VNJA 2XZDA 5GONA 3DEHA 5F33A 1U1EA 3D4IA 4BQOA 2UU9B 5SY4A 2H1FA 1Z47A 2FPIA 3C5VA 3IPYA 1MIHA 4OQLA 1N1GA 1P7CA 2ZRPA 1IHUA 3HN7A 2P4SA 4ZCRA 2HA3A 5KVAA 3A05A 3AINA 4FWBA 2EQ5A 1GADO 2WQZA 1QTRA 3Q98A 2UZ3A 1DKRA 3MIIA 2G5PA 3W8FA 1UDCA 1AXRA 1BFKA 3QU9A 4NMHA 4X94A 4EYGA 4XARA 4ZO6A 5LA6B 2AA3A 3U7JA 1TECE 2MR5A 1JJVA 1OIXA 3A2LA 5H68A 1QFSA 4EG1A 3ZWXA 3FCUB 1KSGA 1QGAA 1SQ6A 1UP7A 3B1WA 3WRVA 1P7ZA 1NXVA 4EI9A 2E5FA 4YN3A 1C7ZA 1PN3A 1DARA 2B1RA 3I1YA 4J6FA 4KLNA 1M0TA 1E66A 1XZFA 4M8KA 3O4HA 2AR7A 2ZRBA 3NXKA 1ZYUA 2NTEA 2D7CA 4X41A 2ANCA 2NGRA 5DISB 3VHLB 1D2GA 1U2GC 3OT5A 2IOHA 4LRWA 4OUDA 1SIBE 5L4NA 3HUTA 1L4FA 2H7XA 4K6OA 3A8TA 2I29A 5H4HA 3KVOA 1VE9A 4DMRA 4ZYYA 4QM6A 4Z7QB 4BE4A 4ZICA 3GP3A 3SZOA 1U0TA 1TUEA 1SD2A 1Q0RA 1G9XA 1GUFA 1QKIA 1SVUA 2M32A 3GEEA 3KXIA 1GAQA 4YS6A 3OIDA 4CG0A 3RYHA 2XUKA 4TZ6A 1ODIA 5IM5A 4WL0A 3TIFA 3UANA 3I4CA 5CYGA 5AQEA 4AKTA 3OCUA 3DDSA 3G2HA 3DPUA 5A3VA 5KAMA 3VR5D 4FS3A 2B92A 4JOQA 1NDHA 3UMVA 2EP7A 1DQPA 4ZAWA 3WWDA 1YVUA 1VPWA 5KNCA 1IEWA 5A4AA 1D03A 1N3YA 2W42A 1UIMA 2ID8A 3BXZA 4BAGA 3UBTA 2G83A 1WPRA 2IFTA 2PBZA 3NC0C 3R8FA 1FP4B 2X5KO 2RC6A 2WWHA 4L27A 2UYQA 1XNJA 1N2SA 2ZANA 4EITA 2VRNA 3GA7A 4HGRA 1SWWA 1B8NA 4Q7KA 4BLWA 3HNRA 2GD6A 2ROQA 1F6BA 1RABA 2W2LD 2WPNA 3DMTC 1B1CA 1VIVA 3LP5A 4MS4B 4KMMA 2B2NA 2Q5QA 2P91A 1ZM3A 3N2EA 2CXQA 1JJAA 2NO9A 4BC0A 3PPWA 3WSTA 2AXPA 3D4BA 4IDEA 1HDZA 4JSYA 4LJ5A 1COZA 3F9IA 1L8LA 2SECE 3QIAA 1NM5A 3VBEA 4C3OB 3ICQB 1UDAA 2HLNA 2ZJ7A 4ECAA 1U2GA 3OD5A 4LVOA 1IZ7A 3LOQA 4TTAA 3ZU5A 3IDSA 3VR4A 3R2JA 3JR3A 1PR6A 1ADFA 5BQFA 4L72A 3IFSA 4MW0A 4N82A 4QYSA 4O4IB 5BORA 2VHVA 3GVCA 4FTWA 1XZKA 3HTXA 2NP6A 2CXSA 4K9OA 4Y3UA 2XYRA 3D5TA 5TPZA 4A2QA 2ZRFA 3G9QA 3HDTA 1Y3BE 4X8MA 1USGA 3IUNA 1TIKA 4C87A 1YZNA 5CPFA 1OLUA 3RSZA 2WUDA 4CUKA 3I53A 4LRUA 4BV9A 4F1WA 1H0KA 4OM7A 1QORA 2QM7A 1M2VA 5EFZA 4E4TA 2G9RA 1D6MA 3DKIA 3HJGA 3P0EA 4K9PA 4DY6A 4EB3A 3KKMA 5CA1B 2CL7X 3BMCB 3LQQA 1NKTA 1ISPA 3K0KA 2QLTA 3L8EA 4NI5A 4Q9JA 2CL6X 4I55A 1K08A 4FGKA 4HLCA 2WIBA 1XZQA 4JBGA 4O5OA 4Y9UA 4N12A 3VNQA 4PCLA 1LCIA 2B99A 4LXGA 4L08A 3WL7A 4URZR 4BNYA 2NQ2C 1U98A 1K8XB 5DGIA 1CRQA 4NPAA 3KR2A 3BCRA 3SN6A 2VZ9A 2AMVA 4FDUA 2FPGA 4IEIA 4ZEOA 3DUFB 4CLEA 1VI5A 3TNFA 3VAYA 4D8VA 4DTIA 4RK7A 1T34A 5EHQA 5AVYA 4URUR 1JJ7A 3QX8A 5IJ9B 5IUKC 3UG7A 4F85A 1FRZA 4O4LB 2CBGA 2XWSA 1XZGA 2RAFA 1AU9A 3U5ZB 1G8JA 3AX6A 1JSXA 3MERA 2W70A 4D97A 4DSUA 2HBRA 2ID7A 3ZCPA 2CDRA 1W46A 3SICE 3SLKA 2GRAA 3M7IA 3S2SA 5AM2A 1FMLA 1CERA 1P3Y1 2AFHB 3UAWA 1NN5A 2PT5A 4EEKA 1YOVB 3FNHA 4HH1A 5EJEA 5AW0A 5GIPE 4H0FA 5B1HA 1QK3A 3MWFA 5GONB 1HZZC 2YJNA 1BU5A 1KMHA 3K7EA 2PS3A 4BV8A 2HLHA 4Y2YA 2LIPA 4KO4S 1LDYA 4CMIB 3NVAA 2QVZX 2ZR8A 3PX7A 5HEKA 3DLBA 4OI4A 3S70A 2XUAA 3VGPA 4F21A 3ZVLA 3EEOA 1X0VA 2AFIA 4OATA 3G5LA 3WGLA 4E15A 5JD5A 2HU8A 3U6KA 3VTZA 1N36B 1WVMA 4WBSA 1AN0A 3DBRA 2A14A 3WK6A 4FOLA 4UZFA 1ZJWA 1RWVA 4QELA 3TLXA 1T0JB 3VH1A 2QN9A 1T2AA 3TNLA 4QULA 3LV8A 3D64A 1AD2A 2R7KA 4MUYA 2A5YB 5SZHB 5JBQA 5C81A 3IESA 5H4GA 1DAMA 5ALYA 2CLDX 2GEBA 3HB9A 5I7RA 1XMQB 4G0VA 2PRYA 4DS3A 2EFHB 3O4VA 4H7DA 1EVIA 4HFJA 1XMIA 3ZCRA 2UXDB 5G0WA 3NKVA 1XA4A 3DCIA 3Q5EA 2DX7A 4ZJUA 3CX8A 4XWWA 2O3TA 1BKYA 4GLJA 4PFJA 4AL4A 4PM4A 3CYFA 4KOAA 3C6MA 1OILA 2Q5FA 2JHPA 5FBHA 3HXMA 4DWJA 3HDGA 2C3MA 5DX8A 1IPFA 1FDRA 2V98A 2XWBF 3E18A 3L8YA 3NV9A 1Y63A 3KEGA 5HBGA 1KE2A 2R8RA 3V7UA 3B7GA 1WU7A 3RT9A 3CEAA 4Y6GB 2R6JA 4EWLA 1DPGA 1EVEA 4IV5A 4JLMA 3VR5H 5K0JA 2A4KA 2V5AA 4L07A 2YASA 1YCHA 2YS6A 4W9RA 1AXGA 5L7WA 1W88A 1XMXA 3HSKA 1STOA 1OKKA 2CK3A 2ERYA 2GM3A 3D6AA 3LBNA 1GR1A 1P9LA 4LIPD 5B7GA 4LHYA 5KQSA 1BVHA 1Z13A 4PWYA 4D9MA 3V4RA 1F6DA 2OQVA 3SGLA 4ML3A 3DKRA 2WJIA 4Z53A 3RI3A 1JR2A 3VZBA 4NU0A 1J9GA 5BWNA 4AG6A 2XUIA 2G80A 4G89A 4JIMA 4JI6B 2C92A 3U13A 3ANYB 3PLAE 1IWPB 2E89A 4WUTA 4U4AA 1K8YB 1TU0A 2QYOA 4QJ5A 2ADOA 1Z07A 2CNLA 5F7JA 5C1BA 1AT1A 2Q4RA 3KLPX 1W94A 4OQZA 1L5FA 2I2FA 4MP3A 1KKUA 1EUDB 4HWRA 3IIIA 3M6AA 4REMA 1RJ9B 4WKGA 5BW6B 2WHRA 3VO1A 3HV0A 5ALOA 3O91A 5K3FB 3GLTA 4UUOA 3C3PA 3IR7A 4R2MA 1WKVA 4OXNA 3CONA 5HR5A 3D6FA 2W4MA 2D8AA 2CMHA 3K8QA 2BW0A 4F86A 1T5LA 1NC3A 4RE6A 5A4DA 3X2FA 5KYNA 1Q21A 5MF6A 3G0OA 2I67A 1M2OB 2AJBA 4M83A 3AHHA 4BY9E 3MMPA 4BYMA 1NUUA 1U0LA 4XSVA 3OO1A 2FSIA 4RJIA 3HJRA 4LFBB 3PQ3A 3QWHA 4XWYA 1K7FB 3GROA 4E3ZA 2YS7A 3MELA 3MYRA 1FZTA 5C8YF 3ZDDA 2EJCA 2BR5A 3GC6A 4YYZA 1RHKA 3DDWA 4JJGA 1AUXA 2AZDA 3F3KA 5CD1A 1HNZB 1N5KA 2WV7A 1VMKA 1E1RA 2CEKA 5BV0A 3L4JA 4BLSA 1KMMA 5HWSA 2DB3A 2H59A 5AJYA 5AI8A 4W8OA 4L74A 4CLOA 1IEQA 1E2FA 2MSEB 2YZKA 3WDMA 4FP9A 2CT8A 1GNVA 1O95A 2NO1A 2H92A 1N6RA 2Y71A 2YV5A 5ITWA 4XGQA 4K5QA 4DAOA 1JEEA 3NCHA 4NYIQ 1H8ED 5KTRA 4DR6B 2QTLA 1NRIA 4G0UA 1P62B 1YJAA 4G1VA 1XKXA 2YVQA 2FUCA 3ZHVA 2ZUSA 4H15A 1QF7A 2OECA 2UYOA 1XR3A 1HY3A 1W5FA 2CFOA 2VT7A 3W6PA 2DUWA 3EDQA 3U09A 2G5TA 2PGXA 4JP2A 2ZTMA 4JZYA 1JB9A 2O52A 1DJNA 3OT4A 2R47A 2C88A 3H6GA 1X77A 1S2OA 1RXCA 3HCFA 2WWFA 4Q48A 3WGGA 3K0HA 1XJ0A 3RE1A 3ZGVA 4BMNA 4DLTA 3GRCA 5BSFA 1XOIA 4DSZA 3U3JA 3TRJA 5I01A 5J2TF 4PYJA 2PL5A 2WF9A 5EXDA 2JGFA 2VIIA 3AY6A 2AE2A 3T3EA 4ZAYA 4I19A 5JEDA 1CUHA 5KHAA 5DH9A 3BD6A 1PWZA 2CVFA 3H2HA 2ZIFA 3LSTA 4X92A 4QJ3A 5TT0A 4AY3A 4XA8A 2WWVD 5HS4A 3DE4X 4PNEA 1KMHB 3N1UA 2O8FA 1RQ2A 3FSRA 4M1YA 1Z7YA 2GN8A 3DBLA 4FT4A 3GEHA 2HCRA 1BHO1 3HXKA 1ADBA 3D8HA 4JYPA 3AY3A 4ESOA 3VPBA 2PUFA 2QMOA 3SHQA 2C8KA 4R83A 4QO8A 4FYHA 1L4NA 1KEWA 1ZK1A 1YAHA 3OQJA 1SK9A 3TTSA 4DUGA 1RM0A 1TQDA 1SUWA 4P4UA 4GOJA 1EUYA 2WFZA 1UODA 4YXWD 3ZJ4A 4S2EA 2PUVA 3RVRA 1I51A 3D7SA 1PWYE 1XYGA 1US8B 4R9RA 3T3HA 5EIOA 3NYIA 1PUXA 4KXNA 5EMNA 3SMVA 2VXOA 1P1RA 2QUZA 2X6RA 3B82A 4H6PA 3LZCA 2ZWIA 2AT1A 3QWFA 4R81A 4BZZA 4YAIA 5BRJA 1YA6A 2IZ1A 1SUDA 4WOCA 5B7QA 1QNLA 1Z8HA 1NURA 2BM8A 4ND3A 3SFTA 2CEAA 2GK6A 3M6XA 1E2UA 2QD5A 1I7QB 1VE6A 1KS2A 4HHEA 4HDMA 3N6RA 1N2CB 2C5SA 3Q9LA 3QLUC 4A8JC 4B84A 3W8NA 3K9WA 2QT1A 2LE0A 2BBOA 1Z5GA 3N58A 3O4RA 2DHRA 3NDJA 5HX7A 1WXDA 2NZWA 1MQAA 3NVDA 1G6OA 3TXXA 2EP5A 3F9CA 2GTIA 3H3FA 4FEYA 4KGDA 1UBEA 2NTYC 3F46A 3INYA 3ILVA 2O7NA 1QIEA 3MWLA 5DLEA 2JFUA 3TH5A 1LDBA 3Q8XB 2Z5VA 5FBLB 1H2BA 1AHIA 1H2RS 2X2FA 1XZJA 3FWPA 3IQIX 3ORHA 4PGHA 1P1CA 1W49A 2JFFA 5IARA 1KI8A 1YUNA 2OHVA 3K6RA 3SSOA 2DQYA 3R7AA 4GVXA 4ZU1X 1OWLA 2QAIA 1NY6A 4RHTA 2DFLA 1O03A 2PZGA 3CUSA 3WXMA 4DLYA 4F5WA 4X60A 4A8JA 4B2IA 4DDVA 1SU4A 3IA7A 2O1XA 3H4TA 4EB6A 3MT7A 4UAGA 4X1KA 4Y2TA 1KYVA 4K6KA 2X58A 2QUJA 4KR7A 1Y98A 4C04A 5KYXB 1KI9A 1OI4A 5JECA 3ICEA 4OLJA 2OV6A 3BERA 1KEEB 2ZJFA 3NR2A 3U1VA 2G17A 1VB5A 1YQUA 5DCWA 1CTQA 1NTOA 3O9MA 4UUQA 2Q41A 4X66B 1TLFA 1DG9A 1UC4B 4J4HA 4GRDA 4PQGA 1M7HA 3DEYX 5TF0A 2D1FA 1JMVA 1MFZA 4TLBA 1ODJA 1AVTA 3DXYA 3NU1A 2HUNA 4WX2B 1MJGM 2J9RA 2VJBA 3MRXA 4D0NA 3A6ZA 1G9TA 2D5IA 4BDSA 5ILOA 4RKWA 1QZZA 5AWFC 4NC9A 3SJUA 5IHXA 4PZLA 1RIFA 3DZ8A 3G0DA 4P4SB 1AGXA 1NE2A 4BP8A 1E2HA 1E6MA 4ZZ1A 5DIZA 5HTOA 1GLVA 1FU7A 4FDLA 3GEPA 4MVJD 5LU8A 2YIJA 3KT6A 3JQBA 4S24A 2ECOA 1EP3B 3JARB 4DR7B 4CM3A 2H4HA 2XQJA 3ZY2A 4BO0A 3F96A 3WY9A 5EMJA 4Q4AA 1QPGA 3I5AA 2QL7A 3I2JA 3DFKA 4QDJA 1Y1KE 1QP0A 3PZBA 3RGGA 4S04A 4DIMA 4R1NA 3GLVA 3M70A 1T5TA 1T6ZA 5JPDA 2PEYA 3GEMA 1W2HA 1THMA 4GE0A 3QXSA 4IDCA 1J1ZA 1LB1B 1VSVA 2Q27A 3OU7A 4QPCA 1Q7RA 3I6YA 1RJFA 5EA2A 2NO6A 1OXKB 2IYOA 3IQDB 4OHFA 1U1IA 1WXQA 1A7JA 3CR3C 3G2QA 3N53A 2AUMA 1B74A 2VTKA 4IUCS 3AR2A 4KJZA 5LNK6 5HKLA 5L3RA 1BCSB 1L6IA 5JXGA 1G5FA 3U16A 5TEVA 1BKDR 3VC1A 1NNEA 2A1UB 5FO0A 5ESDA 2FPUA 3PUJA 4A9AA 3VZRA 2G88A 4I50A 4QXPA 2GFQA 5GQSA 7REQA 3TVDA 4KFSA 5BN1A 2GO1A 4EKEA 4M21A 4KQ6A 4UTOA 1DZ3A 1I7LA 2GK4A 1QZXA 4GXTA 3DZJA 1J8VA 1E9FA 4XIGS 1PFGA 5EHIA 2GK3A 3AVXA 2BL4A 2C0CA 3HWRA 4AKEA 4YQFA 1QX3A 4ZC8A 3NJ4A 3WOHA 5A4MS 4D6YA 4R3UC 4WFIA 2RHRA 2ZCJA 3SVTA 1MENA 1SRQA 3AYZB 4MB6A 2FUG1 4MGEA 4RDIA 4CW7A 1ACMA 4YXFA 3N8HA 4LHEA 1A1VA 2AN5A 1TM1E 1TTQB 2QN2A 4PZDA 3JQBC 2QVLA 5IFLA 3W7BA 2UVPA 2HMWA 2DR2A 3HI6A 2R6DA 3H65A 3ITNA 1N8SA 2CLHB 2YY5A 3WMEA 5IRCD 4DV5B 3KQVA 4IVRA 1V43A 4ZI5A 4BAUA 4L75A 5JV5A 5FUXA 1P0PA 1EFTA 1Y3DE 4WD3A 4BTLA 1AXEA 4JB0A 3WS7A 4PSUA 4TZTA 4I1IA 5BYBA 3GY0A 1QK5A 2DETA 4NXMB 2DT5A 4ZT4A 5BRAA 4Z0TA 4YPOA 4ZMBA 3DBVO 5BPFA 3DZHA 3QVVA 2IVZA 5AJZA 3QWIA 1LF0A 4K9SA 2FX3A 2I4RA 4U6NA 4CT4B 5BOSA 4HDRB 3NIBA 4R0VA 1TLLA 1DBVO 1EK0A 3DEKA 4OLAA 1YL5A 4IXTA 2QE7D 4DGQA 2AF4C 2CLEB 2C8JA 4EFMA 1FJGB 3ZWAA 2X5JO 2ODQA 2B3DA 1EEXB 1XNHA 2HWYA 2JIPA 2QR3A 1NYLA 4OXKA 5ALIA 2C2KA 4KPGA 3HJUA 4C14A 1WV1A 4N3NA 4Y9TA 5ETJA 3U48A 1ZM7A 5SY9A 3D8BA 3NBUA 4LF6B 5EJAA 3NBYC 1PNTA 2CDNA 1S7CA 4LJ7A 5A4JA 2WG0A 3FYUC 3CPHA 4HBZA 4N5MA 3MTGA 3WK9A 1O2DA 1T24A 3CF0A 4PG7A 2FRDC 3ZKWB 2ZRKA 5D3KA 3IP9A 3UXEA 4YRSA 1QCYA 4ZOLB 5FNVF 2L69A 3I9V1 2YQZA 5E3JA 4Z9YA 1V48A 4KLZA 4YRNA 2RHHA 5AKZA 3EG9B 5BURA 1J21A 3PDUA 2MU1A 2DUMA 4U0KA 5AOVA 5B1EA 4XJTA 1UJ2A 4O2RA 4AT1A 2ZZMA 4QBIA 1V95A 2W6ZA 2PZEA 1JMYA 1TAQA 2HTFA 3GGDA 4IIFA 4FGSA 3WA6A 1WCWA 3CZ5A 3FW1A 4MUFA 3WZ2A 2PSHA 2CE2X 4HGPA 3EC7A 3LWNA 3V2IA 4BLOA 4KKVA 4JYZA 2GMWA 4UKDA 2BAGA 1W9MA 4LS3A 2A0FA 5AKKA 4ENPA 4EL5A 4CM9A 1IOZA 4M49A 2M98A 1EBBA 3IHLA 2G77B 3JQAD 4NABA 4MPPA 1ZGBA 2XMGA 3BULA 3KJHA 1BCRB 3LY8A 4TXMA 3DT8A 4B4VA 5B58C 2LGJA 4GD3Q 3O6VA 4JEUA 2UVQA 4WVLA 2TSYB 1ZI9A 3AR6A 3MLAA 1YJQA 1G1MA 5AH0A 1WU8A 3RT1A 4AMUA 2O8DA 5EJ2A 5JEEA 4ND5A 4J1QA 3EXG2 2MSDB 2VQSA 1C9NA 3P2KA 1BEUB 4Z9XA 4BE7B 5KREA 4B33A 4DARA 3G13A 1CUZA 2G67A 3BRQA 1QANA 5JFTA 3L1VA 2QG4A 1DJMA 2GJ8A 4YH1A 2BFAA 2OV2A 2QA5A 2ZR7A 1VG8A 3EDRA 4IIJB 1ORIA 1ZGZA 2FPMA 3IBGA 3ITDA 4OSOA 2ZSFA 5CJJA 3WTCA 2WHEA 2C4HA 1E5QA 2JZOA 3FKSA 1M8PA 1USIA 1JA1A 1YL7A 4Q1AA 3PQ5A 2VYCA 5EUQB 1DC5A 4J9VA 1HO3A 3VV2A 3FNQA 4XLTA 1TK3A 5K01A 1YB2A 3ZS9A 2OHJA 3PQ8A 4HNVA 2NSJA 3KZCA 3NFRA 2UVPB 4X44A 2RG7A 3VJKA 2WKSA 4KOEC 1R12A 2IKSA 1T3ZA 3ZZTA 3JQGB 4GZ3A 3IXQA 4LE2A 4GQBA 4LYFA 5LQJA 1M2VB 4UPVA 4YAKA 1AZTA 4LZPA 4D0RA 4EMSA 1P0IA 1G8GA 3GUYA 1UMDA 2O5RA 3DL2A 4GECA 2VK2A 3B6EA 5TARA 4Q3NA 1XTKA 1PTJC 1WXFA 5K7SA 1I9GA 5AW1A 5F7XA 3ANLA 5D1HA 3C6KA 2RGBA 2ZR0A 4CLRA 1GKKA 4XIIA 5DCYA 1PSWA 5DSZA 1XMSA 4O4HF 1VYUA 5K51A 3WGNA 2O2SA 1ENYA 2Z8YM 1Z6AA 4TSFA 4DDTA 4YJHA 2PVPA 4JX9A 2B37A 1VBMA 1O8CA 4L57A 1N2XA 3CCBA 3ZIAD 5EXTA 4D8XA 3L7LA 1USWA 2AK3A 5BN3B 1JKXA 4L73A 3ZVKA 1X14A 4QDKA 5FOXA 2BGMA 4HH3C 4RY0A 4GBMA 3JYHA 1EGHA 4ENRA 5ILGA 1XN4A 3S2EA 5AJHA 3P27A 1SU8A 1U7HA 1VE7A 3HBAA 3IIKA 1M2KA 4GMKA 1IZZA 4MI6A 4R8MA 5CCDA 4BB9A 3LNCA 4GX0A 4OBWA 4E7OA 2C7OA 2CCKA 1HNWB 3EXEA 1BD3A 1FNCA 3F7NA 3F8TA 1H0SA 4JSRA 4RCZA 2ZAYA 5AI9A 5A71A 4ES6A 2JJ2A 3DF9A 4BVGA 3PA6A 2ZJ4A 4Q7QA 2RH8A 5LMZA 3TBKA 4ENVA 4NBTA 4C7VA 1UC8A 4PWZA 3DG9A 2QYSA 3OZVA 2AXQA 5G53C 3ZR4B 3EVEA 4MW2A 5IH3A 2Q4BA 1KVRA 1X1DA 2NXWA 3H8JA 3L7OA 3JW8A 1LK7A 4H35A 4LXYA 1X9GA 3HU1A 3VDNB 4TTIA 1U3WA 4W4TA 3G7NA 2HJSA 4A6PA 1PTJA 2XJ9A 4GNRA 3E53A 3MS2A 3MWDA 4I1PA 1BIFA 2W2OA 3ESQA 2R1VA 2K87A 4EY3A 2V1XA 4C7KA 3KM0A 2Y66A 3DEAA 2POCA 3PHIA 2R84A 3PC2A 2D06A 1A0OA 1CKEA 2HXYA 4GPIB 4I9HA 4ZQIA 5IBRA 1CR1A 1QRSA 1TM5E 2CF6A 2G7ZA 1TVEA 3HPRA 4FFMA 4KXQA 3TL6A 1JFTA 4ARIA 4NECA 3IAUA 4MDHA 3UNXA 1Y0BA 2OPBA 4OHUA 1UBLS 1UBMS 3RKUA 4KXWA 5CFNA 4HUTA 3NORA 4P4GA 5ECYA 4Q1FA 5LNK1 5LR6A 2ISCA 1WDKA 4PSCA 5AM5A 2XUQA 4JOBA 1Q16A 4TLEA 3ZE7A 4INZA 2IV3A 1L7BA 2Q1UA 1T1SA 4TXJA 4B71A 1H69A