3RIYA

Sirt5 is an nad-dependent protein lysine demalonylase and desuccinylase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
SFTARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-5
publication title Sirt5 is a NAD-dependent protein lysine demalonylase and desuccinylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 3riyA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3riyA01
3D7KA 1BFDA 4JUCA 1NM5C 1S5PA 4JD5A 5EJAA 2H2GA 4IAOA 4O8ZA 1V5GA 1HZZC 1Y9DA 1OZHA 4RMHA 4L3OA 2OD9A 2H4FA 1PNOA 4JT8A 3CLSD 2AG0A 2JI7A 3PKIA 4JUDX 4MZXA 4QELA 1DJLA 4RMGA 4UU8A 2JI6A 2VBIA 3ZG6A 5MF6A 4QQ8A 5MFPA 2QQFA 1YC5A 4F56A 1M2HA 3E9YA 2UZ1B 5EJMA 3FZNA 3RIGA 2VBFA 4GM0A 5AHKA 2UZ1A 4JSRA 4BVGA 2FSVC 4MPPA 2OORC 2VK4A 5K2OA 2AG1A 4BVBA 4UUAA 2EZTA 2Q5JA 1PI3A 4J1TC 4Y6LA 1Z8NA 4RJKA 3F6BX 2VJYA 1POXA 3FLMA 4BUZA 1ZPDA 3HWWA 4BV2A 1SZDA 4G1CA 4JT9A 3K35A 4C78A 4Y6OA 4UTVA 3U31A 2HJHA 1EFPA 2EZ8A 2Q5OA 4JU8A 2JIBA 4KGDA 4Q9DA 4C7BA 4MQ5A 5EJ7A 5EJ9A 2H59A 3GLSA 4L2IA 2Q5QA 2H2FA 4FEGA 4J16C 4KPUA 1OZGA 2WVAA 1YI0A 2VK1A 4K9LA 4KXQA 3EYAA 4IG9A 5DGTA 3U3DA 2FN3A 3CF4G 2JLAA 2W93A 4UUBA 2OD7A 1PTJC 1YBHA 2OO5C 1V5FA 2QQGA 2B4YA 4COKA 2IHTA 2H4JA 4F4UA 4FZ3A 1MCZA 2A1TR 4X3OA 4BVFA 4ZZIA 1UPBA 1JSCA 1T9AA 2NYRA 1YTLA 2Q5LA 5EJ5A 4JUAA 3FSJX 2JI8A 3JWPA 2FRDC 4QPZA 2C31A 2Q29A 5K6TA 2Q27A 2EZ9A 1O97D 2BRUC 4FEEA 3GLRA 5DEIA 5BWOA 1Q1AA 2PGOA 1N0HA 1V5EA 4GG1A 1EFVA 1O96B 4BN4A 4X3PA 1U2DC 4ZP1A 5MFZA 1SZCA 1PT9A 4K9MA 3IAFA 4BN5A 4GP9A 1PVDA 5BWNA 2JLCA 2H4HA 3D4BA 4RMJA 4K9OA 5K6RA 4V1CA 2PANA 2IHUA 3D81A 5D7NA 4RJIA 2H2IA 3CLTD 4I5IA 2A1UA 4BVHA 4UTRA 4K9PA 1M2JA 1MA3A 1XLTC 3CLRD 3GLTA 5FEMA 3EA4A 5EJ4A 4UU7A 1Q17A 2NXWA 2FWNA 3PKJA 4V1CB 2VBGA 4GM1A 4K9NA 1E3TA 2JI9A 3GLUA 1J8FA 4HDAA 4UTNA 1T9DA 1YI1A 1PO7A 2WVHA 1YNOA 1YC2A 3RIYA 3JR3A 2H2HA 4V1CI 1PNQA 2X7JA 3CLUD 4MPRA 3F6EX 1Q14A 2H2DA 4BV3A 1M2NA 2EZUA 4R8MA 4IF6A 4TWJA 1OZFA 4BVEA 2DJIA 4Y6QA 2VK8A 3IAEA 4JUBA 1OVMA 1POWA 1YHYA 5BWLA 4MPJA 4D5GA 5K3SA 4D5EA 1S7GA 3ZGVA 1Q6ZA 5MGNA 3HWX1 1ICIA 4JUFA 1U2GC 1U31A 4K9KA 2OD2A 4HD8A 3LQ1A 3PDHA 1T9BA 1UPCA 1M2GA 4RMIA 5FYQA 1U28C 1D4OA 2IHVA 5EJ8A 1M2KA 1T9CA 3OE1A 4RJJA 5EJ6A 1YHZA 2WVGA 5IMSA 4GM4A 4UTXA 5DGDA 2EZ4A 1QPBA 4K9QA 4TWIA 2FR8C 4UTZA 2Q28A 3ZGOA 4FVTA 2V3WA 4GPEA 4JU9A 3EY9A 1PYDA 1UPAA 2PGNA
chains in the Genus database with same CATH superfamily
4PQRA 3A3KA 3BCRA 3HXTA 4YFYA 3U6KA 3IBGA 4A0FA 2BFWA 3I9JA 4V0LA 3CRMA 4M0CA 4DA7A 1BSVA 2ZYHA 5LQRA 1L8QA 3ZGNA 4FEYA 2Y1FA 2BMJA 4YRSA 1Q12A 3S2UA 3PITA 5IN4A 2NPFA 2IYLD 3W8DA 2ZR0A 5KKNB 4YGYA 3VJRA 5K6AC 1Q44A 3AOGA 1I7SB 1L9KA 3REFA 2XSZD 1D04A 4RY9A 2AL7A 2CL5A 2WHQA 4PE5B 3X1MA 1EWKA 3G7NA 4IFEA 3TZKA 2VH5R 3SXUA 1HX7A 1A9QA 4OK5A 1QCYA 4DUGD 5IZCC 1KIMA 2TS1A 2H3HA 1P1IA 4LVNA 2FHPA 2EQ5A 5KVCA 3HO8A 1NKSA 3ZD7A 3VC2A 1L4EA 5JXHA 5K99A 3LGSA 3LDHA 1N36B 1CRQA 3QX9A 3W9YA 3CM0A 5EIHA 3OKCA 1JFVA 1EXWA 1AK9A 1S8FA 3MBOA 4HQRA 4U7HA 1SBCA 4WFQA 3ZHCA 4B43A 5CFPA 3U16A 1Y63A 1XAGA 3T1TA 1UBTS 4ZV4A 4GOXA 4IQ4A 4D41A 1Z9BA 4QG7A 2FX3A 3FTPA 3FKSD 3NBYC 1ULAA 1BXZA 1OFUX 2E37A 4P2GA 5T3UA 4YWJA 1KETA 2R87A 3FD8A 4OMDA 4YRAA 3OP4A 5EUBA 3QNUA 5KPDA 2F00A 5KSZA 4NMHA 5AYVA 2IUEA 2XMSA 1PN3A 3OF3A 2XQFA 1MB4A 4K2AA 5JANA 4R68A 3SFVA 1WV0A 5AHWA 4AJ4A 1KWKA 4NBUA 3BC1A 1RWBA 1PHRA 1NJ8A 4MKRA 3T0FA 4AWAA 3WGGA 4UW9A 1ILWA 1QFMA 1V6CA 2BTQA 3E1GA 3UWSA 3O7MA 3OQMA 2VS1A 2JHPA 5DSXA 2EWWA 2XTJA 1K6IA 1VJRA 1G66A 5E6SA 2V4UA 3IMGA 5B3AA 3U5TA 2ZWAA 2HWKA 4G0YA 4XJXA 3ERCA 4LIPD 2RIRA 4L07A 4M53A 4U00A 2NVUB 5KS2A 5FAKA 2X3YA 4U2FA 4A8JC 3H0KA 1NXOA 1B26A 1PR4A 4YT4A 3NJ4A 3H0CA 1H6CA 1RBZA 3FMFA 3PC8C 1TLFA 3CPHA 4F5EA 4EJ2A 1QM5A 3CJRA 3ROTA 1XWFA 5BOSB 4HTFA 2JIDA 4Q7QA 3KALA 4LF4B 3W2IA 5I9NA 1XTJA 1XZPA 1IK4A 2ZS7A 3E15A 2C3UA 2QX7A 3Q5EA 4I6EA 3NHSA 1HG1A 1CS0A 2CLHB 1BROA 2E4AA 3IMEA 1E0DA 3C1TA 3I01A 4LZAA 2A9PA 3CB2A 1XRPA 2W2KB 3OT4A 2BZGA 3D1VA 4G97A 4WD3A 5AJZA 5EERA 3RS2A 1E8DA 3AG6A 3GD5A 5KNCA 4JQSA 4B85A 2L69A 3PENA 2Y9PB 3TAUA 4K88A 4PZYA 5IMBA 4YDHB 1T2FA 3EC7A 2XKAA 2CV1A 4S1WA 4ICIA 4Y2PA 4BX0A 1GILA 1PJSA 1JPNA 3SR3A 2HSJA 1PG2A 2QX6A 5BN5A 2D1QA 2EDCA 2PR2A 3H9BA 5BYJA 4CM4A 3DDUA 1Q7TA 3HI4A 3VO1A 1JDBC 1W4ZA 4L9AA 4WFJA 1XQWA 1TQ8A 3LQ1A 1MT3A 5FA5A 3TSYA 1ZGZA 5SY4A 5FYQA 2I4MA 3R7WA 5EWMA 3DGFC 1A98A 1BOFA 3Q3VA 3AHEA 4WK0B 2NSHA 3DKIA 2FK7A 2Y99A 4CIXA 2JEYA 3MF4A 1E7YA 1R5NA 3TW8B 5LBIA 4MEJA 1MB9A 5AXCA 5BYBA 1A8UA 1QIFA 3HVHA 4MS1B 1B8OA 4IRMA 3YASA 4WXEA 5CEEA 4B84A 2P6PA 4C5AA 4KODA 2CV2A 4PRLA 2C77A 1L5QA 1Z4LA 3ZE0B 4G1VA 1KYQA 3MHTA 2O1WA 1MTZA 1QWSA 2KWIA 1E9DA 4MS4B 2R11A 2RARA 3CT6A 1N2BA 1XZIA 1RAFA 1R64A 1Z5GA 2QXTA 2XUIA 1JT9A 3BZUA 3P9XA 3FDZB 4EUKA 1I4WA 5A6SB 3W4JA 3QBEA 3OIYA 1I1OA 4YRMA 3CTPA 3AEUB 1YRBA 2H1RA 2ODTX 1R9JA 2FRXA 5IYZF 1R88A 3P9SA 1D1QA 1GG2A 3OJFA 5FV7A 2PUWA 2YZNA 4ALMA 3QUCA 3UHPA 4DJFC 3KKLA 5EG5A 1WWKA 3WYAA 2Q46A 3RS7A 1EA5A 3R3YA 1SWWA 4DQKA 3THOA 3FLMA 4B4VA 3NOQA 4WZ6A 4BUZA 1VRWA 4YJ3F 1W59A 5D8DA 1DCKA 4KPGA 3QF4A 2ZYVX 1GNTA 2KI5A 1G63A 3DM9B 1DPFA 4KEAA 3DC2A 2Y9MB 3KSUA 3COPA 3ZGLA 3IE1A 3UXEA 2JPDA 1OZ0A 1ZZGA 1WY7A 3WYDA 3PQ5A 4A2WA 1EJ0A 1XELA 1TQ4A 2Q4EA 3IKJA 2G5TA 1WUKS 2Z08A 4OB8A 3WBBA 4AKEA 5LLTA 3PPYA 1I2CA 2A9JA 1A97A 3FKQA 4WLUA 5ILOA 3AH8A 4AMYA 1M10A 1MXFA 4ZOLA 5BUCA 1NASA 1QOQB 1GLVA 1FOEB 1UC4B 3T1YB 3CURA 1FRZA 1KWGA 2R47A 3DLHA 1L5WA 4EHFA 2ZRQA 3E0QA 5A9SB 2Y1CA 4IS2A 2XJ9A 3LFUA 3IHLA 2MT9A 4OLBA 4HR7A 1ZOIA 2O7RA 1JHUA 4MYHA 5IJWA 3J80A 4CIWA 4RPHA 2NU7B 3LRXA 3WP0A 3FNFA 2WWFA 4JVNA 1GGHA 1VPLA 3DBRB 4G89A 5LP1A 1I01A 1E7SA 1K66A 8GPBA 3JWHA 5K45A 2B21A 2ZCUA 2LKDA 4XQCA 2FW1A 2QR2A 1AQIA 2MDTA 3D1LA 4UULA 2VJMA 5AQEA 4P22A 1X7YB 2G63A 3SJCA 3H1FA 2C2BA 4P7FA 2YWDA 2B7LA 4LE2A 4M60A 1HKHA 3GAMA 4IGAA 3ZHSA 2FE4A 3B6MA 2CD7A 4QLBA 3FMPB 3U81A 1E2IA 2ZRCA 3G8CA 1L5KA 4DJ5X 4E46A 2AGVA 1A5AB 5HQ3A 1K7FB 1XCPA 4N7MA 1O97C 3FJYA 2ACWA 4CCYB 1RBMA 1Y7HA 5IBRA 4F3CA 3F7NA 1RWQA 1AXEA 3AIIA 3LSTA 2QR5A 2F1OA 3FJ1A 4UNQA 5TQVA 1RC8A 3CUSA 2PUFA 3I2HA 1OFUA 5K0SA 3M3PA 3QFSA 1JJFA 5AVOA 1B8UA 3NYQA 1H9CA 4LYEA 1FMJA 1UBCA 3A3NA 3HCPA 1OYYA 1YIDA 5AKXA 4AURA 2ZQZA 3FA2A 1X1RA 2OC9A 3EB9A 4ARUA 3LP8A 2UUPA 4QHYA 4BVLA 3SHWA 5IDWA 2R6AA 4LK3A 1KBQA 4QXPA 4PG4A 2O5RA 1YE3A 3NQ41 4QO7A 4Q15A 5KCMA 3SLRA 1NN5A 1N32B 3HKDA 4NYJR 2Q8QA 3DW1X 1RQGA 2WAMA 4RKQA 2PWPA 4BNWA 2WTUA 1JT2A 1YK0A 3HCOA 3IUMA 3NTLA 4KBYA 4GOND 5DBFA 2HRQA 1XPJA 3P52A 4J07A 1XAJA 3KC2A 1VSBA 4ZALA 5TIIA 3O8LA 1KF0A 1TM4E 1XTZA 4Q6BA 1QP7A 1E6UA 1VBNA 2BGIA 5D5HA 3KWFA 2G4LA 3D8RA 3HPRA 2WINI 4GX0A 4JUDX 4L27A 2XD9A 3UWKA 3ZG6A 3H1EA 4L8LA 1SUFA 2NUBA 2RHOA 1CUWA 3QBDA 3VC7A 3ZJVA 2XCSB 4HZUB 4NOKA 3TBHA 1CXZA 3GG2A 3OVMA 4FFLA 3ENNA 1QHGA 3CG0A 1SCUA 3IVGA 3MZ0A 5AVTA 1P1KA 1SZPA 2HK9A 1Z37A 2Q3LA 1WHSA 2XT0A 4YPVA 2AEEA 1VHQA 1IZZA 2P2LA 4ZODA 3TQFA 4CM4B 1W88A 5AVWA 3ECSA 4KGZA 3L79A 4BKPA 4BP3A 1SHJA 1Y89A 1YDHA 4WEQA 5K0FA 3ML1A 3WP1B 4J1NA 3AETA 2C2HA 3QWFA 3WWPA 3IIIA 5KOIA 2ZIWB 2IUFA 4CKWA 3GOQA 2H1IA 5HIMA 2N46A 2JIQA 3PYLA 2W2KA 1AHHA 4K28A 4C4OA 5IP5A 4DEYA 1RYNA 3AFHA 1RPTA 3T5PA 2P67A 1KRXA 2R1ZA 4Q3CA 3HFGA 2I67A 4JROA 4TWBA 4YALA 2Q27A 1AHPA 1U8EA 5BWOA 3RANA 1S9HA 3EMDA 3SI7A 5B2EA 3FYUB 3O7WA 3R8FA 4BNDA 3CH7A 4R8KA 4TV9B 1E66A 1FLAA 1BEUB 3TOSA 2PBLA 1YOVB 1LPMA 4RFSA 2UVPA 2Y1LA 1CPYA 2VT3A 3W6PA 3WGJA 1P1FA 4BLOA 1EX6A 2Z5FA 3GAFA 2EGHA 1LJ8A 3D6VA 3IHWA 4G5OA 4ZHSA 2GCGA 3PEEA 3X1YA 3STTA 1YVPA 3BQNB 2XQVA 3GV0A 4Y98A 3I5UA 3SICE 5IPFA 5D1NA 1NBWB 4JOCA 2QRUA 3H87A 5EXTA 1DV1A 4XUCA 1LLFA 3PNMA 3E9CA 4C30A 3Q98A 3ORFA 2CXQA 1WF6A 3FPCA 1HLGA 2WUVA 2H1VA 1SCBA 3ABOB 3HA7A 4TRRA 4GGMX 4DGQA 4HUTA 1YC2A 2PQ0A 3DHNA 5I7SA 2IBSA 1BVHA 1Z82A 3FNEA 4Q37A 2H2DA 3TZHA 1Z6ZA 3BDIA 4HNAB 5K05A 4HN9A 2PKWA 3EMVA 3HUTA 1ODLA 1Z34A 3A2NA 1BJKA 3QLUC 4KAFA 1NW3A 3EGCA 4OLHA 2NQ8A 4XEHA 4YR7A 5CFQA 1FU4A 5EAIA 1VE5A 1VFPA 4J6EA 4B2PA 1DX6A 1X9GA 3BD7A 4UVEA 1C1HA 4MV8A 4R8LA 1WKVA 1JU9A 1T1SA 3DAHA 5CM8B 2AK2A 2B4QA 5L7YA 3IT3A 5F2EA 2YQ5A 4C0HA 6REQB 3IE0A 1VHJA 4CMBA 5B55A 1X1QA 4JL8A 3A6PC 3IOEA 4DC0A 3B9PA 5EJ6A 4S2UA 4RGQA 4GICA 3HDHA 1OI2A 4UU0A 2HUNA 2BYTA 1M2EA 5L7WA 4JLSA 2B94A 4TL6A 2OM6A 1EZZA 4W8HA 2GJAA 3G02A 1SEVA 4A0HA 2AE2A 2V6IA 1AJEA 1PHPA 2ENUA 5CM9C 4DCOA 1CRZA 5IFKA 1GGJA 2B5OA 3ESZA 4IIJA 4LMRA 4TWZA 4FOPA 3ROPA 6GPBA 3QE3A 4FOTA 1UBLS 1C14A 1DX4A 3IGFA 4UDOA 4EYEA 3BERA 5CH3A 5CDYA 4F8JA 5TMBA 4AZSA 1TCVA 1XMPA 3MD0A 4ZEOA 3HSKA 2C2ZA 3SR4A 2ZB3A 3MW8A 3N70A 3M5PA 3FOCA 2WFZA 1HE2A 4RH1A 1OBCA 3TAHA 4DEVA 3LVQE 3VSCA 3OJWA 1VSTA 3DS8A 1NAIA 4ETMA 4MICA 3RD5A 3DOFA 4F2WA 1ZD8A 1OSNA 2CBGA 5SZJA 3UV7A 1BZYA 4G5GA 2NU9A 1OI4A 1ZQ9A 2C4MA 4DV5B 1Z0UA 4PYNA 3EEYA 2DKOA 1EMDA 2Z8YM 5DB4A 4DKJA 2P69A 1E6EA 1FNMA 2OFFA 3A32A 3ZDBA 5E9JA 1HEUA 2VPIA 2ZSEA 3PXDA 3GWZA 1R66A 4J0HA 5A4AA 3TKLA 4F7DA 2AIRA 2BDTA 5A4DA 5K0BA 4AQ7A 1EAYA 4KO2S 4G1FA 4ALLA 1N2SA 2CL6X 2P75A 2WSSA 2YX1A 1H2RS 4P35A 5K8UA 4MAFA 5A5DA 2QV0A 3BB1A 3QW2A 1ZK2A 3OPNA 1FUYB 3R3XA 1OROA 4NE9A 4PHHA 4CUJA 5HNKA 2XB4A 1PNTA 1FIUA 3IT0A 1YK1A 5EKSA 4AKSA 1OJLA 1TK3A 3L49A 5IUKC 1TEVA 4I08A 1FW8A 4QPCA 4AZVA 2RHMA 2CNNA 4Q01A 2J7KA 5ALPA 4GYYA 5HIJA 4QJ4A 4KFCA 2AFHB 5LM3A 2ZYTX 4X62B 2W42A 4MHSA 1L5HB 3WRWA 1YRWA 3VSEA 3IUEA 4Q0MA 4EMTA 2CDCA 4F4CA 3I58A 4R1NA 3RNLA 3KXDA 2RCNA 4IO1A 1ZH2A 1Z3CA 5C4GB 3A6EA 1VGQA 4BOYA 3MSXA 4HNVA 1EYZA 1WS6A 2DFTA 1QE3A 2Y1XA 3H2JA 4LZZA 4IGKA 3R1IA 1BWRA 1P9WA 1ZESA 4Z4QA 3GN1A 5C8XA 4J7UA 3TOCA 4AIIA 1UDBA 3HI6A 4PLFA 3ILYA 3AF5A 5JSUA 4TXHA 1IHOA 4PCUA 1FX0B 4H9GA 1ADCA 1AKYA 3OTHA 4JAVC 3GEPA 4TTAA 1L4KA 4D9FA 3OOSA 4TOIA 3DVRX 5AW0A 1ZOOA 2C92A 2VI5A 3M6LA 2GDZA 3NJRA 4PIMA 3QEJA 1I4TD 3WDKA 1EVYA 3ROFA 1VYTA 2A0FA 5T6BA 3E4CA 3NUQA 1G8FA 1GCAA 3OMXA 4JBIA 5AI0A 3G0DA 3IP6A 1EEHA 3ZH2A 1CIJA 3K0AB 2HCTA 3D7LA 2PJUA 3SBXA 4CUKA 2H2AA 2ZCVA 3KKPA 2NZWA 5EMNA 1FPMA 3EDQA 1OX4A 3FUXA 3K8ZA 1HQDA 2DWCA 5BXYA 3SJZA 2UXCB 1Z2PX 2JAOA 2PA3A 1TYEB 3FGZA 5DDIP 4IQFA 4EB6B 1KOJA 2XGGA 2XVXA 2ZR7A 1KBZA 2ZTHA 2KSQA 4FYPA 4GS5A 2QUKA 4OKIA 1DG9A 2AVNA 1TF7A 2H9AA 2ZREA 3G2MA 4RMNA 3GEEA 1O6GA 2W11A 5JS1A 2JDIA 2X41A 3L1HA 2WT9A 5A7GA 2JLZA 1DKLA 1KH2A 4NQZA 2HA3A 1CX9B 3PC3A 4R7GA 2FZKA 1QG2A 3MCVA 1OLUA 4GPEA 3V34A 3E9ZA 1QAMA 3AP3A 2IYQA 3C3EA 1Y81A 1A2QA 1XMSA 3AFNA 1QV9A 4NZMA 4UNNA 2CWDA 3EXG1 1CJKC 1FUUA 2GFHA 2CLEB 2FP4B 4N6OA 1ZHHA 3FSEA 1F20A 4OOFA 4I1OA 3DZFA 3B3FA 4CLHA 4C2UA 5JQGB 4A0GA 3CVVA 3VNRA 4YAUA 2I87A 2IKQA 2ZJYA 3ECCA 5F1OA 1BDMA 5K3DA 3UFBA 3IBYA 3X1ZA 3CCFA 5EI5A 4PN7A 5J2TB 3BMCB 2BV3A 1V3TA 1ZP6A 3THXA 1JJIA 4QPDA 4X0EA 1ZG3A 2ZP1A 1M0EA 4M21A 5CDHA 1H5UA 1IONA 4BMPB 1EK6A 1XTIA 5EY5B 2CNOA 4D81A 1AN9A 4RTOA 4L16A 2A94A 3ZI4A 2IYPA 3AF0A 4Q02A 4LTMA 5IKMA 5LPNA 1E64A 2YNMC 3QRWA 1LD3A 1N0UA 3K72B 3B3GA 1ODSA 3AVOA 2G28A 2H1OA 4H0CA 1XWWA 3PE6A 4FYJA 3P0IA 4Z8XA 1PK7A 1E2MA 1C7QA 4S0XA 3FX2A 4PHFA 3RVRA 3V7FA 2P2DA 5C1OA 2I7DA 3QWAA 1MKYA 3H8SA 4KE9A 3OCZA 5TF4A 4AECA 4OUDA 4ZAGA 4P3XA 1K2VN 1QK3A 4PN3A 1HV8A 2HCRA 3D8BA 1CLEA 1HMYA 3AF1A 5DNDA 4M87A 3S44A 4I1YA 4V03A 5CDTA 4KDRA 5HJEA 2GPTA 3GT4A 1OX6A 2W2LD 3LTNC 1FS4A 2P65A 3CMCO 2BFEB 3JD4A 1U0SY 2I6TA 4NPHA 4Z49A 2HT6A 5I45A 4FZ3A 3WK5A 4C14A 5CA1B 4INOA 4YAOA 3SX2A 3WLNA 1F17A 5J2UA 1FU8A 1MX3A 4B5LA 2VK2A 3JQAB 1N2IA 1TZJA 4ID9A 4G8BA 4Y7DA 5FUVA 4HP8A 2R6GA 2V6GA 2BH9A 2G40A 2I65A 3M7IA 4PX2A 2ZJFA 4LNUA 3TTWA 4AL4A 1AF4A 4I1SA 4ZP1A 4BLQA 1SIOA 2V8BA 4JI6B 3IAFA 1RXCA 1TDJA 1PZNA 3BMQA 1I3CA 2YIVX 4ZAYA 5FPPA 2O6LA 4INJA 2BFBA 2GBLA 6NULA 3T1QA 4DM7A 5FWXB 1TUBB 1N7HA 2GPSA 3LPDA 4RS3A 4Q12A 1GLGA 4JX8A 1U2TA 2XBUA 5A3JA 2PS1A 2VN8A 1DTWA 1GCOA 3L01A 4BE9A 4ZDWA 4DM3A 4J2OA 4ZN6A 5IANA 3I34X 4OP2A 1CR2A 4O4JB 2OSVA 4G07A 4YP5A 4B6QA 4MI6A 5TEVA 3RC1A 2JKYA 4Q82A 3KDSE 2OUIA 1U7ZA 1XQ9A 5KWVA 2ZRIA 1B8PA 4F92B 4ZANA 3T9CA 4IDNA 3AJDA 5KMGB 5CXUA 1PU2A 1YR3A 2BAGA 4HMQA 4TL7A 4I8XA 1G8AA 4QLOA 3SY8A 4CKEA 1WMBA 4G8JA 2J5XA 2Q2OA 3ZGVA 1L4MA 2V98A 2VJLA 3PNPA 3PWZA 2ZRMA 3P0HA 1E1KA 4FX2A 1EH5A 2JAUA 4NZ9A 4WBXC 4NULA 3R0ZA 5HMMA 4YV7A 2KYRA 4ZQGA 3UJPA 2BKUA 4M22A 5C5DA 4AJKA 2WFAA 1TZKA 1UDXA 1T9CA 4F5YA 5LU8A 3RHFA 1DAHA 1M8JA 2WWWA 5HTKA 2HA2A 3EVTA 5C37A 1NXVA 4EL5A 5E95A 1M5RA 2EBUA 2YH2A 2WD7A 5E4JA 1F2VA 1GJRA 1CU1A 1SKUA 3EY4A 2ZTVA 3JASA 1IPFA 1KO1A 3ACCA 4HOYA 5FPTA 4EW3A 1WDKA 3AERB 4YAGA 4BPBA 1Z75A 2VF5X 1ZRSA 3FBWA 3U4CA 2C58A 5LYJA 3G2NA 1QYDA 3GMTA 5BORA 2W0SA 1PR2A 2GM4A 2WWIA 1J24A 2CYCA 2DOKA 3RREA 3GLVA 3TQHA 3T0IA 4D9JA 2BI4A 3OPXA 4G67A 4US0R 4BQQA 1J25A 4M1KA 4Q93A 2FFRA 3P7MA 4Q4CA 2OCGA 4C88A 1KZ6A 4B4UA 5BV8A 4PAMA 1Y98A 2IEBA 1G8SA 3T7CA 5J4KA 1ZR2A 3KR1A 3ND7A 4IIHA 2AXQA 2DF8A 1TL7C 1QHSA 3H18A 5MDHA 2HU7A 3PEWA 4G36A 2JGRA 1I6KA 3UCXA 4RDHA 2FX2A 2G5CA 1L4FA 2OQIA 2G7ZA 3NRJA 4BFVA 4AUEA 2B7CA 1R0RE 1T91A 2BDUA 4UTVA 3FPFA 3FTCA 4DVGA 1EUCB 1J33A 1P19A 2COUA 4CKYA 2Q5QA 2R9VA 3SEZA 3E8MA 2Q1SA 4JT2A 4QUDA 2ZFUA 3HRIA 2XRZA 1RCFA 1S2MA 2ILTA 2QUIA 1W44A 2XTMA 3TZQA 4EPRA 3GRZA 3CF4G 3O92A 4BQIA 2R7NA 4H6PA 1MC8A 1TM2A 1U2RA 4M89A 1QP0A 4DMGA 5I7OA 3DZIA 4JP8A 4YH1A 1E9AA 1U63A 5KC8A 2C82A 4MTCA 1C1DB 1NVGA 2JLBA 4K03A 4V0QA 1ZUD1 3JQ8A 1X0VA 2OY0A 1ISJA 1XDWA 3H5AA 4OQLA 3S8MA 4NF2A 1JLLA 3SBOA 4NXNB 4EPTA 4NEHB 2NTJA 2GAOA 2W6PA 2BJWA 5ENVA 2RGRA 2ALJA 5FBKA 1XSEA 4YRDA 1XI2A 3X1XA 2A9KA 2YVUA 3FGPA 5ALRA 3OTGA 4ID3A 4X1IB 3EGVA 4GP9A 1IBSA 1P3JA 4U5XA 1WIWA 2OBBA 2R86A 1FNBA 3MB8A 5I5EA 3D2CA 3P5SA 5J47A 4YEDA 3QHPA 2ZPUA 4DJJA 2B34A 3LIIA 3X1JA 2WAOA 5DOZA 5I6DA 4KQWA 1TA0A 1Z25A 1ZXLA 2HA7A 2EKZA 2ZAGA 3OZGA 3QY0A 4R3UC 5JD4A 3IMFA 1MXHA 1KMHA 1N7GA 2BW0A 3PKJA 4OP3A 5EP2A 4C6RA 3HYNA 4QNMA 1JEJA 5DHSA 2IZ6A 1QIGA 4MRMB 5F7OA 1O54A 1WCIB 2P41A 2Y2VA 2MYUA 3HY3A 1NX9A 5HKBA 3GXOA 1KI6A 1Q0ZA 2I3GA 3AI1A 3LG2A 4O4LB 4IDDA 2VP2A 2IW3A 4DLXA 1QO0D 3D2AA 3LFHA 2LGJA 4H4CA 1GCGA 2C84A 1JR3D 3UQZA 4H15A 1SC1A 3U3JA 1RWPA 2QY9A 5KNBD 1QZUA 1VHWA 1FSGA 3WK4A 1VMEA 4EOGA 2N0SA 5EJFA 2IPAB 2PV7A 1KI2A 3I53A 2XZLA 1RXEA 2JGAA 4QNNA 5D6OA 2EERA 2AZDA 2F8MA 4G24A 4F38A 2A3NA 2ZIXA 1QPBA 2XRYA 3VMMA 3ZQJA 2VVTA 4R9UC 4FBMA 3HB4X 1UJCA 4DBZA 1E2JA 2WF6A 4XGIA 3V1MA 5JBQA 3GLFA 2H54A 3WWCA 1KU0A 5ALYA 2XA1A 1NIJA 1ZFNA 1D8TA 4A03A 3O8OA 3GNTA 4ZYVA 5A9RA 3OO0A 2RGNC 3HZOA 4HEA6 1X8KA 2IHKA 2Q6TA 1RABA 2DKNA 2QTVA 1Q7RA 4HAVA 2I54A 5K7SA 1V8BA 1K97A 1E6LA 3ZKWB 4UEWA 1SC3A 2AOXA 4YWHA 2FQQA 2Y4OA 4MGKR 4QNRA 3BTUA 3N2KB 1EVQA 2VBFA 4ZOCA 1N5KA 3SJAA 3KQMA 2JI4A 3W9UA 1R4ZA 1QPZA 3TF5A 4U2KA 4AFNA 4J0KA 1JFSA 1HLDA 3O4JA 4HDSB 2IQ5A 2HPVA 3K20A 5BN4B 3V00A 4HT3B 3LVRE 1PZXA 4E7OA 2BFMA 4TT3D 5BNIA 2DSNA 3G2QA 5F1KA 3ISJA 4LJLA 4X63A 5FRDA 3BD8A 2VRCA 3VU3A 3O2QB 2GCNA 1J2EA 2JCGA 4WZBE 4DEXA 3ZX5A 2OKGA 1U3CA 1WMAA 3G6KA 3Q1KA 5JXWA 3MC1A 4FHEA 2IDMA 3WZ2A 3EZ6A 2IZ0A 4D9NA 4DY4A 2HLDD 3Q7TA 4Q1FA 1KYYA 2ZUSA 4N7JA 3P2OA 5LQDA 5FLKA 4LMAA 2ZULA 2XMDA 1SPBS 2OO5C 4JKIA 1CEEA 3PZBA 1MIOB 3QGMA 4Q4JA 3GJQA 2KHZA 2G0NA 2C8JA 5F7ZA 5G41A 3W5UA 1XNQB 1SVMA 4HRYA 4K0RA 3A25A 3VPHA 1N5RA 1RW4A 4UE6A 5GVSA 2CZGA 2OBNA 4H3HB 4FEEA 2BRUC 3AEQA 5EIBD 4WVFA 3VX4A 4D0SA 5L3QA 4TLCA 1QFXA 5GOTA 3ZR4B 4Z7OB 5JNUA 4YI3A 1ZIDA 3WRVA 4ZI5A 4FP9A 4TTPA 2H3EA 4HXEB 1JTVA 5LYYA 2DTDA 3IEVA 3GJ4A 4E12A 4X90A 5CDFA 3RDPA 3P45A 3P0JA 2JLQA 4LXXA 1N5OX 2GQ0A 2FG5A 1V47A 2FDRA 3P9RA 2ZIUB 4MNTA 4NPAA 3TUZC 4NENA 3GDHA 3O1LA 2R751 3PT9A 1W19A 3BE5A 3THRA 1YRHA 3HCDA 4HGYA 1XYGA 1FTSA 1CY7A 1LBHA 2P9HA 3L82B 1VPEA 3JQFA 4G1UC 4RM3A 3EEOA 1AZWA 1KMCA 1G2IA 1AKRA 2WVHA 4DJDC 4F3NA 1JAIA 5B4VA 1IDOA 3B1FA 3TDNA 3R7BA 5I7EA 5IS2A 3Q8LA 1GP2A 5DYNA 1EIZA 3O93A 4RULA 2R1UA 5EFZA 5E6UB 1VFNA 4XVCA 5C1BA 5JBIA 4W5NA 2NO7A 3VISA 1R50A 3H2YA 2DMRA 3BGIA 4TUYA 4D5EA 1XU9A 3C8UA 1UWLA 3HY6A 2ZRPA 2QRJA 5KX5B 4P4SA 4F97A 5I4IA 4O4HF 1DU4A 2VT2A 5A3SA 3CVOA 4J3NA 4PSVA 4B40A 4BGDA 3R7AA 2EIXA 1MIHA 3IKVA 3LUAA 4J90A 3G85A 4PLYA 3A05A 3ADDA 3ISVA 4PO1A 2BP7B 3DOOA 4MKGA 4MWBA 3WNDA 2ZUFA 3PVCA 5EVJA 3DOCA 2BCEA 3R3UA 4RCYA 1NA5A 1V11A 3QVLA 4YPFA 1K68A 2OXRA 2CYBA 1NWCA 2WTEA 3UN1A 1C1YA 3IBTA 4EVSA 2QY6A 1YONA 4NV0A 4V24A 3FYUA 3M81A 4KOAA 3FROA 3PHBE 1OWOA 3F4KA 3CINA 3QYFA 4NOJA 3FFTA 2BT4A 4LJ5A 1QKKA 2NZVG 3BL8A 3I3SR 2LP4Y 3B6ZA 1PQ4A 4IX9A 4ZDJA 2JI6A 3C41J 1DKQA 1X19A 1YVEI 3IIKA 1EM8B 1RMQA 1M2HA 5AKYA 2OZKA 5JIBA 2DQKA 1JQBA 3TD2A 1MQSA 1LKZA 1ZQ1A 3G2OA 3FHTA 1G2OA 4QQFA 3RIXA 2FOIA 4AXXA 1DAOA 1SXIA 5JY1A 3EXHB 3R3WA 4BVBA 2SNIE 4TQAA 5I9BA 4KLRA 5KYWB 1AHNA 2GXSA 1LQUA 3QXSA 4F0JA 1R1DA 4OU5A 2VJYA 1Z5PA 4UHJA 1A3CA 2IP1A 2O8CB 3DPSA 2I99A 3FOBA 1K86A 2YIJA 3E9RA 2IYNA 2BZSA 1RAIA 1YI0A 3MRVA 2R25B 2XCIA 1SXJB 3H2BA 3ESDA 1ZH0A 1DO8A 3B6IA 3DE3X 4O4HA 4ZCSA 4DXHA 3R5HA 2PY6A 1JFTA 2OXCA 4UAGA 5I7RA 1E7MA 2G3YA 3JYPA 3PF9A 4KV7A 3S1AA 4COKA 4XVUA 5TPZD 4HNUA 3ICCA 3IP3A 5JWHA 3B8EA 2GSDA 3CIOA 1JDPA 4JOQA 4V2IA 13PKA 1IB6A 1NV8A 3DVLA 3MTJA 4UVGA 3VO9A 1G2PA 1DBSA 4A5OA 2ZSDA 2DBVO 1YF3A 1EPUA 1KJYA 1E4OA 1GZ5A 5DHFA 3CUEF 3UKOA 4UOZA 1EK0A 4B75A 3LMKA 1ZWLA 3UVEA 3W7AA 3KYCB 1LPBB 4P5EA 3REGA 3AILA 3GO4A 3TG2A 1UWKA 2QN3A 3H3JA 4KXMA 1J6UA 1X7WB 1E3WB 1SKQA 2C4TA 1FX1A 2PH7A 2PRYA 2WHPB 3EGEA 3FWHA 4JFRA 3TZLA 2L17A 1WEHA 2POQX 2CJWB 3DTTA 4EB8A 4MQ6A 1E5QA 4M7PA 3QK7A 1JR6A 1KO8A 2C1EA 2PGIA 1JBEA 4NC9A 1KMIY 4YREA 5LBUA 4I99A 2ZRBA 5CB6A 2YMLA 3NBAA 1P45A 4ENVA 3KKNA 1NGSA 1KKLA 2R7LA 3AF6A 1GZ6A 2BHRA 3NEYA 4HWSA 2CE7A 4MIOA 4GI2A 4JENA 4FTWA 1L6IA 4EDFA 4KR0A 2A9VA 2G5PA 4R51A 1RWMA 1ZM3A 2C4NA 3I6QA 3W5IA 3T4EA 2D62A 1M7GA 2VK8A 4OL0A 2JFWA 3T7KA 4D3FA 4FMDB 1QZZA 3BAZA 2OVBA 4HUQB 1MOZA 4LA4A 4FLEA 4Z86A 3WE7A 4DIUA 2GWHA 4ZT3A 1GYRA 1I9CA 1NLYA 1V71A 1VLVA 2IF0A 3B12A 3F7OA 3MGAA 4OXQA 5CX1B 3PUZA 4X6LA 2VYNA 2W2NA 5T8KC 4R4JA 1QC5A 4PTYA 1QXSA 3KJEA 2MSKA 3EJ6A 5C7OO 3QEMA 4GEKA 1XEXB 4E6EA 2QRVB 3B1ZA 3NHYA 1AKVA 1WCXA 4OEHA 4OLJA 1FFBA 1QC5B 1UT6A 5ALHA 3ROMA 3GLFE 1K7EB 3LE8A 4IH9A 3GLIB 3DMNA 3LHSA 2EYQA 3D43A 1U7WA 3R7LA 1PLKA 4FDAA 1ECBA 4LPKA 5DEOA 3TBFA 3SIWA 5EQFA 5IAEA 4OOEA 3L46A 3MGGA 1E58A 4K6FA 4LHSA 4QELA 5HBRA 5B4TA 2WWXA 3T95A 1AKEA 1JHZA 4YMSA 5BQOA 3X2FA 1DC8A 5JFGA 4KQMA 1KDZA 4I5GA 2IS2A 2B82A 2NTNA 2R6CA 3KYJB 3WQSB 4B3MB 1A7UA 3VTAA 1RYBA 4GM0A 4BLWA 4IRUB 1P2TA 1XDZA 4BWVA 4ZIRB 3BE4A 1E5TA 4BAGA 4JSRA 4RLQA 2YHUA 4KR6A 1TYBE 5TE9A 2CCGA 3N3AC 1GDDA 5IVHA 5T4EA 1KZ7B 4TXLA 2HC9A 2MSNA 3DCIA 4FDUA 4B3BA 1XXHE 1K6JA 5EIBC 4M0UA 5IEJA 2OE2A 5IKXA 3R6WA 3RS4A 1C0PA 1TGYA 4YJFA 4EYGA 1DV2A 1VE3A 4Q9KA 1C4OA 3HB0A 4HNGA 5DW0A 3CVWA 1CJCA 3AGQA 3EULA 3QEBZ 2PD6A 2LRHA 1AGPA 1WQ1R 3AW8A 3CX3A 3OOHA 2G1AA 4Y6RA 2OCAA 4DCUA 3INNA 1C0EA 3UYLA 4HVCA 2F43B 2Z8XA 5EQDA 1KI7A 5DRTA 4WNCA 2V0GA 1TTQB 3BMNA 3T06B 2IXTA 3Q3HA 1N6IA 2VQSA 2IHTA 2IH5A 1PJ3A 4MUAA 4BX2A 1RI4A 2C4KA 2IEYA 5E1DA 3FWZA 4HQNA 4UATA 5K0EA 5ALZA 3CLKA 3ZU5A 3C2QA 4TWAA 1SJ9A 1N57A 1E79A 4PWYA 4K1XA 2IBMA 3ZY2A 3BSFA 4OXXA 1WBBA 4JI1B 1N34B 1G0OA 1MR3F 4G2TA 1E2DA 2UV8A 4QYIA 2VTDA 3CVJA 3LQRA 3TLJA 1WNFA 1BA3A 1EFPB 2RAUA 1S3IA 4NZZA 5BWNA 2W98A 1Y3BE 2FVXA 1SQ0A 3SCZA 1MRSA 2IHUA 2PANA 1VPVA 3M8KA 3JU3A 3OJXA 3TE7A 1CJBA 1T3GA 4H35A 4PXSA 4WUTA 4YRNA 4BO7A 1J1UA 3PE4A 4X64B 3PUJA 2PYIA 1X3SA 1KZ1A 1US8B 3LYUA 3QPVA 4DA0A 4K9NA 1CY4A 1GTG1 3G6WA 1GYPA 2X23A 4C06A 3NM6B 4B79A 1KTIA 1JFFA 1LVHA 1W4AA 1XXHA 2QAGA 1LGYA 2Z58A 4RD4A 1NT2A 4Z9AA 1I0LA 4DQDA 2AEJA 5K3AA 3H5WA 1Q14A 1XDBA 4PS0A 3OFSA 1WSDA 2IHJA 3FOFC 3ACDA 2Y1DA 4GPD1 2YRXA 1U1GA 1VG0B 1T8RA 2JBHA 1NT4A 3BPSA 4TYNA 1Q6ZA 2OILA 1D1SA 4RGYA 4EARA 3TLMA 1U31A 3OQBA 1SG0A 1FMLA 5FHRA 4HAWA 4KIUA 4LX0A 3RAGA 1GPJA 3RK4A 5JNRA 4Q9IA 2M6RA 3EDRA 3F4LA 3GH3A 4IUYA 3VI3B 2GPJA 2P1DA 1XJ0A 2DG2A 3R0IA 3DLCA 3M6XA 1R6DA 2HMTA 1E7QA 4NYIR 2ZBEA 4K9QA 3D5EA 3FB4A 3A1NA 1L8OA 1P7PA 2MSDB 1DKNA 5KX5A 4D98A 4KUHA 4B83A 1QFZA 1Y1SA 2F67A 2VF8A 4BHTA 4JX9A 4YACA 1EXDA 4W6ZA 1XD9A 1FFHA 5E6SB 2ZI7A 4Z4HA 1E4EB 1ZOPA 1MDBA 4GLBA 1M33A 2J5QA 3V8QA 3QVMA 4C0XA 4CNBA 3R5XA 1XF1A 5JE8A 5KSYA 4LYYA 2JGIA 3EMBA 4V0SA 3E3LA 4OQ4A 4EAQA 1VXOA 4OH7A 4MUYA 1WXHA 5DN9A 3S2EA 4W1RA 4C4SA 1QCCA 5I48A 3TIFA 4KOEC 4NMWA 3SIPA 3N1UA 3N2ZB 4DSTA 5THXA 5CX4A 4C7OB 3ZQKA 2GO1A 1IN4A 3M9WA 2HQSA 2Q5HA 3GGDA 1IY2A 3N5CA 1WL8A 3WA7A 3FMVA 2B78A 4IDEA 2Z2XA 3GT7A 4UUAA 2EZTA 1HZJA 3FUCA 3VUEA 1RC0A 2C2KA 3ER9A 4MR9B 5KHAA 4F2HA 2WUFA 3NDPA 2GBCA 1VLZA 1CJUC 1IZ0A 2DC1A 3F6CA 2JKZA 1QOPB 1EB9A 2O6HA 2RK6A 3SSMA 3VKWA 4BKQA 3IQFA 4C20A 4EF5A 1E9VA 2O0LA 4PGFA 1QSGA 3DWGA 4CZ2A 3DT6A 3PG5A 3UA4A 4ATNA 3U7QA 5FBLB 2IV7A 2DHQA 2XCQA 1RLMA 4C0SA 4NJEA 3KQWA 3QHAA 4PCLA 4Q1BA 5I7AA 4ZKDA 4D3ZA 3WX0A 5IULC 1ID8A 2GESA 5DCUA 2P0EA 3UFXA 3A1TA 3M9XA 2B4YA 1NQXA 5D3MA 3K8QA 1R2QA 1Q91A 4LX8A 4MR8B 2B5WA 2NGRA 2R62A 3ND5A 4GPBA 5EIAA 5G1OA 2V7PA 2JAQA 2JHFA 4CLXA 5KDOA 3FSJX 2PT9A 4GC5A 1UMDA 1W5EA 5AVKA 3N2NA 4ZZ1A 3QFTA 4ZCRA 3KJXA 4BO9A 2WJYA 1U2PA 3ZGZA 5I9SA 2GN2A 2X3UA 4WY2A 1L4UA 3AF4A 3T12A 4FOOA 4GD3Q 2HV9A 4RETA 3K15A 1L1QA 4NBRA 3CF6R 3PJGA 3VTKA 4RE5A 3OFND 4HGQA 3UMFA 3GD7A 1ZINA 2P4SA 1RJDA 5AK0A 5FPHA 4BVHA 2VSYA 3VR5H 2HOQA 4UU7A 2NXWA 3M1AA 3AR9A 3JD3A 4TS1A 4I36A 5D3MB 5A1JA 3RVPA 3ZZMA 1LSSA 1OWLA 1QH1B 1N6NA 2J0EA 4QQKA 4RTNA 3D9QX 2QMYA 1UBKS 2NO0A 4A7PA 2BM9A 1KY3A 2FWIA 3C6KA 1L5NA 5JCPA 2UXDB 2GEBA 4CG1A 1E7WA 1T5DX 1DEHA 1Q3HA 2CZQA 2QTFA 1T35A 3IXQA 3LLUA 4XD7D 2I2CA 1KY5A 4INPA 5G4KA 1IH8A 2LUOA 2GN4A 1C0IA 3MXTA 2GJKA 1R8JA 4AICA 2XT6A 1DSSG 4I50F 2VSOA 5FTJA 4NBTA 4Z54A 2BE9A 3GARA 4JUIA 4Q16A 1AF7A 3TKAA 5F4ZA 1HR0B 1J00A 4O33A 1NW4A 1U28C 4Q19A 4PX3A 3OY2A 2P9YA 4WK6A 2ZRGA 4KE8A 4MOWA 4RJTA 3OMWA 1RPAA 1CV2A 4D9CA 3KSBC 2A0KA 3CEMA 1M54A 2HDHA 4IOJA 1HK7A 1GCUA 1U8UA 5LKAA 4AJNA 2YFHA 3KQTA 3FPSA 3ZWMA 2Y2UA 2C04A 4HNRA 3RC9A 4E4TA 3K71B 2J5RA 5LZ4A 3LA6A 5B7PA 1QHYA 4EKEA 5EJAA 5JDIA 5KZMB 3KBBA 3MGBA 1N2CA 4J91A 3VI4B 3RT9A 5FQNA 1Z73A 1L5MA 1XTQA 3KSAC 1P6QA 5A9TA 5JJCA 2B4RO 5KNCH 3EGWA 1Q5PA 2YCBA 4QOSA 5A3VA 4TROA 3DHYA 4TQ9A 2Q0HA 1AN0A 1SCDA 2SCUB 3BB3A 2GUGA 1D1TA 4MGIR 2CT8A 2H4YA 4XIGS 2VP3A 3U9LA 1P60A 3P9NA 3LX5A 3O8CA 3LT4A 4BVGA 4TV9F 4YI5A 1AQLA 4CTOA 4LYDA 3D6TB 2FXIA 1ZMBA 5FOSA 1RRMA 2B2CA 4D8YA 4JJ7A 2JBAB 3DAOA 3CXRA 1FDTA 4GO1A 3RRNA 1Z4JA 2ZYDA 4RXMA 3RKSA 3RLIA 2GNOA 4BV2A 2VJAA 4O0MA 1FVFA 2EFJA 4IUCS 2YMPA 3OKFA 4JZYA 4QRIA 4UAJA 4DB2A 1D5WA 2ORED 2R00A 4UM8B 3OT1B 1Z2CA 4DJEC 4MQ5A 3TRIA 4EO7A 4F3YA 2IHNA 4M9ZA 4Y9RA 1F38A 2Z9DA 3IPYA 3C6XA 4RV9A 3U3MA 3ZQ4A 4AQDA 3VPXA 1DAIA 5JSFA 3CSDA 3T3DA 1TM5E 3QVGB 3V5NA 1NLFA 4WN3A 3X1DA 1K6EA 2PSDA 3HFRA 4IOLA 1WB9A 4CEIB 3DFKA 5EP1A 4LDZA 2IYRA 3AIOA 5LA6A 3TEFA 5JWRA 2J87A 3ED1A 5DMHA 4QE3A 4N3AA 1MJGA 4R5HA 3ZHRA 4B31A 1XDSA 3OIWA 5E9QA 1H69A 4KH0A 2XA2A 1YAJA 4DDVA 4EA6A 5FV4A 5JT1A 1GRQA 4LF8B 2Q3FA 3V1UA 2ZRDA 1E2FA 1U2DC 3RSFA 1RE0A 5CVJA 5KOHB 1QLJA 3OQIA 2FV8A 1MVNA 2G17A 4AO6A 4QU0A 1LB1B 4MSUA 2I62A 3JZMA 3K6KA 1T5OA 3RYIB 2C20A 4NZPA 3RRBA 4ER0A 1XU4A 1SHTX 5AJWA 5FIUA 3X43A 2PT7A 2WQZA 4MVJE 4MVJF 3KELA 1SKBA 4HX2A 2P6OA 4W1QA 3K9LA 1J0DA 3IMCA 5FNVA 4OX9B 4LHYA 3I39X 3E61A 4BZWA 3ABSB 1E96A 5C18A 4R40A 4QG3A 1E5LA 2OM2A 5LMCA 5B3KA 1Y1KE 1CUCA 3JQCA 4C89A 5LYJB 3EARA 4JCCA 4GVXA 2WNIA 1U0FA 5AVSA 1N92A 2O7QA 5CT6A 4IYJA 1D2MA 3LKVA 4QFBA 3FJOA 4AIRA 2WKQA 5G3ZA 1O6ZA 5TF0A 5JFTA 1QFJA 2YMMA 2Q1UA 3JVIA 3T9AA 3UHJA 2FQYA 4EHJA 5CCEA 4DV3B 2P11A 1ILEA 2HQ1A 2GZRA 1EFHA 3PQ7A 2D5BA 2EHJA 3O94A 1AS2A 1EJBA 1UXGA 1BGVA 3NHKA 1K4YA 1CQZA 1L2TA 2W7TA 4M8KA 2XGSA 1Q0SA 1N5MA 1XZAA 3OQ1A 3FFXA 2JIZA 3FHLA 2O2CA 4GYJA 2W70A 5LIPA 1VL5A 4YRQA 1P39A 5P21A 4J94A 3IPXA 3KZKA 1TKAA 4J8PA 2JJMA 2DFVA 2WDPA 3IOCA 1F6WA 3JSAA 4F9FA 2Y71A 3BBPA 1E2EA 3AM4A 3ZDCA 1LPPA 5B7QA 4OQDA 3H16A 4R1QA 3WLMA 1CDEA 4E2XA 3EDMA 4HH0A 4TMFA 4EKNB 3L92A 5BMVB 3LM8A 1BFKA 1V3VA 1WB4A 1NXWA 4IKPA 3HXLA 2QRVA 5AKEA 4RABA 2I2AA 2Q41A 3WIDA 5CCDA 5D86A 1ZI9A 2WT4A 4P4UA 4JVMA 2PBZA 1F06A 3S1SA 2JFXA 5K2OA 1TUBA 1C1XA 5F3RA 4CF4A 3WKDA 4D8WA 4F85A 5FFFA 4DUYB 3PP8A 1FL9A 1KVRA 3VSDA 4CLRB 1DKMA 2NN3C 3M70A 1OLXA 4K05A 5CX1A 3LDGA 2OO7A 2R68A 3C6MA 5M3BA 5ADUS 2BZ0A 4UMDA 2AG8A 1FU7A 2AJLI 4R9SA 1HE3A 2RMKA 3KTAA 2H2FA 3LO8A 4FEGA 4RHTA 3AZPA 4AY3A 5CB4A 1QP4A 1WPXA 3R20A 5M34A 1MO3A 2OB1A 2A6PA 2W93A 2D2VA 1EUDB 4HB2A 4BLUA 4TYWA 1S9DA 1R0LA 1V4VA 1INLA 2EAUA 4C0JA 1C3LA 1P2DA 2HJVA 5GY7A 2W58A 2QTAA 5LOVA 1VIDA 1TTHA 1ZGGA 3GELA 1JG6A 1UPBA 4IJUA 5DT2A 4TYQA 3ZV4A 1E1LA 1R00A 1LC3A 1GQ2A 3N6RA 3O74A 5BV7A 4GI7A 1KAMA 2GR9A 4J7CA 3LKZA 4OHBA 1B0PA 4XD2A 1DJPA 2FMKA 4ZEMA 5CITA 1T6BY 1QF7A 2NW6A 4YHBA 3ZXUB 2JCVA 1DQPA 1N6HA 3EZ7A 5J5AA 4F5ZA 2PSFA 3NOVA 4QFCA 2WG0A 4E3WA 5M2QA 3A8TA 2CUKA 2GN9A 4KE7A 3L1IA 2O3SA 3R5SA 1ENYA 4RIIA 4KDCA 1BW9B 5HDQA 1XQXA 3FUVA 2VPXA 5G0WA 3IQGX 3QJYA 4KQIA 2PRIA 4O2RA 5H59A 2FSVA 4E4RA 4JNKA 5FP0A 3BWCA 2C7OA 2CNBA 1WP4A 1Y1PA 1XLTC 4KQKA 4QYMA 2A1IA 5D84A 3UQYS 1JQLB 1E18A 1LEHA 1JG7A 1QP8A 1T0HB 3B7WA 3MYRA 4K8OA 1HI9A 4RLSA 3WBKA 4BTLA 1FNNA 1M74A 2RBGA 4R16A 3GX1A 2CXNA 1J8DA 3MRSA 3WGQA 2Q7XA 5AKIA 3K5PA 4D92A 4NZYA 2IE0A 3BXPA 4R8MA 2HADA 4TWJA 1MVOA 2CBXA 4KAXA 1ZJ6A 2VLIA 4TTTS 4DG8A 4NECA 4YBRA 1VGVA 1E0KA 4ONEA 2IU4A 4N01A 5IAKA 3UZUA 1E5VA 2E49A 4YLYA 2NQTA 4AMBA 2CLOB 3I5AA 5ALEA 1HL7A 1O6BA 3LVFO 3HBLA 2GETA 3COWA 3LAWA 2DHDA 3RVNA 3QU5A 2XNHA 4B4OA 1QF6A 2WHXA 3EXHA 3H2IA 3Q2KA 2FPLA 2X14A 5FPYA 1G9XA 4XWOA 4LG1A 1G38A 4RTJA 4IZHA 1XIVA 3LZCA 3G9XA 2SKCA 2ZROA 2GCIA 2ZIZA 3C97A 4BGIA 5THKA 3IL2A 3LLVA 3VR5D 1BE6A 3OE7D 5CK4A 3WL5A 3TQIA 3PUWA 4CKZA 4JYZA 4DR1B 2I91A 4GW3A 3ESXA 4CG0A 3GHYA 4NCAA 5IM4F 1WXEA 1Z5ZA 4MZXA 2ZB2A 2GERA 4HDKA 5H9VA 1C7FA 4JJKA 3VR0A 1EP9A 1IEVA 2FZ5A 1ZRMA 2MIIA 1ECFA 4WCFA 2VC2B 4XR4A 4MR7B 4XUGB 3T3EA 1ADJA 5TGDA 2QSYA 4J9VA 3A70A 1R5BA 3VBCA 4R0VA 4GX1A 3NXSA 3KT6A 5FCDA 4A15A 4GP7A 4DXAA 5CB8A 5GONA 1JNXX 2NV0A 3QMMA 3C24A 3K31A 2H92A 2CNLA 2BF4A 3MG9A 2W6ZA 3UAVA 5I8ZA 3T6KA 2GTHA 2X19A 4II3A 3W4IA 5M7EA 4FYVA 1KYZA 3QUSA 1S96A 1NUTA 1GPNA 3I4CA 3NTUA 4JJGA 4XXHA 5IT0A 3CHYA 2MYNA 5KO2A 3D6NB 2D7CA 3KSDO 4EYSA 3AR6A 2ZU6A 4XTCS 5K9ZA 1SA0A 2ZIFA 4IXWA 5JAOA 1OBHA 2EF0A 3U3DA 4RIFA 1YULA 1F14A 4AYXA 1G3MA 4U9UA 1J8YF 2R1TB 3BAFA 1GV1A 2WR8A 2RJOA 4UEKA 3SKXA 4NBWA 1FSFA 3T35A 3PDWA 2XVYA 4R9RA 4CKBA 4G0PA 1Y8RA 4L74A 4BEVA 5IF3A 3AKEA 1JIUA 2PVCA 3BIOA 2CXXA 2ZUWA 1WDMA 2IIVA 3KJNA 3KHSA 3MM4A 4MW5A 4C0AC 3MILA 4RZSA 1AO0A 2Z6QA 4OFXA 2PFGA 4K9MA 3F3MA 4F8EA 1ZA1A 4HDNA 2HK7A 4G0QA 4UFOA 4AJIA 5EIFA 2X6TA 1WCWA 2PH3A 3CPEA 4NDAA 4RE6A 3VR6A 3WNBA 2NZ2A 3U0BA 4PZ0A 2D54A 1YCGA 2C7VA 2LE0A 4O5OA 4KHZA 2AJ8A 4FXPA 1SB9A 1KRHA 4NU0A 1G20A 4FHCA 1KFJB 1M2OA 1YS2X 4KUEA 4KXFB 5JLAA 3VH2A 4EHBA 3FXAA 1GPKA 1C0LA 1GAEO 4LDPA 2DWPA 4HPXB 4KK3A 1KO5A 3T7IA 1IYZA 2XJ4A 5GJWC 1X80A 4YT2A 4Z7NB 5HYVA 2GA9A 4NK5A 4DA4A 3G79A 4DAOA 1U0EA 4YNBA 1KAHA 2AZ4A 2BMDA 5IDYA 3RS5A 2ECOA 2VPQA 2FMHA 1GQOA 4RZ3A 4XGKA 1HT1E 3HGQA 3ZWAA 1D03A 1PL7A 4Z6KA 1B3BA 1VHLA 3EFOB 4PZLA 1LF5A 4G4IA 4RHEA 5MN4A 3T7SA 1ICEA 1XC7A 2W8BA 3ETJA 4H6WA 5EZ6B 2FZ4A 1V4BA 3G7SA 3UJ8A 3EVBA 2FCRA 5LKRA 4R8RA 1D3AA 1L5SA 3HN2A 3RO7A 3QX3A 4HJRA 3KPJA 3AWDA 1QVWA 3OFNA 4KUGA 1IQUA 1R6VA 2V9PA 3PFGA 4XLLA 5DTQA 3HVUA 5KI6A 1ZMOA 3CEAA 4O8CA 1Y4UA 1JNYA 3K16A 1XEFA 3KTOA 2PVPA 4RESA 1VBKA 5JZBA 5JADA 3W06A 3SEAA 2CFOA 1P72A 1CTQA 4JBGA 1IBCA 1KEEA 3G82C 1Y9DA 3K9QO 5FDFA 1ULBA 2W4IA 5TRTA 4KYVA 4JT8A 1CZLA 4GZ5A 4D8XA 4Y30A 2YVKA 2X0NA 1TK9A 2OXFA 2QP9X 4F4DA 1C3OA 4DLTA 1EE1A 1F1JA 2EP7A 1ADYA 4Q3BA 5EGSA 4E5PA 5AVXA 3LUJA 5FO1A 2JIZD 2QX8A 3ZLVA 3TGWA 3IHKA 2ZIXB 3CUWA 4DARA 1IM5A 1P0QA 1BVRA 2C3PA 2E4XA 1ZD3A 3LBIA 3OEHA 1Y7LA 4P08A 4R2JA 3W5BA 4KMOA 3MJ4A 4L5JA 4NXMB 4GPAA 1UJ2A 3BWVA 1SUEA 4M0PA 2AX3A 4H18A 3Q15C 3ZE2B 4Z4EA 5EN4A 2YJ6A 3SWWA 2CHEA 3DJYA 4RNCA 3ZOZA 3C0KA 1FFXB 1S1CA 1XJ5A 1CRLA 2EC5A 3IHTA 3DNPA 4MP6A 2XT9A 4EIWA 3L5KA 3JS5A 3OE7A 4RPLA 1PF7E 1U4SA 3AHHA 3WI7A 1U0BB 2CK3A 1V25A 4I46A 3IBFA 3EIFA 3KK0A 3AXTA 3KHUA 4EYOA 1T3TA 2Z5VA 2JGKA 4NCNA 3UOAB 5A06A 2AD5A 4QREA 1NZJA 1TADA 3HR8A 4BRWA 3S0JA 1ACLA 3NASA 4Q4AB 1QZ3A 4D3YA 2XF2A 2WKWA 4ZHQF 4FBGA 4UHCA 1X77A 2FZEA 2XHEA 4YUAA 3GJYA 5HE9A 1G3UA 1GKIA 3Q0IA 3P9KA 2HDWA 1HC7A 3KDPA 4CF6A 4PFKA 2CMHA 2VP0A 3P2MA 1OB5A 4RD2A 2QMHA 6ADHA 2Q29A 2VQDA 2ID9A 3V6MA 1P4GA 3R5KA 4OGLA 1JLHA 1DWOA 2PGOA 5BWMA 4R6XA 5CMLA 4TMWA 5BV2P 2OFOA 2P27A 3RK1A 4AS1A 3ROZA 1LVUA 5GZ3A 3TYXA 3DKVA 3V4PB 3EUAA 1J5PA 1ESNA 1T8SA 2YWBA 1X15A 1YL6A 2QM8A 4H7JA 1G3RA 1KKUA 3C6BA 1W88B 2CY0A 2ONCA 2PSJA 1HE4A 3JY6A 1UQTA 3O26A 4WTOA 3ZK8A 4A91A 1IC6A 1PSDA 4AKIA 2IIPA 3IV9A 1G6OA 4P2BA 4UM7A 5LMNB 1IY9A 1SCUB 4EUSA 4MKFA 1LPOA 3ETHA 2RB4A 5NULA 3WDSA 3NBQA 3KQYA 2PUEA 3KL4A 4P93A 3WIUA 3RB8A 2UYHA 2Z2YA 3P2IA 4S1NA 4LOLA 4DYVA 3DEHA 3K0HA 3OZUA 4M8LA 4JVLA 1PO7A 1Z06A 4OXYA 4B87A 4BRSA 1P7ZA 1OIWA 1PWXA 1Q0RA 5IC4A 2DFKB 2XYVA 2WM3A 3L7IA 1I80A 4V0RA 5JTTA 5LCXA 2ATEA 4CBVA 3MT0A 2L0XA 4RUKA 2I1LA 3QPCA 5AJVB 3DYVA 1FF9A 3L8EA 5HJ7A 3ZYZA 4J0FA 1E2GA 2JL1A 2YJ5A 2ZYSA 4M83A 3UJAA 4IEEA 4D96A 1NZDA 4KWHA 1TNDA 2ASVA 5TQ2A 2VTVA 3PUIA 3QMVA 4ZVOA 1J0AA 1U11A 4TPKA 5C1IA 5BY2A 4EEXA 3E7PA 2Y1WA 2A92A 3K2IA 5SZIA 3HUFA 3HB5X 4IDGA 5AI4A 1D2HA 3NDJA 4YA6A 1AZLA 3EFHA 3VZQA 4FVTA 3TPFA 1F8YA 1GZ3A 2HM7A 3QE9Y 1XCLA 4P1ZA 3T7RA 2G0TA 1T3LA 1IULA 2EFDB 3BK1A 3R77A 3UATA 5BSKA 4WZAE 1P9LA 3UJ3X 4P4NA 2NADA 1TAUA 2GKOA 1D7OA 1UK8A 4P36A 4D2IA 4PYRA 2OHXA 3LCRA 1CR1A 2GKGA 1N6PA 3H0EA 5KVSA 4GZLA 5HQ3B 2VAPA 4LDJA 2QQFA 4AJEA 3ADCA 1JDBB 3JZIA 2BGJA 3NP7A 5DJ5A 4DR2B 4MRPA 4HBZA 3KR0A 2GD1O 3O91A 1H94A 4JB8A 1FTGA 1ZL0A 4O4HB 1UM9A 1SXJA 2QQ0A 2O4UX 2YXLA 4UZFA 5CIQA 3WHIA 4U2BA 2OHFA 4IQ8A 5GPBA 4QGSA 1S1MA 1I24A 3NIDB 4YRCA 3EXFB 4OL9A 3RABA 1DAPA 1U5BA 1YHNA 1T34A 4KXUA 3LWDA 1M73E 1KQNA 1CUSA 4B1FA 5JAMA 3Q7EA 1U7UA 1C9YA 4TL9A 4CLRA 2XTZA 5AVQA 1MGOA 4AKGA 4QRDA 4EHLA 5KYWA 1XTPA 1V7PC 5I9LA 1DAMA 5L95A 4MX8A 5A9SA 1JHMA 5ADWA 5T3YA 1GGVA 1KEWA 2VP6A 4FBLA 4I7EA 4FS8A 4IVPA 2AF4C 1Z0IA 3EEFA 1TYAE 4UEQA 2P35A 2BEKA 4L72A 3A9WA 3SX4A 1WXGA 3PV0A 4X91A 2QTGA 2O50A 1DXHA 3JWEA 3G0CA 4J16A 4Q4AA 4PG7A 4RTMA 3IDQA 1XTRA 4G0VA 4ACBA 5DLPA 4TVOA 1TC2A 4LISA 4LZLA 1T0JB 4XIFA 1TF5A 2C3YA 5BUSA 1XR3A 1QANA 3O03A 1OWNA 2BRUA 2WWVD 5JS2A 4YMTA 4TVBA 4AKHA 2J8ZA 2XYPA 1ECJA 1USWA 4G1EB 4ZZ2A 2BFCA 1SN7A 2IEDA 2YHBA 4EFKA 3PHIA 5E1BA 3C3MA 1XZBA 2CDBA 4EAAA 3FWNA 5IWAB 5FO0A 4OYYA 1P2GA 1X2BA 3QA9A 3MJTA 3U62A 3PFKA 1K4KA 1RXSA 3THYA 1C81A 1WM1A 3VPCA 4NOMA 4TVKA 2BEVB 3AW9A 3I1FA 2CVHA 3JWJA 3VH1A 3EA5A 4BVJA 1UZNA 3O47A 5T57A 1YZLA 2YNMD 4KO4S 3OOYA 4H7KA 4ML3A 3BJZA 4XYMA 4DV0B 2L2QA 1UJ5A 3L6DA 2MHCA 4R2LA 1RWKA 1OI3A 1NJ5A 3ITEA 3TOXA 3F6EX 3GLQA 1RPJA 2A4MA 3KD2A 4QPNA 1R9MA 2PWYA 4KPYA 1EJ2A 1AMUA 2RSLA 4X8HA 2X8JB 3NAQA 4TQGA 4MRVA 3IDZA 2RHBA 2GSWA 4R2WA 2HA6A 3CZMA 3TTTA 3NAZA 3W1VA 4DT1B 4DVJA 2VAMA 3ZHVA 1BAPA 2DKFA 1YZYA 2GUWA 1F9AA 1CUEA 1FFDA 2J3IA 3EOBI 3FVVA 3Q7IA 2XNCA 3FCUB 1HPLA 4LHWA 4UM5A 3TW8A 1NHWA 4I2NA 4DIEA 2QTNA 3KHKA 5AUQA 3DHWC 1ACMA 4EJ0A 1G6HA 5EWMB 1I7LA 3RYIA 1NATA 4G25A 1SVNA 3N0RA 1S2GA 2XXJA 3RYHA 3QFRA 3VVMA 1C8VB 2OLEA 3RHTA 2B8WA 1WZUA 4MINA 1VRVA 1CZUA 1GQQA 3F90A 2GBLC 3LL7A 2FVYA 4F71A 5C8DA 2YZGA 4J03A 2P62A 2W2TA 4HWGA 1T1GA 4L3VA 4RORA 5EE5B 2WD9A 2JFPA 4OIMA 1E1NA 4JL6A 1AQYA 1UPUA 1LDNA 1CSEE 3B6KA 4ND1A 4KU4A 4BMDA 2VT7A 1GG8A 2BFOA 2NVBA 5LXTF 4DCCA 1ZVKA 1W85A 2HA5A 1W8IA 1NM5A 1D9ZA 4FHFA 1QTQA 2QX9A 1WLYA 2WJHA 2DETA 3PXUA 3GN2A 1NN3A 2X9GA 2ZUBA 1KVSA 1OT3A 4IDHA 1V2GA 1GUDA 3L6CA 5G40A 2QEQA 2GASA 2HWXA 2Q50A 1OX4B 2ASEA 3KNZA 4TLMB 1IU9A 2EFHB 5J5VA 2PUCA 3AJ9A 1Y5RA 2QSZA 4QOFA 3W8EA 4F4IA 1TCCA 3NC1C 4Y1FA 4MB6A 1KMNA 3OESA 3OO1A 3WMXA 4ZZ3A 1WG8A 1P61B 1HE1C 1DG1G 3VHQA 1YZUA 2H1SA 4P6VF 4Y1RB 5E7IA 1RHQA 1JMKC 1M72A 3JQGB 5EIOA 1Y8RB 2PIAA 3V4FA 1SVWA 4WDRA 3WLLA 3L4BC 4QC2A 3L8GA 4DR4B 2PMDA 2BR3A 1AD2A 5IBCA 1G98A 1XQ6A 4UEJA 1DWQA 1KJ9A 1W35A 1OWPA 4UXHA 4BPRA 5GQSA 2A9FA 4L1KA 1WUIS 4EPWA 3ZQ6A 1QHNA 2HIGA 1O97D 3W6ZA 3U44B 1SA0B 4QAQA 1G21A 3WO0A 3U5ZB 1Z2OX 1PJRA 5AJUA 1JYFA 2O3RA 4X8LA 2FFQA 2DP4E 1FUEA 1OKKD 4FNAA 4AWBA 1B8VA 3K2QA 5MFZA 1QRAA 2HF8A 4QYXA 3E23A 3BMOB 2Y4NA 4OQYA 1SXHA 1UJ6A 4AT1A 2BM8A 3ETLA 3LGAA 2JLCA 3U3RA 3RC8A 1CT9A 2QXUA 2Y1OA 3FF4A 2PLAA 4C03A 1XV5A 2ROQA 1WXFA 1XNHA 3DMDA 2IYTA 4J9UE 4AO7A 1ZC4A 3DMHA 1M34A 1Z0AA 3GPIA 4IJWA 4K9PA 3CBGA 1JR3A 1B2LA 1UKCA 3HJRA 1FLDA 3GLTA 1JAYA 1YMUA 1VLHA 4XGQA 3R7FA 4QSMA 4LAFA 5IHXA 3H19A 3KOWA 1O95D 4E5MA 3WL8A 5LQUA 4F1WA 2IYEA 1Y1QA 4QBIA 3QFFA 3DEZA 3GJ7A 3WR5A 3QIVA 1T6XA 4GQBA 3IULA 3N2EA 5G4KB 2PX3A 2FJPA 3WK9A 4DRXB 1FZTA 1MABB 4TVSA 3U61B 1H2HA 2AUMA 3TQOA 2X7XA 4GAEA 4RSGA 1VM6A 2FZGA 2RI6A 4BP9A 4KI0A 2GBPA 2EJWA 3RADC 1BU8A 1MENA 2NUAB 2WWYA 4MVJP 3V46A 4KXLA 4TSFD 3DYBA 1MAHA 4BKMA 2PTGA 4KRFA 4FFRA 4ABYA 2A5LA 4RMIA 3Q8XB 5SYNA 4KREA 2JRLA 2XI4A 3O4VA 1FDSA 1NQUA 5CT9A 4CMEA 3V2GA 5L7TA 1TA4A 3FCEA 2ZM6B 1ATZA 2F8TA 1C29B 1WPQA 2PYDA 4HCJA 4TXMA 1MHTA 4GECA 2JIMA 2C5HA 1UMBB 1V9CA 3JRWA 4NBLA 1VC2A 3C14C 1IXYA 5K8LA 3OWXA 4X7PA 3EQ2A 1W76A 2J9GA 2YC2C 3KKEA 4ZGGA 3WAGA 1ZD4A 4YAWA 1MW9X 1MV5A 1CIPA 1Q84A 4ZXFA 5CYOA 2CKMA 4I5EA 5CDSA 1JZTA 2RKBA 2JGLA 1V96A 3V8PA 1I7PA 5CXXA 3NUGA 4TV8B 2HNAA 4QD3A 5C3UA 1E4VA 3MWYW 3ZHQA 3DAPA 3D4LA 3FKJA 4CQLB 3KQLA 3FLBA 1U1CA 2Q3EA 1VIYA 2VZ0A 4Y2GA 4B47A 3ABZA 1TW3A 4AQYB 2QZPA 5LUAA 2GYYA 3M82A 3PQEA 3DONA 3N2YA 4Q03A 5EMMA 5FPQA 4DL9A 4MW0A 3LHIA 4JR1A 4HNQA 2GRUA 1G2QA 3KT8A 1TE2A 3ZXSA 3ZD6A 4BJ3A 5LBTA 5H5JA 4QT4A 4P38A 3P32A 3RSLA 3JQ9A 4JJ8A 5LQKA 4GIBA 3HB1A 3HLKA 3F46A 4UBLA 3BJMA 5CDUA 1KTVA 4CV1A 1R10A 2PNFA 2VHVA 4OI1A 5J4HA 4KR2A 2BWJA 4E08A 1CD5A 1F4PA 1LBQA 2XOKD 3O73A 2UUAB 3SVLA 1Q0QA 2BI7A 2ONZA 3EW7A 4QJ3A 4OBEA 2VNAA 4M7OA 4UZSA 4E94A 4ERNA 1SIWA 4LBWA 5B3LA 1O5OA 1C7EA 2C03A 2NNLD 4HNHA 3DZJA 1YACA 1WW8A 4K2HA 3TLGB 5I9IA 3SYKA 3GUYA 4KMRA 2NU8A 3I62A 4H7IA 4Q9JA 5CCXA 3V2IA 3IEPA 5FORA 4X60A 2EJCA 3BORA 3O21A 2J85A 4NYJQ 4IH4A 3D8TA 5DM2A 5E2AA 1E0JA 3AERA 4CDRA 2BFDB 2RH5A 4X94A 2CVQA 4JI2B 1A27A 3EISA 2XQJA 3PT5A 4YO8A 1X74A 2CW5A 4BNDB 1BDJA 4UPEA 5I7WA 3DR3A 2XAAA 4O25A 2WDZA 2WU3A 3Q5DA 2ZE8A 4ZXPA 1T9KA 1QYRA 4C87A 2JBWA 2R6ZA 1P0PA 4OHCA 5I9MA 3TLCA 3TFWA 2JIOA 1O3YA 4DS3A 3NWEA 5JSYA 2VTBB 3NHZA 3LS2A 5A05A 2Q3CA 2Q4OA 5CA0A 2C00A 1R0ZA 2BBOA 4WFKA 4FQ8A 4AG3A 4AJ2A 1S89A 4PY2A 3WHKA 1EUZA 5A4FS 4CKWB 1K98A 3L7NA 1B76A 2OOSA 5KMGA 5JVDF 2VDJA 4KIJA 2CDAA 2Q9BA 1JKJB 2BGMA 2OO5A 2V6JA 4JJIA 3VNBA 3WADA 5B1YA 3K0SA 3B70A 1UFKA 2K2QB 4IICA 4L9RA 3UPTA 2I2BA 1NY5A 1JFFB 2QAGB 1M66A 3M6FA 3JZDA 3RTEA 3R6TA 4MWOA 4AP6A 4IILA 5GTDA 2VZ9A 4L9WA 5CLGA 2ARKA 3UGJA 2ISCA 2QOEA 4BU0A 1U2SA 1Z13A 2GAAA 3GRUA 1A8PA 1Y4ZA 1BKSB 1PR1A 3UT6A 2ZKLA 4G81A 2Y0BA 2GEDA 3D2BA 2DY0A 3GPLA 4PW0A 3K9WA 3RYFA 3HEMA 1C9NA 4RD3A 5JZSA 2F3PA 5DE3A 3OG9A 2P4UA 4WOCA 4CG2A 4BQFA 4UQOA 3UM9A 2DU8A 3NDRA 1IPHA 1FTYA 1NVDA 5B58T 1HDOA 3RK0A 1CLUA 1HYBA 5J40A 4LNUB 3P27A 4UXIA 5GM2A 1DX9A 2MSWA 4GFDA 4M86A 3HZRA 5KWIA 3PFNA 1PK9A 2NACA 4QEKA 1CF4A 4GOJA 4R1PA 1YUBA 2AG0A 4YROA 2GT1A 3PX3A 2QNBA 2P9ZA 2REQB 2WJ6A 3TSOA 5J2UB 2O8DA 1SUPA 3DMTC 2F1JA 2O2DA 4L4UA 2F4NA 4OYHA 3L9WA 4YC7A 3SOPA 3ZZTA 5AHKA 1MB0A 1BMQA 2GO7A 1IEQA 4YCJA 3FVQA 1N2XA 1CY8A 1RYMA 2IS1A 4LGVA 2HHLA 1MO2A 1RM3A 2RDMA 4G4GA 4ZARA 5F2OA 3IKTA 4PONA 3QTTA 3ES9A 4A8JA 4RY8A 4CM7A 2YWHA 3PD1A 3ZDEA 3HCCA 4IIJF 1TAHA 3SHVA 2MJLA 2JK1A 2Q9UA 3D3WB 2X8WA 4K87A 3BT7A 5BXQC 4XSHA 4WY5A 3VYTB 4KXQA 2YS6A 1G7RA 4OSPA 4B73A 3E82A 2OP1A 1IG3A 1LBTA 1HG0A 3G0OA 1OE0A 1TEHA 5A4IS 2ONYA 5AOVA 2B8NA 5E0KB 2ZM5A 2HSWA 1H4TA 2A1TR 2FN9A 3X1KA 5TJ9A 4DGSA 1N5IA 4JLKA 4DYHA 2C98A 2Q5LA 1R0WA 2PX4A 2VH2A 4R3NA 1PEDA 4CEIA 1QRRA 3QVGA 3VMFA 4YCLA 3AY7A 4QU8A 3D59A 4M0LA 1W1WA 3HACA 1Z15A 1NW7A 4WE3A 4ZWNA 3WOHA 1XZDA 2AC4A 2QE6A 3DR5A 1N3IA 3PJFA 3RWOA 4MMZB 3SC3A 5JQWA 4RL4A 2AKYA 5B37A 3BTSA 2R4UA 2ZI4A 8AT1A 2OCLA 4BIMA 1G18A 1X7HA 4ES6A 3CNQS 1XEXA 2BGLA 2LCIA 1VIMA 3LKBA 4RVUA 4WK2B 5DBHX 3NR2A 3MCWA 3SLKA 4ADSG 4EY4A 5HPYB 2V1UA 4GT1A 1CHNA 1YVUA 4RANA 5AKKA 5IBPA 4R31A 1E1QD 4CFSA 2IYUA 3TQCA 9ABPA 5A7HA 2WPDD 3FM9A 4EA9A 1XDUA 2GVZC 2H48A 3UCEA 1USUA 1ZCBA 3LBYA 3AMVA 5I5GA 2HF9A 2R6HA 3P4XA 1DBRA 1ZK4A 3N0TA 2VRNA 3AUFA 3CNOA 4GWKA 4JGGA 3RI3A 1ABBA 1V7ZA 2YINC 2OYCA 3GLGB 4LXHA 3RRZA 1SIUA 4M9QA 1E4YA 1TM3E 4L22A 2Q1YA 3GC6A 3WGNA 2QYSA 4EK9A 1PEKE 4D26A 1YDFA 2JD1A 3Q10A 4HAUA 5AVUA 4KDFA 3TO5A 1NXQA 1YBFA 3HKBB 3IUQA 3KQQA 1QV7A 4M4SA 4LCBA 3GQBB 1QGZA 1YQTA 3ZEAA 3N8GA 2QMZA 4CUZA 4D1YA 4YCAA 3ZLBA 1DNPA 1SC9A 5DTMA 4FONA 3RFTA 1SELA 3CLTC 3B6JA 4TMTA 5CNIA 2FETA 2PIDA 4GI1A 1RBYA 2PH1A 3H8JA 3KDAA 5CHEA 5FPSA 7AT1A 1M1YE 1JH8A 4ZAFA 2IDKA 1P8AA 1XA0A 1ZVMA 2QHXA 3EF3A 2WNSA 1XFDA 2DTXA 4PHGA 3LI2A 5FNVF 2V6BA 4FGJA 4MP3A 2WHPA 3NIGB 4PBRA 3KZXA 5EPEA 4ENWA 4I66A 5KUTA 4D56A 2VHZA 1KS9A 1KJ8A 1S5PA 1KHHA 1MNQA 5AXDA 3NONA 4ZCLA 3WYBA 3MJCA 4C7XA 1FVXA 4LECA 4REQA 1LK7A 1JEQB 1P2SA 3FR7A 3I37X 3R0XA 2PRJA 3BGSA 2R2GA 2HWWA 3M1LA 1GZSA 1QWOA 2AWOA 3TW4A 4Z2YA 3VSBA 5IK2A 5BMVF 5K03A 1YWGO 2GN0A 1O95A 1BJTA 2ZSAA 3B9RA 3LWBA 4OFZA 4PQYA 3VKVA 4TMZA 4OK6A 4Z9XA 4UVIA 4ZO4A 2ZT8A 3DBVO 2BH2A 4JLPA 3C3BA 3E7FA 1U6KA 2BUBA 3HKEB 4CRWB 3A10A 3VKHA 5LQNA 1WXXA 1D4FA 1Y7TA 1T5SA 3MCZA 4RJKA 1WUHS 4MV3A 4PO8A 3UTCA 2EKQA 4FJ1A 3OLZA 2WIGA 2NV2B 2LTAA 3F5QA 2O8CA 5DNVA 1N2GA 5JMWA 2G0AA 2MYTA 2ZZKA 1DIHA 3OCVA 5E4YA 4ZI3A 7YASA 5I4KA 3VKGA 3S2IA 1T9HA 4PG5A 4WN9A 4UARA 4Z9BA 2V0CA 2WTAA 4FHGA 4FLMA 4KR7A 2B36A 3OHMA 4JOSA 3TEMA 1F8GA 4OHXA 1XPOA 2JGFA 3DV9A 1IWBB 2A1TS 4J1TA 4L02A 5CLQA 1ZM2A 4HGZA 1VCHA 1UXKA 2QZ9A 5CCBA 1ENZA 5K3CA 1Y82A 3M83A 2WLSA 1CS0B 3SSNA 1J20A 1TT5B 1XD2B 2Q5FA 3B6EA 5EMJA 4DB4A 2WD8A 3N2GB 1FP1D 1P0FA 2VAVA 4W5JA 4FR0A 1QHHA 4R83A 4R5MA 3STUA 1GUFA 3KB8A 3VC3A 1Z4QA 2F3QA 4YXWA 2C99A 2FCAA 2O0HA 2P9CA 4U9HS 3CRVA 4C43A 1KSGA 5KYNA 2A57A 1IN6A 1T4DA 3F5MA 3LF1A 4L28A 3V7WA 3GW8A 4NJMB 2NVUA 5E7MA 3F3KA 2XCOA 1G8YA 2HPAA 1AE1A 2WJ4A 2W6QA 3I2KA 1MG0A 2VZLA 3SQOA 4B7CA 1O0CA 1UXJA 3STWA 1R5OA 1JIIA 1CQXA 3VU8A 1QORA 3P2YA 3B36A 2YHIA 2FPPA 4FYMA 4RJIA 2HR1A 3F78A 4NDZA 2PGDA 2FPUA 2G4VA 4I14A 3ZW7A 4D6YA 1X14A 2JAWA 1MA3A 3WV5A 5AWFC 5FFNA 3C4JA 3DZKA 1IN8A 3PU6A 3TL2A 5I7VA 1DUVG 1MX5A 4DR5B 4MUBA 4YMVA 3KLOA 2VPTA 2W6IA 4Q5IA 5CVUA 1RRGA 3T9EA 4W9RA 3IEMA 4E30A 3KOMA 5B2ZA 5CU7A 3SZ3A 3BGWA 3ZCTA 2OZPA 3R4CA 4BCCA 1YAHA 2ETXA 3IJPA 1B1CA 1XB2A 2PZFA 3LY7A 3GRCA 4BMSA 4GMDA 3WY9A 3PHLA 1BWQA 5KYXA 1XEWY 2YBEA 1U8ZA 1KOGA 1Z4NA 2P1ZA 4F21A 3I0MA 5B30A 4N9QA 4BWFB 3UYKA 2GYWA 5A5VA 4CTKA 3RU7A 3D02A 1MC1A 2PS0A 4XRRA 4TT3A 4YUYA 4BY9E 2EJBA 2VQ3A 3HNPA 2ZRNA 3DMRA 1KNXA 1YU6A 3PRHA 5ALLA 2RH8A 3NCHA 5J1SB 2B35A 4JB2A 2FMUA 2ZI9A 5ALDA 2BKXA 5CJPA 3NWBA 1B14A 1TPZA 2UVPB 4EO4A 5KVAA 1VDMA 2CN1A 4ZK6A 3CFYA 3O8QB 4RIEA 2O5VA 1W93A 3L4EA 3K8YA 2ZPTX 2Z1DA 4CEHB 1DDIA 1K7CA 2VJDA 2PEZA 3B53X 3CUYA 3AQIA 1M6VB 1QIJA 1DIBA 2PGJA 4H7HA 1VCNA 4HY3A 1IBRA 4TSKA 4L3OA 2XQGA 1IUKA 3IXLA 2BZ1A 4HF7A 1PZMA 4CT4B 2HDNB 1W1IA 1U1IA 3T9BA 2VNKA 4GF5A 5JCJA 3C7DB 3W8FA 2Q45A 1ZRNA 3FVTA 5C31A 4ZYTA 5CAEB 4BYMA 4EQ6A 4CR7A 3DEIA 3NU1A 3S8YA 3RUAA 2GHQA 1J0CA 3N7AA 3P4YA 3S55A 3OZSA 2XDWA 1CG6A 4QFMA 1NW8A 2NLOA 3JQBC 1RRKA 4NX2A 2AS0A 3QVXA 3ILVA 4C7VA 5LP6A 3QUTA 2FEXA 3EVNA 3KB2A 1HNXB 4QBFA 3ZWNA 2H1FA 3DL4A 4DLBA 3T9DA 4Q48A 4N5NA 4Y18A 1Q74A 4CF5A 2WAYA 4DV6B 3KU1A 1DC7A 2HJHA 1VG8A 1X0XA 4Q9DA 1UPXA 5HE8A 5ES4B 3ELYA 5SY6A 4XPIB 5JPIA 1NN0A 3LVBA 1J2TA 1MC4A 3RYHB 5ALVA 1FSZA 3H1AA 5DT9A 5HRUA 2NX2A 2CUZA 4DNPA 3FAZA 1I4LD 4ETIA 3ORYA 5AM2A 4EKYA 3ETNA 4BXOB 1VKRA 3RF6A 2CHFA 3C48A 3RCBA 3U37A 3CX4A 4MHTA 1RSZA 1AA6A 1XQVA 4DA6A 2OCXA 3ODPA 4REQB 3EPPA 1WTAA 5LN1A 2XD4A 3ZHYA 1GD1O 4U0JA 3RJZA 3KIPA 5AW2A 5B1SA 3OD1A 3PSAA 3VAYA 1PCXA 1T1RA 1TEXA 4LGMA 4WZAA 1M6WA 1GSOA 2ECKA 2XMGA 2BE7A 2RB5A 5TJHA 4DMMA 4F3TA 1PG5A 2XCTB 2RH4A 3FRHA 4QEZA 2WYUA 2XVZA 5IAOA 3T5TA 4N0MA 3I6ZA 2H9IA 2H8GA 4IDPA 3QX8A 2DUWA 3N87A 3D31A 5HSGA 1SVIA 4H77A 1SM4A 4NEGA 4NS1A 4P0TA 3VC1A 5LZ5A 3LGXA 2UZ4A 4R1SA 4C2TA 1DT5A 1SXJE 4TWRA 5JCOC 1L4BA 2A2ZA 2FXVA 4G5FA 1BMFA 1JHDA 1V3QE 5ER9A 1IIRA 3MTQA 4KWEA 3SNKA 1NBME 3O84A 1SUCA 2WUWE 4IHAA 1WMEA 2YTZA 4B3RB 4PF1A 3S2SA 2QQ5A 4BMCA 3OJEA 4G26A 1WCIA 5EA2A