3SJBA

Crystal structure of s. cerevisiae get3 in the open state in complex with get1 cytosolic domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
351
structure length
288
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 98
structure length 288
sequence length 351
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sjbA00
4QXAA 4URZR 4NE2A 4V0KA 5TARA 5KU1A 3QEOA 3QKUA 3WYFA 2IS6A 3SJCA 4C0QC 2W0MA 2FE4A 2QUZA 3IO5A 2GZDA 1ZC3A 1E9CA 3AF2A 4YMUA 1Z83A 2PJRA 2CCKA 2VSOA 2YC4C 2F3RA 4PHGA 2AR7A 1HEIA 1GIAA 4F4CA 1MO6A 5L3RA 3CKLA 2ZJYA 3SJAA 2F1RA 5F2EA 1HQYE 4KVAA 3L8YA 4BZQA 1E2HA 5SZIA 2HV8A 1DBSA 3CONA 5BQ5A 4NONA 1MABA 1YQTA 4ASUA 2A5FA 3QF4B 1E1RD 3KQHA 1OKKA 2NQ2C 1MKYA 3JZAA 1QVRA 3OE7D 3OEHA 3JVVA 3BK7A 1PUIA 4O2RA 2EVWX 1KTVA 2QQEA 5DSZA 1KMHB 1G4AE 2J3EA 1W36C 2FPMA 1G3RA 1K5GA 1G64A 1ZNYA 3R8CA 3NBXX 4KYUA 4HDQB 3TK1A 4DLZA 1XPRA 4I1VA 1E9BA 3T15A 3W90A 4P33A 3X1DA 1OT3A 5CB8A 1E79A 1W0KD 4OBEA 1G18A 4Q4HA 2ZPTX 3SN6A 1EWQA 2IYRA 3Q3JB 5AJYA 1KI7A 1KO1A 1ZAKA 2XNDA 1HUQA 2EQBA 2BMJA 2NO0A 1N0VC 1PLLA 2ZRDA 3C5CA 1YHNA 5CJ2A 4TSFA 2AD1A 3W3ZB 1GRRA 5J4VA 1NMXA 2WWHA 4JVLA 3ADCA 3AF1A 2RGNC 4CYMA 3TMKA 4MITA 1TAGA 1XBTA 4NYIQ 4RFVA 2ZE5A 4I1SA 3IPYA 4PZLA 3B13B 1NRJB 4O2LA 5HE9A 3GLIB 2O5VA 5F3WB 4HUQB 1HT2E 4BECA 4Q7LA 4JBYA 1ZM4A 4Q47A 3KUCA 5KO2A 1DG1G 4L9WA 2PH1A 1PLKA 4N0EA 1EFRA 2C77A 5JS7A 1AM4D 2QMOA 3LQRA 1OPXA 4AYXA 3DM5A 3I3SR 4G5OA 3K70D 1AGRA 1Q12A 3HU1A 1PZNA 4X8MA 3ICEA 5FR1A 5E7MA 1N6LA 6Q21A 1WQ1R 2H1LA 1NVUQ 4LJYA 4WIAA 3P1JA 1W36B 3EG5A 1LV7A 4QHSA 3THOA 1KHTA 2GXAA 4KXFB 1P60A 4Q7JB 5SZJA 2AKYA 4PO1A 4HAXA 4UJ3A 3WBKA 2G6BA 3R9XA 2QN6A 2HLDA 1T4GA 1ZC4A 3TLXA 1VIYA 4IXNA 2JJ2A 4PO9A 1F5NA 1R7RA 3GJ6A 4Q1FA 4B2LA 4I99A 2IXEA 5C2JB 2RGBA 4EFNA 1XPOA 1D5CA 3LNCA 4A6XA 2CLCX 1ZM7A 1FMJA 4F91B 1EESA 5CLLA 4B35A 4ZKEA 2QP4A 1MR3F 5BYJA 4R98A 2AFHE 3HYTA 2JLRA 3WMFA 2VF8A 3OIYA 2X8AA 4JL5A 4B74A 1SVSA 4NL4H 3RVBA 2QU8A 3ZVNA 5JJLA 1XJ0A 4R2IA 2ZSFA 2PX0A 4TSFD 5FTJA 2D2FA 2E87A 2Q3HA 4NZYA 3VHXA 5IT5A 1CXZA 3NTUA 4DT1B 4EPXA 1KK3A 1S9DA 2R8RA 2QEQA 2BJWA 1XXHE 2R6CA 1P72A 3QXJA 3QPUA 4OQFA 2OXCA 3A6PC 2N46A 5FBWB 1Q57A 2YWEA 2NIPA 2OUKA 4C2UA 2ODNA 1Z47A 4DLRA 1NBME 3I61A 1W49A 4OHVA 3S1AB 4IDHA 4XVQA 3PUYA 3T1VA 4JLAA 2JJ2D 1NSTA 2ZEJA 3K1JA 5FOXA 2BOVA 5EE0A 1XEXB 3CRRA 5ELXA 4D0LB 2B8WA 2H8KA 3OEED 3A1TA 1DVRA 1QHHA 2FN4A 3A36A 1L8QA 3CLVA 4EPRA 4EKDA 3UKDA 1TTTA 2IT1A 3AF4A 4TL8A 1XDBA 3BC1A 4AG6A 5JECA 3BERA 3SE0A 1NLFA 2PL3A 3V00A 3AVPA 4JLOA 2UVQA 4BQSA 4DLSA 4YMWA 3MSXA 3AV0B 1Q44A 2YWHA 3RS4A 3SI7A 2OXRA 2JLXA 4G5GA 1FZQA 4Y0VA 4EQ6A 3UANA 1NIJA 2GCOB 4D81A 3MWLA 3I62A 1FW6A 4NHOA 4H1VA 4JSYA 1US8B 1N5LA 1U94A 4Q1EA 4Q18A 4V0OA 2X77A 2ECKA 2EWVA 1TPZA 4TYNA 1OJLA 3MFYA 2O8CA 2CNWD 1AA9A 1OXTA 2VA8A 3B1YA 5EXPA 3O8BA 1KI8A 3T5GA 1D2EA 1YZGA 1WB9A 1LVGA 2HT6A 3B85A 3QG1A 5IK2D 5J4HA 1Z2CA 1OSNA 5KDDA 3TJZA 1XPUA 1NIPA 1UEJA 2P6UA 3M4YA 1E2DA 5H1YA 4UXIA 5CK4A 1GL6A 2Z6VA 1L4YA 4NYJR 2PBRA 1DARA 5KNBA 1EK0A 1OHHD 2DFTA 3LAWA 4PC6A 2ZRPA 2B92A 4V0MA 4BE7B 3CZPA 3I8XA 1H8HD 1T3LA 5TVKA 4WW0A 5AJXA 4KITB 1UBEA 1VHLA 2FSFA 2WWWA 1Z0DA 4Q19A 4QBIA 2FZLA 1KAGA 3UATA 4ZI2A 1UKVY 5JI2E 4KJZA 4RCZA 1KJYA 3X1XA 2RB4A 2KB0A 1Z3IX 3OZXA 3RSOA 4C7OB 4B73A 2PT5A 3TRFA 4AKIA 1XZPA 1Z07A 4EQ6B 4IDOA 4WBSA 4XD7A 1IJEA 2ZRHA 4MYTA 3THWA 3Q72A 3Q8XB 2PEYA 5AWFC 1AIPA 1SGWA 1IXZA 4C0AC 4C9BA 2FPLA 3RWOA 4QBGB 1Q1QA 2REOA 1SVLA 3MLEA 4KCGA 3SJZA 4JYBA 2CCGA 3L8ZA 2QM7A 4HZUB 1YZTA 3B1VA 3MG9A 1AQYA 1CLUA 1TQ2A 2WJVA 4JYCA 1N6NA 2ONJA 3ZS9A 4DWJA 3ZQ6A 4QGAA 4QHYA 1XEFA 2ZRMA 4B33A 4BFZA 4ZI3A 3T1OA 4TT3A 4LRWA 3RYTC 4Q1AA 2PX3A 4AKEA 2X19A 3BAFA 4MYUA 4UNPA 3RNLA 4CIDA 1NY5A 2VSFA 3BD9A 1RKBA 3B78A 2A5JA 4BPBA 1BYIA 1KDPA 1KJWA 3B8HA 4FW9A 5FR2A 4DDTA 2HCBA 4I81A 1N3BA 2NG1A 1P9WA 4DLTA 3TIFA 3E1SA 1E96A 3ZIAA 2H16A 3LXXA 4PHTA 1GL9B 3B6EA 4OHXA 1CR1A 3UMRA 4BFWA 3SR0A 4A8JB 3AQ4A 3QXXA 3B9PA 4Q48A 3OEHD 2QBYA 1G17A 1CRPA 4RFSA 3FOZA 1IOZA 1ZCBA 1J99A 4MGIR 3CX7A 2ZRIA 4P4UA 5EE5B 4B75A 1G8YA 5DISB 5KNDA 4M21A 5FPYA 4PC7A 3ZZ0A 4JMPA 4HB3A 1KO8A 1CR4A 1GKYA 2QRNA 4FI3C 4D4LA 2VO1A 3HU3A 4B43A 3FYHA 1XTRA 4JVSB 5J40A 2ZRAA 1TF2A 2GK6A 4QJ4A 3LW8A 5EUQB 5G53C 2OG2A 2O0KA 1A2KC 5IDVA 4ZDIA 2GXUA 1SVKA 2ZIAA 1NP6A 1JECA 2FZ4A 2ZJ8A 4N0DA 4DSNA 5GJVC 2O8DA 1W47A 2C04A 3M1IA 5J47A 1FFHA 1NG9A 3DM9B 2KI5A 1QDEA 4KI0A 2RHMA 2ZJ2A 1AK2A 1WF3A 4LI0A 4PX9A 4DCVA 1XD9A 1BIFA 1UJ2A 3KKNA 3B60A 3IIJA 1AKYA 5FL3A 3EX7C 4HB4A 4LYAA 2CLDX 2QE7A 3H4MA 5HKKA 3FWYA 4NCNA 2KBFA 4LPKA 2RGEA 3MUFA 1OHHA 4WXPA 4HLDA 4DBLC 2OBLA 2OCPA 5AK0A 5J5CA 2D3WA 1ZNZA 4B48A 2FF7A 1RFLA 2WMOB 4Q7MB 1R8SA 3AKCA 3OIUA 2NZJA 2PMKA 3VR6A 1RYFA 4MRPA 1G7RA 1JAIA 2CE2X 4JS0A 3O8RA 2CHVA 2JASA 4AK9A 1GRNA 2ZR7A 4X8OA 4PSKA 1W46A 1LB1B 2PMDA 5FL7A 1N6OA 1CR2A 3ECCA 4IRUB 1OFHA 4W5JA 2FX3A 1YR6A 1NVVR 3RABA 1U2RA 3NKVA 1Q20A 3UK6A 4CW7A 5FUVA 5FUXA 4UNNA 1NL3A 4NMMA 1FNNA 1KSHA 4E07A 3LQQA 3W5JA 2JATA 2WICA 4JBWA 4KODA 3RDPA 5GJCA 3WHKA 2RKOA 1P2TA 5FUWA 2ZXUA 1NVWQ 3K9NA 2AHOA 5DNYB 1UPTA 1J8YF 4JJZA 4LJ8A 2YV5A 3W6NA 1DG3A 2J9RA 1TF5A 3FFAA 1VYVA 4CEIA 1VG1A 1G8GA 2D7DA 1FP6A 4QOSA 1M6NA 2R6AA 2WHXA 3BORA 4Q7KA 1WCV1 3FE2A 1DAKA 1JR3E 3AGQA 1J70A 4HATA 4QGHA 4ZIRA 1OB2A 1XEWY 1AS2A 4EPTA 2XNSA 3GP8A 4BASA 2AWOA 1GAJA 1R0WA 4OQLA 1OV4A 5DGXA 1JNYA 1W4BA 1RPZA 2WMNB 2XZLA 2QBYB 4Y0AA 4RZ2A 1E0KA 3THYA 4HAZA 1YRAA 3VX3A 5GADl 4MGYR 3KB2A 4XSGA 5IHPA 1IN6A 3K53A 4L4UA 4JLBA 4IXMA 4MRVA 4E09A 2GNOA 3QKTA 1OXXK 3CO5A 2J5XA 2QMUA 1KY2A 1ZUNB 2XSZA 3QPWA 3VR2A 1ZNWA 1GITA 5AR1A 4BFVA 1RC8A 1EX7A 1YJ5A 2VEDA 4Q66C 2ZI3A 2AK3A 3WP1B 1U0HC 3K8YA 3MCAA 2C2HA 3U7FB 4OKSA 1WMSA 2X2FA 3A37A 3RS0A 2W83A 1U8AA 3K70C 2JLUA 1E1QD 2OFXA 4GBMA 2W00A 1UF9A 3SZRA 1NKTA 1NNEA 1T3HA 4HSEA 4YXWD 2WKPA 3GEEA 4UNSA 4BRUA 1AZSC 3UMFA 1XD2A 1S2MA 3MD0A 3KZ1E 4URXR 4OJQA 3KQLA 1SZPA 1E94E 3PFIA 4GT1A 2XTZA 3PQCA 1GM5A 1HE1C 4GSYA 1CU1A 4L9SA 4NCHA 5HR5A 4Q1BA 3KKMA 3UMSA 4F92B 1GL7A 3FMOB 1ZM9A 2CMKA 2PCLA 4RZUA 5AUNB 3KB1A 2GHIA 3AB3A 4RZ3A 3DMDA 4DLYA 1Q22A 4IVQA 1K6MA 4A4DA 3KQNA 2BBTA 4YQFA 2P6RA 2B21A 4DLXA 4IDNA 3I92A 4CDGA 1JAHA 1PV4A 3ZYCA 1OE0A 2QP3A 4RZXA 4C0KA 2W6JA 5JEEA 1KI1A 3GLFE 2V7QD 2GAAA 2X2EA 1B0UA 3RRMA 2EYQA 2IYUA 4HAWA 1S1MA 1EFUA 3K9GA 2XNDD 3NH6A 4DRZA 4F4IA 2Z5FA 4LHZA 1GKIA 1M2OB 1SXJA 2QENA 4DSUA 4IJMA 2ASEA 5SZKB 1VG0B 1FP7A 2ZRBA 4TL9A 2QNRA 2NO6A 3CNOA 1OLOA 1XU4A 4DEYA 3U5ZB 5E95A 2GCPA 1Y3AA 3U44B 2WAYA 4QNRA 1E0AA 1TX4B 3IIMA 4GZMA 1XFAA 2E9SA 2ZU6A 2OBNA 3WHLA 1YVDA 1TEVA 3PEWA 4A2PA 1U0JA 1L2TA 4ITRC 4OYHA 1OXVA 2AK2A 2KSQA 4OHZA 1NVXQ 3CPJB 1BMFA 1PLJA 2BM1A 4U7DA 1FOEB 2OE2A 2X1VA 1LS1A 4H9GA 4EDHA 3KKQA 4Q9HA 1G7SA 2QROA 5G41A 1E2NA 1LNZA 4D0GA 2DY1A 5CIWA 3REGA 5FPSA 1GFIA 1RRGA 3WXMA 3CRVA 3FVQA 5J4KA 2IUUA 2AWNA 2ZYVX 1T8TA 1Y63A 1DADA 3EPJA 4FMDB 3CF6R 4MRSA 4US0R 2QTVB 1G5TA 4JL8A 4YLGA 4OI1A 4O3MA 2XGJA 4HZIA 2ODEA 1ESNA 4JLNA 1XMVA 4M1OA 3WRXC 1F3OA 3VNVA 2REBA 2H92A 1KI4A 4S35A 1OIXA 4RD0A 5FTMA 2Q6TA 3B2EA 1E98A 3E5HA 1A4RA 2W6JD 2I4IA 1SKYB 3LA6A 4CT5A 5JLJA 2GCNA 3TGPA 1KI2A 5JFGA 1FX0B 2V1XA 2D7CA 2ZRLA 4AYTA 4Q4HB 4B3CA 5BYKA 2VHQA 4EJSB 4G0NA 4BFYA 1ANKA 2XX3A 4FMBB 2VP0A 4MUBA 2P0EA 2ZE8A 1T91A 2BC9A 3BB3A 1VDZA 1DO0A 2IW3A 1G19A 3PUXA 4LYHA 1C1YA 4A0GA 1Z6GA 3PV0A 1LF5A 1TL7C 2OSBA 5G3YA 2YZ2A 3BJIC 3TSZA 2CHGA 5CLQA 5FI0B 1OIVA 1EG7A 1QHIA 4FN5A 2V8OA 2P5TB 1W7AA 3AVVA 1F2UB 2YJTD 2BMFA 1S1CA 1NLZA 1Z6AA 1B23P 2F43A 1HYQA 5CDFA 4GP7A 1UFQA 2BEKA 4F7WA 1MABB 4CF7A 1Z22A 2XTNA 3LXRA 4ON9A 4C0BA 3D6TB 1KKMA 4CEJB 2NPIA 1HQCA 4YMVA 1NJFA 2WAXA 1Z0JA 3CH5A 4DIEA 3KQUA 1WXQA 2BBWA 2OCBA 2PJZA 4QJ3A 3U4QA 4HAYA 2RGGA 2J59A 1RJ9A 3ZJYA 2NO7A 3V4FA 3WYGA 1N5JA 3C4JA 1UEIA 221PA 2QTFA 3AEZA 3BS4A 4IKEA 1LTQA 4CEHA 1FQKA 1N6KA 2I1QA 4LUCA 2CNWA 4A2WA 3VR4A 4F4JA 5J4YA 3I5YA 4AKGA 2IEZA 1XXHA 3EIEA 3SJBA 2R6DA 2VP6A 3A58B 1VHTA 1PVOA 4EFMA 1R6BX 3K0EA 3WYAA 1JBKA 1AKEA 4EJSC 4HLUA 3LBNA 1GKUB 3WRYC 4UNQA 3WNCA 4JJKA 1N6RA 5DLQC 4TTQA 3TE6A 1TUEA 3FKSA 1A7JA 4NKRA 5JSZB 1OIWA 4KVGA 1DAMA 3QVVA 3KKPA 3PG5A 1P62B 1XRJA 3WY9A 2ZU0C 1NMYA 1LFDB 2UZ3A 4HI0E 2TMKA 4G3XA 1RZ3A 5AJZA 1R2QA 1VECA 2FEOA 1F60A 2W2TA 2UKDA 3TAUA 2VHJA 2YKGA 5HZKA 1YZQA 2VHUA 3BWDD 4D4MA 4DT1A 1NBMD 1H8ED 2O8BA 1KIMA 2WTUA 3CIOA 3NXSA 4QC2A 4E03A 2RGNA 4Z8YA 2BWJA 5AUOB 2IX3A 2J0UB 3L82B 3BFKA 3NC0C 2IF0A 2A7QA 4EIWA 2BDTA 3AF3A 4QG7A 5GVRA 3NBZC 4NCIA 4D4JA 4LCBA 4GFDA 2A5DA 2IS2A 4JT4A 2W2XA 1CKEA 2ZI5A 1E99A 2IEYA 2R65A 3C5HA 4Q1DA 1TADA 4NTZA 2XEXA 5FOVA 4UXJA 4Q9IA 2C03A 3VTKA 5IK2A 1E2JA 3SYNA 2RH5A 3X1YA 1A5TA 3LBIA 1X3SA 4C0LA 4D6PA 3R7WB 1OYYA 3OESA 3ASYA 2CLSA 3FMPB 1MRSA 4NPHA 4DEXA 4HLQB 1ZUIA 5HE8A 2ZYTX 4LSGA 2JJ1D 1T5IA 2EW1A 721PA 1DAGA 3FPAA 4ZV4A 3AH8A 4FWTA 3B1XA 2FNAA 2GAOA 3AGPA 3B82A 4PAOA 4ACBA 5KSOA 2RCNA 3IUYA 3EIHA 4OQMA 2C96A 1X1SA 2MMCA 3RC8A 2FFAA 2ZE6A 4XH9B 4B2PA 3MWJA 4OI2A 2K5UA 3BOSA 3LFUA 4QHTA 1Z6XA 5E4FA 3VMFA 1FX0A 1UAAA 2P3SA 2J0QA 2WJGA 4PC3A 1U9IC 3BH6A 3K09C 3R9IA 5HPYB 2FFBA 1ZD1A 1JALA 1QHSA 3A1UA 4UJ5A 4FD2A 4CEIB 3QBTA 1WBDA 5FTNA 3RRZA 3L2OB 3QKRA 1G4UR 3UWOA 4KBFA 1T0HB 5G3ZA 1II0A 1T8UA 1TU4A 5KSPA 3PR1A 4NYMQ 4LZZA 2NPFA 2ZS9A 1Z29A 3HPRA 3R8FA 2I3BA 3K9LA 1X8JA 3LV8A 1XNJA 2CL7X 4TZ0A 3GLGB 3EASA 3NH9A 1XZQA 2QORA 3DHWC 4LJ4A 4PR0A 4M9XA 2ZJ5A 4US1R 4A9AA 1DS6A 2JA1A 3K0CC 1R5NA 3A4NA 5JWRA 1GVNB 2N42A 4TYPA 2FPKA 1KKLA 1XB2A 1BO6A 2NOAA 3H2YA 5EZ5A 2QE7D 2J7PA 2MSCB 3GLGE 4NYIR 1RJ9B 4S2EA 2W0SA 4KU4A 3RSLA 1KK1A 1IN4A 1S3SA 1D9ZA 1P3JA 2BCGY 2ZSAA 2G3YA 4FWIB 1Z2AA 3PXGA 4QM6A 1COWD 3U60B 3LDAA 2KJQA 2OCAA 1KZ7B 3M6AA 5C1BA 4TMZA 1SQ5A 1BOFA 3T06B 4LJ9A 1ZMXA 2OBMA 1RRCA 4D82A 3FHTA 3L0OA 2XXAB 3U3RA 3CWZA 3LWNA 1HURA 1UADA 3MJRA 1W2GA 4IVRA 4A0HA 1E9FA 3PIRA 1SVOA 1OKKD 2WOJA 3RS3A 4Z54A 4XSHA 5EUMA 5H8WA 5F9FA 2CHQA 3GJ3A 3NVAA 3C15C 1ZRHA 4G5RA 4KFTA 2ZRKA 2GF9A 2VPPA 5BN5A 2C8VA 2IYYA 4KBGA 5FH9A 3A4LA 3OFND 4XD7D 1IN5A 1VMAA 2WVJA 2ZSDA 3F8TA 3IEUA 1E32A 5CYOA 5K8TA 2RAPA 3IHLA 2VYFA 3P32A 1CULC 2PT7A 3AKDA 3M0EA 1UBFA 4ILEA 1G21E 2XOKD 4U5XA 4BFUA 4K81B 1IXRC 1XD8A 4PZZA 1SKYE 1DTSA 4LWZA 4PZYA 3DEFA 4LHWA 2H5EA 4AIIA 2WM9B 3U3KA 2FGJA 1E2GA 4K46A 4US2R 2ZRNA 4G5SA 4JSTA 5DYIA 1TEXA 1XTIA 2GVDC 3QUSA 4JZKA 3ZIAD 4HB2A 5DYGA 3IBYA 3BH7A 2R62A 2D62A 2F1IA 1XXHB 1E0JA 2OZEA 2ZQ5A 2WKQA 3THXA 1T0JB 3B1WA 4QGGA 4L8GA 3VU9A 2LCFA 1II8A 2ZVQX 4RKEA 1W1WA 2ZYWX 1WA5A 4A36A 4M9ZA 4EPWA 4P3YA 4B76A 4PC1A 2EFGA 4EPYA 1EFCA 2FSIA 4A15A 2WJYA 3KTAB 1F6BA 4C4PA 4EFLA 4YMTA 4ZKDA 1G5RA 1YZNA 4DB2A 3QVUA 1RW4A 1W2HA 2GEUA 2NTYC 4HEJA 1E9EA 2XOKA 4ZCIA 4W7SA 1P4SA 4C2TA 2EWWA 2QG6A 2V6IA 3U7GA 4DDUA 5EE9A 2A78A 2PCJA 3ZDQA 4L5BA 1UKYA 3KXLA 5DO9A 2IXGA 5TXGA 1Q1EA 2OFWA 3GJ8A 4IOMA 2FV8A 2VP5A 3CZQA 1KO7A 1IONA 4Q02A 4DZZA 2VL7A 4A8JC 2V3CC 4TYYA 1TNDA 2ZS8A 2GTPA 3HJNA 3CPHA 1I2DA 1P61B 3DVLA 4I4LA 4LDJA 4M9SA 2EYUA 1E2EA 1ZINA 2GJ9A 3VKWA 2ERYA 3QXCA 4EUNA 2O8EB 4D80A 3DL0A 4V0ME 1R0XA 1VPLA 5KOYA 3SOPA 5HCIA 2JJ8A 2DB3A 1NJGA 2ZI4A 4XTRA 4BRWA 2Q9BA 4PSAA 4OI0A 3EPHA 3W8RA 3GLHA 4A82A 2ZANA 2C9YA 4Q00A 3MGCA 1BS1A 5GVSA 4WZBE 2WWYA 1N5IA 2DWOA 3THYB 1FUKA 3GJ7A 3TH5A 2ZR0A 5GJWC 3PENA 5LB4A 4GI7A 4BUJA 2HF9A 4MRNA 1GZSA 2WWXA 2J0SA 2FSHA 3FTQA 3AM1A 2WV9A 1EWRA 2V54A 3MWKA 3ND8A 5CJPA 3CF0A 5BN3A 1WBBA 2XZPA 1SKQA 3QQ5A 3MJHA 3U2QA 4B3DA 5IF9A 2IS1A 3BRWD 4D26A 2Y8EA 4PPFA 2PLFA 3ETLA 2HJGA 3BXZA 3K0FA 4P4SA 4Z1MA 1W0JD 2CK3D 2JIZA 2ZUDA 3AP1A 3GFTA 1JEDA 3GJ5A 3FMIA 5FBRB 3O8CA 2HXSA 5HKKD 3IIKA 2VIIA 4NCJA 3IEVA 4D25A 2VHCA 3C8UA 3EZ2A 2HT1A 1JQJC 4DIDA 1LY1A 3A8TA 4YMSA 1XCGB 3K0AB 1N6PA 3IQXA 3ZZTA 2F7SA 3WNBA 3OHMA 1KI6B 1O3YA 1H65A 1MH1A 1XF9A 2ZUBA 4DLVA 1T6NA 1AN0A 1RRPA 3PUZA 4TMVA 2QPTA 3VR3A 1KDRA 3NBFA 3IHWA 2D4HA 1U8ZA 3KQKA 2FDCA 2HUPA 1IBRA 2O0JA 1AS3A 4X8HA 1CR0A 3UG7A 5TMPA 4CEHB 5LD2B 1IAQA 4LC1A 3W34A 2HYIC 1HV8A 3CNLA 2VHTA 2GXQA 3IGFA 2FSGA 3LW7A 1I4TD 2CXXA 3T1QA 5EE3A 1XP8A 1DE0A 2P5SA 3OIWA 4NH0A 1SHZA 3SNHA 3GLFA 3RWMB 1X6VA 3UWKA 5L3QA 1J8MF 3BBPA 1GDDA 1IN7A 1ZM2A 3IBGA 2WPDA 3F5FA 3AUXA 4PAQA 2FEMA 1I2MA 2R2AA 3T35A 4HDOB 4AI6A 2ZVPX 3EZ7A 3SFZA 2H7VA 3CRQA 3TW4A 1SXJE 1IQPA 3NG1A 2XTMA 2ZJBA 2D74A 4W5WA 4LJ5A 4OQNA 4URUR 2R6FA 4LHVA 1E2IA 4LHYA 2AFIE 2ANCA 2AN9A 2P2LA 1DEKA 4KV9A 3UPUA 1UBCA 4TMXA 2XAUA 2QQ0A 2ZI7A 5E7JA 2XJ9A 1FNMA 3D31A 2J87A 1U8YA 1FL9A 4UNRA 621PA 4TL6A 1UBGA 4RD1A 2JLYA 5HTKA 3SFVA 3D7MA 1Z6YA 2FA9A 3Q7QA 4AD8A 1GG2A 3AKEA 1AGPA 4LK2A 5A5GA 2OCYC 1NLYA 1VCNA 5B58C 1AJEA 4C0SA 5CITA 3LRPA 1IM2A 2C9CA 3X1WA 1XJCA 4MYCA 3GLIE 3SU8A 2IYXA 4HAUA 1E1RA 3WBJA 1N6HA 2VTKA 4MKIA 3WNDA 4AURA 2BKEA 4IVPA 5JWOA 3FHOA 3FFBA 2VRWA 4E22A 1U98A 3GLFB 4JLJA 3EPKA 4FCWA 4K8OA 3HR7A 4MKHA 1G3QA 2B7CA 2V4ZA 5JEDA 1KYIA 2YNMA 2B6HA 3HP1A 1TF7A 1NN5A 2ZITA 4TLAA 2LKCA 3P20A 1XD2B 3LX5A 4CEJA 1H8HA 1MO3A 5M04A 3TSOA 4M1YA 4FIDA 1XTQA 4P31A 1X8LA 4M1SA 3THWB 3SC3A 2GCOA 3GMTA 2IC5A 521PA 3Q9LA 4WXRA 1COWA 2DPXA 4IDPA 4R7ZA 3VAAA 2QZ4A 3LBHA 4PHHA 1L7VC 1KZGB 1VYUA 2WOOA 4LV5B 2Q0HA 2YOHA 4EAQA 1J2JA 3N5CA 4PPQA 3TNFA 1G3IA 4KO8A 1JXMA 2W6IA 3F0TA 4EJSA 1D6JA 4ZO4A 3CWQA 1MV5A 2CCJA 4B3GA 1L4UA 3FHCB 3IQWA 1NY6A 1R4AA 2IS4A 1G8PA 4URVR 5B64A 3K0FB 2GWHA 4GOJA 4TN1A 4V0NA 5EP4A 3OF5A 4LV8B 4ABYA 2NO9A 2QAGC 3NHAA 1JR6A 4ASUD 3P4YA 3PITA 2QA5A 3FB4A 1TQDA 3DDCA 5EQTA 3U7EB 2BVNA 1S3GA 2ZAMA 3ONWA 1EFRD 3OE7A 3NBYC 2RGXA 4TMTA 1VKJA 1Z0KA 3IO3A 3QEJA 3DZ8A 2OT3B 2JLQA 2YINC 5A0FA 1CJVC 3QXHA 4Z51A 5B30A 3P26A 2JLWA 2GKSA 3T5DA 1G8FA 2NGRA 5C46F 4OJKA 2J0UA 5TB5A 5CB6A 1C9KA 1SXJD 2BKUA 3LX8A 4PANA 4ARZA 1UM8A 1E1QA 2W6ID 4MGZR 4BZPA 2EFHB 4BFTA 2V6JA 3D3QA 2BM0A 3PJRA 5DI3A 2G83A 4D2IA 5F98A 1HTWA 2OO7A 1YZKA 3SYLA 4HYYA 5D3QA 3GLHB 2FJUA 2WSSD 2G0TA 5KSYA 5C18A 5LDDC 3U4QB 4B71A 1SVIA 5AJVB 1P5ZB 3SBEA 3K9HA 1MRNA 2WWIA 4A1FA 1GP2A 2GDJA 2CL0X 2J7PD 1R5OA 2HJVA 1JJ7A 1QHNA 2V7QA 2O8EA 4GMXA 3CR7A 3FDIA 5EP3A 2RHDA 2JDID 4QFMA 1W5TA 1R8QA 4RSGA 4MKFA 1KGDA 2IL1A 2IA5A 5D3MB 1K8RA 1XCPA 3TQFA 4KHZA 4BFXA 1IJFA 2ZRCA 4Q03A 1QZXA 2ZE7A 4YC7A 5SZHB 1HY3A 3OAAD 1CJMA 2ERXA 4ESHA 5FTLA 5FOWA 2G0NA 2JLZA 2BMDA 3BIFA 2R44A 3ZVMA 2QAGA 3KXIA 2WBLC 1FMLA 2JCSA 5H70A 4NCKA 1Z08A 3U3OA 1N0WA 2BV3A 3KKOA 4RVCA 1ONBA 4GL2A 1RIFA 4NYJQ 1W48A 4XVRA 5FPHA 1KI6A 3AF0A 3EXAA 3QE0A 1LF0A 4Q5IA 1XTKA 4KLZA 3PUWA 5FBLB 4N1AA 3HWSA 3EA0A 3PVSA 4HLCA 3KJGA 2ODWA 4B2IA 5EP2A 4GNKA 1FQJA 4XWAA 2Z0MA 3SDZA 2NMVA 3UXMA 3SHWA 3V9PA 1KNXA 1D2NA 1SHKA 3MAAC 4M2LA 1YZLA 2GA8A 2VQSA 2XSZD 4FMCB 3RC3A 5C4MA 4TQUS 5FOTA 3Q7PA 1NSFA 3EZ6A 3GEHA 2C99A 5DH9A 2ZRJA 1E2KA 5L8VA 1KMHA 1Z28A 4MYHA 4Q01A 5KYKA 1FUUA 3BGWA 4DDVA 1KDOA 2PLRA 2XJ4A 1S8FA 2QMEA 2J0VA 2ZTSA 1YU9A 4WVFA 1W44A 1VCMA 3GEIA 2J46A 1OFUX 4R9UC 3R9WA 5KNCA 3K0SA 4BLSA 2WWFA 3H86A 2GBLA 3QI2A 5DHAA 2WJJA 2QTHA 3DMNA 4MUAA 2F43B 2ZRFA 1ZVQA 3GJXC 4OHYA 3R7WA 1SULA 4IDQA 2CJWA 4Q4LA 3TUIC 5L3SA 3T12A 3I4LA 3C14C 2HLDD 4ZDKA 1GNPA 4RJLA 3L0PA 3VQTA 3TW8B 1Q1ZA 2L0XA 4QNMA 3U44A 4OK3A 2ANBA 3ADKA 3IILA 1R0ZA 2CEAA 2BMEA 1Z0IA 1J90A 2ZI9A 1U99A 5UKDA 2G1KA 3W6OA 1ZD8A 1GOTA 1XEWX 4TYWA 2HYDA 2HDNB 8OHMA 1T3SA 2CK3A 1NG1A 1P9NA 1N0UA 5AJWA 5BN4A 2R9VA 4M53A 3GJ4A 1CF4A 1JJVA 3RLFA 1ZU5A 3SQXA 4FMCF 1DOAA 4BZXA 3QKRB 2BBOA 4OI4A 2DWQA 4B47A 2ATVA 2WJHA 4ESVA 1QHXA 2XITA 1W0JA 2JIZD 2Z43A 3R20A 4GPTA 1OXUA 1TUIA 4JL6A 1X8KA 3P4XA 4R71A 2DFNA 4DCSA 1Q3HA 1P2SA 4A0FA 1R0YA 4B3XA 4OHWA 4OQXA 3U3JA 4ACAA 4RD4A 3NEYA 4WZAE 1DELA 2OAQ1 4Q9KA 1OXSC 2BBSA 5TY0A 4Q4JB 2YYZA 4TLCA 4TT3D 5TV2A 2FGKA 2HXYA 4ZDWA 1JI0A 1G41A 1KK2A 1XTSA 1NKSA 1P9RA 3ZQJA 2G88A 3TQCA 4LC0A 2DHRA 5KPDA 3K70B 3L43A 1IY0A 3TR5A 4TLEA 3QF4A 1JQLB 2VBCA 2FU5C 4Q9LA 3DO6A 3QKSB 2CL6X 4B44A 2OLKA 2F6RA 4PQFA 4RY2A 3KUDA 2C78A 3Q85A 1VG9B 4C0HA 4MDFA 4QRHA 2PZEA 3U6BA 1W4CA 2JLSA 3ASZA 2Q3FA 3GFOA 5HCNA 1XEXA 1P75A 3D8BA 3RAPR 4HDCA 2GJSA 5FI1B 3OFNA 2P67A 1ELOA 4AWXA 1E2LA 4AYWA 4HUQA 2ZUCA 3QOFA 4GOXA 1KDTA 2HEIA 1YR7A 4PFSA 3NEJA 3QSYA 2WIBA 1JR3D 1S96A 3KX2A 2B7BA 5E3HA 3GPLA 4Z8XA 2FFQA 2E1RA 3EZ9A 4KSBA 4LBVA 4OL0A 4B6FA 4FMDF 4ZCMA 3LVRE 2GILA 1A82A 1MO5A 1UKEA 4Q4AA 3SBDA 4U00A 1CJKC 1II8B 1PJRA 4TTRA 1G16A 4YONB 4HZUA 3H0KA 1OH5A 2RGCA 1J7KA 4TYQA 3QNUA 4R2HA 2IYLD 1F2TA 1NF3A 2D2EA 2C5LA 3T34A 4XWOA 3C16C 2Z4SA 3ZZUA 2J41A 2GRJA 4NU0A 1DAEA 2FOLA 5KDLA 2N1BA 2G77B 3A1SA 2ZREA 3K0AA 5L3VA 2WZQA 3H84A 1Z6TA 1GWNA 3N2IA 1E79D 1W0KA 2IYWA 2FWRA 2WPDD 2YC2C 4IOJA 1ZIPA 2ZJZA 2XZOA 3AVWA 1NMZA 2GJKA 4L16A 5EZ6B 4ZDJA 4A2QA 3BFVA 2JLVA 2OM2A 5K8IA 1BMFD 3TBKA 1DAIA 1QF9A 4A8JA 4POAA 3CNNA 4C30A 2GVZC 3W8NA 4TLBA 1XMJA 4DXAA 4PXAA 3EPLA 2QI9C 1RYHA 3NIBA 2GBLC 4IHQA 5HZHA 1CJUC 2J1LA 3NHBA 4IOLA 5CIQA 3GCGA 4EPVA 3EC1A 3I5XA 2IHYA 2O8FA 3QG5A 3X2SA 1IN8A 2ATXA 4DVGA 1P7CA 5E7IA 1V5WA 3HDTA 2D06A 1M7GA 2ZRGA 1XWIA 3BFXA 4G5QA 4N3NA 4NP6A 4RCYA 1S9HA 1FTNA 1X86B 2ORWA 3EC2A 3LVQE 3ZD6A 2A30A 3OEEA 2DR3A 5AUQA 1IHUA 1OH6A 1N2CE 4BLQA 1OYWA 1ZUHA 3KJHA 1G6HA 1GNQA 3WMGA 2J45A 1KSGA 1Z5ZA 4C7OA 3LLMA 3W6PA 4PTLA 1E9SA 3QJYA 5JHHB 2DYKA 4FCVA 4KFRA 3ZVRA 1Z63A 4G1UC 5EJEA 4PO8A 3ZGXA 4GMDA 4HUTA 3E2IA 5LB2A 2WIAA 2EFDB 4JLMA 3AVUA 3GQBA 3V4RA 2DFKB 4KYIB 1PUJA 4YDHB 1OH7A 1ZCAA 3KJEA 1XJQA 2H57A 1W36D 1OB5A 1KY3A 3DOEA 3CRMA 5DI3B 4DHEA 2QPOA 1NI3A 2IYSA 4JKYA 2GESA 4TTPA 2DWPA 3B1ZA 4IEEA 821PA 5L3SB 3KFXA 1E0SA 4BLTA 4PPGA 2I1VB 3DKVA 1WP9A 1LW7A 3B7GA 4AKHA 3DOFA 1UDXA 1NN0A 4CZ2A 1AZTA 1MT0A 2OFOA 2WSMA 3GLGA 1M7HA 3EARA 2G1JA 1RE0A 2OEPA 2R6GA 1CTQA 4V02A 5JS8A 2O52A 5EXXA 1G7TA 4DC9A 4ZCLA 2PZFA 4BLOA 2O8CB 3LLUA 2DFLA 3N70A 4RD2A 2DCUA 1QBKC 3N2EA 4H1UA 4XWKA 1OF1A 1MOZA 1TQ6A 5B57C 2A5GA 4YXWA 3G0HA 1G8HA 3AUYA 4V0LA 4DLWA 1A2BA 1CJTC 4LBZA 3IPXA 121PA 4MQBA 4W9MC 5FFMA 2ZROA 2A5YB 4LBWA 3BH0A 5BXQC 5DN6D 4DUGA 1NN1A 3ZVLA 1SVMA 4ZPXA 3C41J 1QG4A 3OAAA 2ZJAA 5FPTA 2IYZA 1OFIA 1ZM3A 4WA7A 5JRJA 1GTVA 4MDEA 4P0TA 2F1HA 4PQRA 4Q1CA 5FL7D 2GJAA 4I1OA 2RGDA 1IY1A 1GRQA 3CBQA 4CGZA 5G40A 1Z06A 2A2ZA 2BJVA 3UG6A 3IKJA 3NC1C 3AVXA 1E9DA 1WDTA 3FKQA 2JJ1A 3OIVA 1E6CA 1XCMA 4BLRA 4BEBA 2MSDB 5JMTA 1JPJA 2GXSA 1P2UA 4A92A 2KBEA 2ZETA 3A4MA 3SEAA 2C95A 421PA 2H18A 2ODBA 1G9XA 4LX0A 4CRWB 5IRCD 2V1UA 5DN6A 1C4OA 1U90A 1VCOA 1E2QA 3NWJA 4IFBA 4UXHA 4DJTA 1E2FA 3SYKA 4QBFA 2CE7A 2BHRA 4LV6A 1JXOA 1BH2A 2WSSA 4TMWA 5EP1A 4IEIA 5JCPA 5JCZA 1U81A 5CDFE 3MRSA 1QHGA 4JLDA 2QAJA 3J81k 2RGAA 2QGNA 5EXTA 5LBIA 3TUJC 2ZSEA 3THXB 2QT1A 2P65A 3RS5A 4M0LA 4QBHA 3K09A 1U9IA 1IXSB 1NBMA 3JVUA 3MMPA 3GJ0A 2O8FB 4PQYA 4W5HA 2DBYA 4BEJA 2OLJA 3H1TA 3LO5A 3CPEA 5KUTA 3CB4A 2LWIA 3W9YA 2CDNA 1VCIA 2Z4RA 3I72A 3DKPA 2F9LA 3KJIA 4QGFA 3VKGA 2HCJB 1JEEA 1NVVQ 4AG5A 1CIPA 2O8BB 3FKSD 2YVUA 2J7KA 4HB0A 1AQUA 1KO4A 1ESMA 3CX6A 1N25A 4HAVA 1Q3TA 5JBQA 4GZLA 1HE8B 2F1JA 1XTJA 2IWHA 4C3ZA 5GJBA 4Q21A 3AVQA 3TSWA 2GZHA 4MGKR 2QGZA 1R10A 3NDBB 1N5KA 5FOUA 5JWHA 2VP4A 3CF2A 5P21A 2QRZA 5ANRB 1JPNA 1P6XA 1SXJC 2ZI6A 3TVDA 4M22A 4A0RA 2XB4A 3A1VA 3VFDA 4OK6A 4NDZA 5KTYA 2EFCB 2YOFA 1SVWA 2AXPA 3E70C 4URWR 2YWGA 4B6EA 2GJ8A 3KL4A 4JIMA 4M1KA 2AD5A 2ORIA 4MH0R 5KDOA 3GFPA 2GF0A 4FINA 5EE1A 4QJ5A 5DHFA 4DCUA 1S4QA 2ZR9A 1VYTA 3CH4B 4LGMA 4DLUA 2GK7A 4Q4AB 4F38A 3CM0A 2KWIA 3TUZC 2W58A 2IHBA 1Q21A 5JZVA 5FTKA 2IYVA 2UZIR 2VP9A 1QHHB 1M1YE 1E2MA 1F2UA 2AXNA 2AX4A 1JR3A 4XOIA 3X1ZA 2ZM5A 1EFTA 1ETUA 1MO4A 3AVOA 1P2VA 3F3YA 3W3AA 3S1AA 4MRRA 1EXMA 4GP6A 1DO2A 1M8PA 3QXSA 2IWRA 5J4LA 4LJAA 3RHFA 2H17A 4CT4B 1DAHA 3VX4A 1ZW6A 5EXSA 3WP0A 4JLVA 4G01B 4P4SB 4WZ6A 3TR0A 3PEYA 2AKAB 2ZAOA 1WE2A 1NN3A 1LS6A 3CUEF 4HLUC 1E4VA 2JEOA 3HPQA 4E5UA 3EZFA 1D9XA 1XX6A 5C4GB 4RD6A 1M7BA 1CBUA 3QY0A 2FMXA 5BW8A 1AS0A 2WKRA 1KOFA 1II9A 2B8TA 3QKSA 4FCTA 2GETA 4DB4A 3BE4A 4LOAA 3CW2A 4ARZB 3AKYA 3Q5DA 4LJ6A 3PEUA 2QT0A 1TMKA 1S0UA 2Q9CA 4XTCS 4JLPA 1RVDA 4Q4JA 3RS7A 1ZYUA 2P6NA 1Z0FA 3GD7A 4PSVA 3RRYA 1US8A 1XMSA 2QM8A 3EWAA 1QRAA 3CRW1 3KTAA 3PCRB 3L0SA 1YR8A 5KSZA 2OILA 3CX8A 1OW3B 3U61B 5JSZA 1DPFA 4PC2A 4KSCA 2IF2A 3A1WA 2WWGA 4J0QA 1M74A 5FPKA 1GUAA 5JI3E 4M4SA 3VHLB 2KE5A 4A6PA 5FOSA 1CEEA 3B5JA 3LD9A 1E9AA 2VSXA 4B34A 3BB1A 1ZBDA 2FG5A 3QIAA 2OAP1 1WRBA 2CBZA 3VR1A 4LPSA 3G5UA 4L15A 4DUGD 5JHGB 4OK5A 4P32A 5H68A 4JVNA 3HU2A 1DAFA 1VIAA 1QG2A 4NYMR 1VG8A 4JBXA 3O47A 1UKZA 5CM8B 4NBSA 5L3QB 2Q21A 1SXJB 2AL7A 1XMIA 1Q1BA 4KFUA 4TWZA 2BIFA 2GEDA 4DDWA 1GILA 3TVTA 2VF7A 4JVMA 3PUVA 3QF7A 1ZD9A 5K8UA 1N6IA 3ND9A 1KSJA 1H8EA 1KAOA 1ODFA 3U7HB 3Q5EA 4DSTA 3L0IB 1VTKA 2MSEB 2C9OA 1T5LA 4MKGA 4CVNA 2ZJOA 3QPVA 2HF8A 2O8DB 2IBMA 4ERNA 3TAHA 1G1MA 3UIEA 5KHOC 2NZ8A 3VKHA 4P4TA 1EGAA 2QPAA 4XIGS 5DIFA 1KMQA 1V43A 4KAXA 2PEZA 5F9HA 2F3TA 3MWYW 4YDSA 3EW9A 4D4KA 3GLIA 4XJXA 3I32A 3W5IA 4Z1MD 3QENA 4M1WA 5FBQB 5DI9A 2Q9AA 1G3MA 4LYJA 4XVUA 4GRAA 1P73A 1RRFA 1YKSA 3T61A 1FTSA 1Z0AA 2LKDA 1EFHA 2QP9X 3U3MA 3T1TA 1Z8FA 2OV2A 1G291 1W4RA 4RFSB 5JJKA 4TLDA 1YRBA 3I8SA 1UDWA 4URYR 3B9QA 4LY6A 5LD2C 1D2MA 2BEJA 2VLIA 2QSZA 1GSIA 2YWFA 2EFEB 4FXPA 1BYUA 1M34E 2ZS7A 2CVHA 3EWSA 3WMEA 4O0MA 2V55B 4TQ9A 2QL6A 4DSOA 3ADDA 4TQAA 5LPNA 1G5PA 4RD3A 4GDFA 2VH5R 2REXB 4PHFA 5JRZA 3BB4A 4II7A 2IYTA 3KFVA 5TDHA 3VR5A 2BCJQ 1W4AA 4M1MA 4IW3B 3LY5A 4LYFA 4B3FX 1CS4C 4KFSA 1ZJ6A 2JGNA 1A1VA 4QKQA 2O0HA 5CK5A 5FBVB 4LHXA 4LBYA 5A4JA 4DCTA 3EAQA 4B32A 2F55A 2XXAA 3EA5A 4U02A 3ICQB 2IUSA 3O8DA 1YZUA 2Q3MA 3U6KA 4MA4A 1E2PA 1G6OA 2FFHA 2QAGB 3VNUA 1FPMA 3KDSE 1KK0A 2RMKA 5D3MA 3RRNA 2GEVA 2GZAA 1Q0UA 1E69A 4ZIRB 1EX6A 3I1FA 4Q9JA 2ONKA 2ORVA 2QY9A 3IDQA 4TL7A 1OH8A 1I4LD 4BGDA 2W2VA 4WOPA 2A9KA 5K8LA 4D0NA 2QMHA 1HA3A 2WJIA 3AP3A 1G20E 1R5BA 5KPJA 1X1RA 2OESA 2OHFA 3RANA 3AP2A 3JZMA 3P27A 1YR9A 4KLNA 5AUPB 1TQ4A 3FGNA 3G82C 1KNQA 1K5DA 3ZS8A 4V03A 3FMFA 3ZD7A 3QBVA 5FUYA 3SS8A 2YHSA 1G7CA 1CP2A 4C0JA 1QVAA 2IYQA 3PEVA 5B2ZA 1YE8A 3RS2A 1KJZA 1GNRA 1ZU4A 4O25A 4QM7A 4PPNA 1ZIOA 3REFA 2IUTA 1HH4A 3GLHE 2ZYUX 4RKFA 2Z83A 1TU3A 3I73A 3VU9B 3KXKA 1O87A 1QHYA 3EIQA 3NDPA 2SHKA 1E3MA 2C98A 2FH5B 2V9PA 2G9NA 4F93B 1KI3A 1ZNXA 3ADBA 4M1TA 1KSFX 1BKDR 4JKIA 1CRQA 1T9HA 1JB1A 3DPUA 4IFEA 4BFSA 2CVFA 3ZH9B 1ZP6A 5BWMA 2F9MA 3LH5A 2EU8A 3SHFA 1U0LA 2MMGA 4M9QA 1W5SA 4X8LA 3AVYA 2A3RA 2XB2A 1D8TA 4UKDA 1F48A 4I1UA 4DCNA 1E4YA 2JAQA 4UQOA 2JDIA 3C7KA 4BWYA 4JT2A 2PZGA 1HT1E 4DKXA 5CM9C 4WAUA 3ZLJA 4AY2A 2VP2A 3HR8A 4GOKA 4M8NE 3HYRA 5DE3A 1E9RA 2QSYA 3K0CA 4TZ6A 1F2TB 4AC9A 1G3UA 3CR8A 2IK8A 2YOGA 3DZDA 3AVTA 1KI9A 2CJWB 5CYPA 3SQWA 3TKLA 1IY2A 1I4DD 4LJ7A 4BLPA 1OFTA 4PAMA 4QL3A 4B3BA 4IOKA 2IXFA 2ZSBA 4JLKA 2NO1A 4TMKA 5JJIA 1KO5A
chains in the Genus database with same CATH superfamily
4QXAA 2YWXA 3TLKA 1V37A 3H8WA 1RPNA 5DYWA 1QCCA 1H66A 4IMJB 3GBPA 4PGAA 1FXWF 2W0MA 4LRTB 3SJCA 4C0QC 2X8BA 3AI7A 4G0UA 1Z26A 4L5CA 1VHJA 2PJRA 3WE7A 3FSRA 4RC9A 4EG7A 1ZO8A 1CB0A 3CKKA 1U5CA 1WO8A 4AJKA 1MO6A 4QU8A 1X7ZB 1ZITA 4MHOA 2OV1A 1GYPA 3IB3A 2ZJYA 4BVLA 5JAOA 4YJ3A 4C4XA 2F1RA 3OOYA 1Y8CA 5F2EA 3IKMB 1HQYE 4KVAA 4FFRA 1RXVA 3VR5H 1Y3HA 3W5BA 4GR9A 2FEXA 3CY6A 2GD0A 3TL6A 3CONA 4QDJA 4K6CA 4P4NA 2IEIA 2XV1A 2ZB8A 3BMCB 1OBHA 1MABA 3MWEA 4NONA 4C1NA 5DGCA 4NMLA 3LKBA 1Y6QA 1JHZA 2EJWA 2YVLA 3MCWA 1U0OC 2WYIA 1OWPA 2HIGA 2OV3A 3JZAA 1YSCA 4K9DA 3TZHA 2QJTA 5JXIA 3N2ZB 5JMOA 3K7EA 2ZJ0A 3A32A 1MG5A 2D1SA 1RLTA 2FWPA 3I0ZA 2W22A 2YRXA 3WIUA 2WK1A 3F71A 4HQLA 2FMTA 1NHGA 4X1IB 4ZVKA 4DR5B 3NWPA 4JJIA 3PHIA 3FAZA 2WJWA 3R8CA 4GWKA 5G4LA 3U3XA 4EO7A 4DLZA 3DBVO 4OLBA 1XPRA 5CB8A 1E9BA 1OT3A 4H31A 1E79A 4OBEA 5DM2A 1WNTA 2ZPTX 3NRCA 1ABFA 3KCQA 2I6GA 3OPYI 3I53A 1EWQA 2ACWA 2BDEA 2AYXA 4MVYA 1H2ZA 3CF4A 2P6MA 5CBPA 1RRKA 4QUGA 3RVQA 3IVCA 3C5CA 1F1JA 4E2WA 5A5FA 2AD1A 4Z4IA 2D7JA 4REQB 3W3ZB 3QHAA 2EBUA 3N86A 5FT9A 2O7QA 1A9TA 3ZE9A 2O2ZA 1JU3A 3QMVA 4PLHA 1PX0A 1PW5A 1T9AA 2PT6A 4O2BF 2OQIA 4MITA 1TAGA 3UB4A 4NYIQ 1U6KA 2O1XA 3IPYA 4YB8A 1GAWA 3F47A 1SUAA 1Z62A 2VT3A 3H3FA 3W77A 5K5EA 3CWCA 1KHHA 1SXHA 3PNQA 1YQGA 4BECA 2QVLA 1X39A 5CTJA 4OX9B 4XLLA 3HXPA 4FGUA 5AIAA 1YIOA 1CY6A 2CHEA 2O2JA 2G1PA 2NQTA 1RQRA 1PLKA 3HJHA 2XDYA 3H6GA 1ETHA 5JS7A 2IHUA 4L28A 1SC3A 2C2OA 2Y2UA 4HWPA 4AYXA 4G5OA 1KKUA 4NEQA 5B3JA 1A98A 5EMLA 3K70D 4OATA 4B6JA 1S4MA 4FYXA 4OH1A 3WRYA 3ICEA 1ZWLA 4A7PA 2AFIA 4DIFA 5JVDF 4JXXA 2MJLA 2I6SA 1P6QA 1XQ6A 4FXOA 5JJ5A 2XCRB 4DA4A 1WZ2A 5HF9A 3JD4A 3JTEA 1WQ1R 1QAMA 4NBVA 1I4WA 4TTSA 5ADVA 1KHTA 4EG3A 5CBPB 1VLMA 4Q7JB 4KPUB 4EW2A 3CFYA 5F77A 1SZCA 1Z2DA 2P2ZA 3FNRA 1OLXB 1T4GA 1ZC4A 1VIYA 1P1KA 2JJ2A 2X4DA 4IXNA 2M6KA 4DQ0A 4OF4A 2ZIZA 1BU5A 1I80A 1M0EA 2Z6UA 1UWCA 4FE3A 3V3TA 4L1KA 4EFNA 3PNYA 3W79A 1ZM7A 2DKOA 3LUAA 4F91B 5FAKA 1EESA 4UREA 2FK8A 4B35A 1ZWKA 2BJHA 2HFKA 3P0RA 4NOLA 5A4AA 2AFHE 4PTZA 3BDIA 2WU8A 4KQCA 4ZAFA 3OIYA 4BCDA 5TEWA 1UH5A 1I30A 1QTNA 1N2CB 1W76A 4K6GA 4Y6QA 4DMMA 2GD2A 4GEKA 3DLTA 2PFSA 3F5DA 2UU9B 2QTGA 2PX0A 4BMVA 1CXZA 2BI4A 4M9RA 4DRXA 1S9DA 3FPGA 3QE2A 4U2GA 3O92A 3SKXA 2QEQA 3TRIA 1XEAA 2R6CA 5KYNA 2JD2A 2C42A 4KTVE 5MHTA 4DRYA 3G85A 3L7CA 5M2QA 1VB3A 2XCIA 3M6VA 4B4KA 3STHA 4R1SA 2O3SA 1ISSA 3JWGA 5BNFA 1KEZA 3R3HA 2BFCA 5DHTA 3E8SA 1JKJB 3NKLA 2Z5GA 1C0KA 1GPYA 1D04A 4RLSA 1Y3DE 4XVQA 1WUYA 2DUWA 3DE0X 3PUYA 4HLNA 2JJ2D 4JLAA 2QD5A 1WCXA 5EE0A 1XEXB 4D0LB 3EFHA 3AJ9A 2RJ3A 1BZYA 4EPRA 3PNSA 4OH7A 4EKDA 2ZK7A 3QVTA 1V5GA 4ZT4A 4GKBA 3KS9A 3UKDA 4TL8A 4RHTA 1XDBA 4G2NA 2JK0A 4IV5A 1Y4UA 4AG6A 3BERA 3SE0A 3AEUA 4X3OA 3KKKA 3TQTA 2EIHA 3V00A 4JLOA 2UVQA 4DLSA 5LQAA 3GRZA 4HMQA 3AV0B 4UBJA 4QUHA 4W8HA 1IYZA 2NZYA 2WT9A 4WINA 5BWOA 3RS4A 3T0IA 1ZN8A 2KPOA 3AUTA 4Y0VA 4EQ6A 2LNDA 4JI4B 2DLCX 2QQFA 3MWLA 4J4BA 4XARA 4BMNA 4Q3OA 2RH4A 1P74A 1JRLA 3B48A 4NHOA 1RHJA 3UJ8A 3L7NA 5DT9A 5AQEA 3M5DA 4Q1EA 3R3JA 4Q18A 2Q7DA 2QXUA 3QELA 2EWVA 1TPZA 5LLSA 1GTMA 2YS6A 1MUUA 2VA8A 3B1YA 5EXPA 1L7NA 4BNGA 3DQZA 4V2UA 2GN9A 5BQFA 1LVGA 2VHEA 3BJRA 3FCAA 3M6LA 2ASVA 3AR7A 3BTSA 1JQBA 1NIPA 2G5TA 5F1YA 2VDRB 3M4YA 3RAFC 5H1YA 4G07A 4RSMA 1GUDA 3RGWS 1M2FA 2R5NA 5CA0F 3NZEA 1SKMA 1WQ4A 2C1XA 2WAOA 3PHHA 3P2IA 1JFLA 2J6IA 5A02A 4KOAA 1H9BA 1V9SA 4HNQA 3ZPXA 3GIDA 1JXAA 3MWGA 3A06A 4EA9A 4F2GA 2VBFA 4N18A 1NRWA 3ND6A 1J6UA 3QV2A 4TS9A 1T1RA 4BGUA 1SK9A 4CTOA 1EUZA 2PSHA 3O4VA 1KQNA 5TQJA 3OM8A 1XQ9A 2FFRA 2W93A 1JWBB 2IP1A 3WGYA 1HDYA 3T3NA 4MEBA 2HRBA 2G9ZA 1KJYA 3HCPA 1OFVA 3KD2A 4M7RA 3DLAA 1QLHA 1T2FA 3BRQA 2NXNA 4MUNA 4BNWA 3RSOA 4C7OB 2GN4A 1CJBA 1LQUA 1YBMA 3Q9UA 1JVBA 1Z07A 2BT4A 3UAGA 2AVNA 1WB5A 3OF2A 3HJUA 5KMGA 3Q72A 3F8SA 2BFDB 1IFXA 3BGSA 3Q8XB 1SGWA 1IULA 1WMDA 1UUFA 4MUKA 1IXZA 1H2XA 1M66A 2QRGA 4C0AC 2CW5A 2FPLA 3R3UA 4PIVA 2OCGA 4KXXA 3VUFA 2O2SA 4EF4A 2JLCA 1J8FA 2REOA 4F96A 2CZCA 3SJZA 1EUDA 3JQ8A 3GH1A 5GM1A 4Z1OA 1E3QA 3SZOA 3KHUA 2HMUA 4FIZA 3TKYA 1YZTA 4G1BA 3UMBA 3ZHSA 4CXMA 4H18A 3MG9A 1TQ2A 2R00A 3GT0A 1N6NA 4RTJA 1YB2A 5CT9A 5DXFA 4BNJA 1DG9A 4QGAA 5JFOA 2NZVG 4RTQA 1KZ9A 1IMJA 2C7OA 3CEPB 4N3CA 3LQYA 3WWCA 1VCHA 4BO7A 4Q1AA 2PGOA 4FFMA 2X19A 4REOA 2C2YA 1K0UA 4JUAA 3JAMA 1NYRA 2CUTA 1XZIA 3BD9A 3FFTA 5HUHA 1RKBA 4BPBA 4NSNA 1BYIA 1KDPA 3KU1A 4I81A 4GXNA 2C4MA 3NWBA 1N3BA 2XIQA 1GQYA 1P9WA 1U1CA 2NG1A 2P3QA 3BX1A 1E96A 3E1SA 2H16A 3LXXA 2GWRA 3IAHA 4G4SP 4LOJA 4PHTA 4REMA 4AF7A 2XUJA 4EYSA 4Z0TA 5LQSA 4CIYA 3IC5A 4YCJA 3AQ4A 3OPNA 2AOWA 3OEHD 4Q48A 4DNQA 1G17A 4FFBB 3ZE1B 2WQ7A 4P4GA 1TM4E 3OE4A 4RZQA 1DB3A 1G55A 4B79A 2XCTB 3NVDA 3BTVA 3WLEA 1BC5A 1U8XX 5BOVA 4M21A 1YS6A 2VSNA 3MJDA 3ZZ0A 2UVPA 2DBZA 2ECPA 3AJAA 4KAAA 2OGTA 2WLSA 3SY8A 2OENG 2OHGA 2I78A 1AQ6A 3E9RA 2CXSA 4V3CA 4WCVA 1LK0A 3TIXB 3MUNA 4P9NA 3G7SA 5LBUA 4CV3A 4NMWA 3FYHA 2FPWA 1DAPA 1N8KA 1U6IA 1XTRA 4JI0B 3JAKA 1TF2A 1GGFA 5AM0A 2QR5A 4ROTA 4O3MA 4N48A 1EYZA 1A2KC 1TKRA 5IDVA 1SVKA 1SC6A 1K3FA 1PJBA 2I8AA 3OZSA 2ZJ8A 5GJVC 2C04A 1U7HA 3AUKA 3ISJA 2WTBA 3KCNA 3Q2KA 3DBLB 2KI5A 1IHOA 5I9MA 4R5MA 1JHYA 3ZU2A 2D3TA 1PG2A 1WF3A 2R4QA 3IPRA 4LI0A 5TPWB 5JJBA 3NB0A 5KJ1A 1YR3A 3KKNA 2E48A 3KTOA 1QJCA 1AKYA 3WGQA 4DA7A 5T3UA 2R6R1 4CTNA 2PRIA 3NTQA 4HH1A 4RLHA 3TG8A 4LPKA 2W6NA 2ZT6A 3MUFA 1OHHA 3QOYA 4HLDA 4WXPA 4XR4A 4C3OB 2OBLA 1PFYA 3HSYA 2OCPA 4JU9A 4KLCA 4RJ2A 2AJ8A 2D3WA 4RMIA 1WBJB 5DRTA 5J5CA 4JI8B 2FF7A 1RFLA 2COEA 4JXKA 4LAFA 2WMOB 3M2TA 4WPGA 1WX1A 3LRXA 1WSBA 2YASA 4M1ZA 2PMKA 2BFPA 1DQRA 3EUAA 2GAFA 1UM9B 4RM2A 2PQMA 4LKOA 1QZTA 2CHVA 1UBMS 1ZBQA 1GRNA 2ZR7A 5DPMA 4PSKA 1GCGA 5HG0A 3SLRA 2ZZNA 3KLMX 2AVDA 4QREA 2XE6A 5FL7A 5FOQA 2QM0A 2O23A 1KH3A 1PL8A 2FPGA 3C3XA 2CSUA 2C5EA 1PWEA 1RCTE 4I4CA 1SVNA 4N3GA 1YR6A 4WUTA 1DT3A 5KX5A 5J1SB 2WQ6A 4H4DA 1H9AA 4OB6A 5B6PA 5IJXA 4CW7A 3DEAA 5JMWA 3PKZA 1NL3A 4NMMA 3VKUA 1UK7A 4Q3EA 5TPWA 4KN5A 2PUAA 3HWRA 5J58A 1CUUA 4NAUA 5EG5A 3ZCTA 1Q1GA 3W5JA 2Q2NA 1M1NA 1PBNA 2WICA 1B42A 4JBWA 4KODA 1EJ6A 4TQGA 3SC2B 1P2TA 5FUWA 3WHKA 4QYMA 3M2PA 2AHOA 4HF7A 1F17A 4LJ8A 2K4MA 4L9AA 5D1HA 1SH7A 4IJQA 3ZGZA 1GQFA 3LS2A 3DAPA 3G2HA 3N6VA 3LC1O 3FFAA 4BNFA 3P4UA 1PN3A 3NYQA 1RYNA 4B6RA 4HFRA 1SQ6A 1FP6A 2AC7A 3PT9A 1M6NA 2R6AA 1XLUA 4JX9A 2DQSA 2Z2KA 2TYSB 9ABPA 3IVGA 3R09A 5J2TF 1USVA 3N1UA 2WG2A 1JR3E 3HO6A 4QGHA 4HATA 4ZVUA 1OASA 3CUUA 4WXYB 3RKUA 1AS2A 3GP8A 1J1IA 2AWOA 4FOLA 3R0VA 4GMKA 2WP8J 2XMZA 3V8PA 3SC2A 4CTKA 5JQGF 1W4BA 1DLJA 1Y9ZA 3I6YA 2RH8A 2X5OA 3IV9A 4Y0AA 2XZLA 4BAUA 5A4IS 2GBPA 3R24A 3D54D 2ZIVB 2B36A 4OGKA 2WU0A 3T1HB 3LPCA 4XM1A 2FPIA 2A3NA 4OQPA 5CDYA 5GADl 4Q3LA 3KB2A 5FUQA 3T5AA 2A59A 2WJPA 3GRYA 4X84A 2UUOA 4XZ3A 2VJMA 4MB6A 3F96A 4IFTA 5AW1A 3C2QA 1IWPB 2YJGA 4YRPA 5KVVA 1QVVA 2P79A 5K0GA 2OC4A 3HKCA 5ALEA 4K9QA 3OFJA 2OTCA 1UQTA 2ODPA 2AK3A 4Y0NA 2J67A 1F5SA 1ZJ4A 3HJGA 4B31A 1H4SA 2VUSA 3WICA 2IEDA 4UPEA 3U7FB 1WMSA 2X2FA 5TIIA 3QA3E 2C2GA 2PXCA 5EMKA 1SM4A 2W83A 1NE7A 5WRFA 2JLUA 3K70C 4HRAA 2I2XB 4KHPB 2FQQA 1NKTA 2X14A 4YXWD 3AL0C 1PR2A 3NATA 1GZ6A 3KSUA 3OD1A 3FNBA 1XD2A 4L08A 4U7GA 2D59A 3UMFA 1DIGA 1S2MA 1XMPA 2JAWA 4HDKB 1QRSA 2ZQZA 1GAXA 2VJMB 2C5AA 3E2MA 4URXR 3DDHA 1T10A 3IAXA 3PFIA 1G5IA 2QN8A 5I7EA 2XTZA 3SSAA 1GM5A 4IWNA 1JEJA 1HE1C 1QC5A 1CU1A 4KNVA 2BFBA 5BY2A 4MV6A 4F92B 2AJCA 2JGAA 2KW5A 1TVKB 4MR7A 1GQQA 3PIDA 4Y2HA 1A1SA 5EIEA 1B6TA 1Y9DA 2CMKA 2PCLA 2XQVA 6YASA 3X1KA 2XKAA 3UMYA 1THMA 2J07A 3KB1A 1EI9A 1QPGA 3WADA 1PX2A 5HMMA 1XMXA 4BV9A 1G20B 1HSOA 1VE6A 3MZ0A 1WSWA 1Z6QA 3AB3A 4R41A 4RZ3A 4UPVA 3DMDA 3VR4H 4LXHA 4C7XA 3S2IA 3WXBA 5IVIA 4LE2A 2LZ0A 1AGXA 3KQNA 1WR8A 5CP8A 4YQFA 4OJTA 1OI2A 3LHIA 2R6ZA 5E6UB 1OE0A 4RZXA 4W5TA 2W6JA 2OC9A 5JEEA 3CEJA 4IUYA 2JH3A 2RHLA 3MTIA 3BMOA 4MMXB 3RYHB 3P8ZA 3T7DA 4CLDA 1VSTA 3RRMA 4DA9A 2FG6C 4KQ9A 5IG2A 2IYUA 5T8KA 4FHDA 1HYGA 3HADA 2WUDA 1RM4A 3AY3A 5K3FB 2C2WA 4JR2A 1B26A 4MQEB 1GKIA 1M2OB 2B82A 3RVDA 4DDHA 1OA0A 1Q6YA 1SXJA 3P0JA 4L4SA 2Y66A 4NCXA 4DV0B 4YV7A 4IHKA 3AFOA 2R4UA 2GF2A 4J3JA 4DSUA 1A77A 2ASEA 4YAOA 3JCZA 3V2UA 5JTUA 1BE0A 2JPDA 1KWGA 2B8EA 3P2OA 2VN8A 5E95A 4G8DA 4N6GA 4BNKA 4KDCA 1XFAA 1M2JA 3LCMA 4G1FA 2OBNA 3H6HA 1XQXA 4ZT5A 3PEWA 2A9JA 2EZ9A 4UUMA 4R8MA 2IELA 4ITRC 4OYHA 1JKIA 3RH0A 3V55A 1R9MA 4NJEA 2IYEA 4U7DA 1BMFA 2YUTA 4FQ7A 4P86A 4U3JB 4WLVA 1PR4A 1PJLA 2DT8A 3W3AH 1VE1A 4MB2A 2ZWVA 3BUSA 3RSGA 5CLIA 2AFIB 4Q9HA 3WC4A 2YVQA 5JQWA 1AKUA 1G7SA 1DDGA 1E2NA 3M8KA 2DJ5A 1YVEI 3G2MA 4OHBA 4FKMA 4S0XA 3MS2A 2EQ5A 5CIWA 5DX0A 1M6YA 3RCBA 1GFIA 1RRGA 3H1AA 1KPGA 4IZ6A 3WXMA 3LX4A 3QLVA 4J3NA 3VI4B 4A1OA 2XUZA 2NVBA 2IUUA 3F7NA 3OD5A 2REQA 2AJBA 2LPMA 1EP2B 3DPIA 2H1HA 3OLZA 3ZJ4A 2QR2A 4FMDB 5JCOC 5KTMA 3UFXA 5EINA 5LYJF 4QASA 2VPXA 5JNTA 1SNYA 2WWRA 2PWBA 2A0FA 1HQDA 1N92A 4EK9A 3EMDA 4IIDA 3ZWNA 1QRTA 3IODA 1X19A 4S12A 5K0LA 5L6LB 1WMAA 4Z9XA 1U3UA 5GGYA 5HF5A 4JLNA 1GPNA 2PH7A 1PGQA 4M1OA 5SYNA 5JYCA 2Q41A 2EKDA 5DGHA 3LYHA 2ON6A 1QIJA 1NF2A 3WZLA 4RF3A 2EZTA 1KERA 2J3JA 2AR0A 4BV2A 1E98A 5BUQA 1F6WA 4TUYA 1A4UA 2PMWB 2HWUA 4R51A 4JITA 4CT5A 3BXPA 1KI2A 3D8UA 3N2KB 5JFGA 2V1XA 4Q37A 4AYTA 3LP8A 4G65A 1Y82A 4IIJF 3ZHBA 2ZIFA 3SNKA 5AW6A 3R0JA 2ZR8A 3UMMA 4G9BA 2L18A 2QVCA 2BEUA 1GPWB 3MSCA 2H2IA 2W6QA 2V7UA 4Q7EA 4B8WA 3L84A 3G02A 4EEZA 3ANSA 3N8DA 3NXKA 3PUXA 4FX2A 2DBVO 4LYHA 4OP1A 4PEVA 5DKFA 3LF2A 3CTMA 4INAA 4Z9FA 1NXSA 4F5EA 1XNGA 4E6EA 2YWRA 1K2VN 3BJIC 4LF4B 4FBLA 3TSZA 4I4TA 3O4IA 1OIVA 2B1RA 1D2GA 5E6SA 4LXGA 3EGOA 4ZJZA 1XKTA 2BMFA 2EEPA 3OQIB 4O1MA 3EOZA 2YW2A 3UB2A 3NHMA 1P9OA 2J0EA 3KQPA 1EGHA 1XPJA 5EI5A 5C5DA 3KKEA 2YN0A 3RSSA 4CF7A 4L5JA 4NU8X 1FTGA 5DNEA 1S01A 3GUVA 4JMLA 3EVBA 4C0BA 1HBJA 3NMUF 1GR1A 1VOTA 1Y0BA 2Z1NA 1KKMA 1EB8A 3D6TB 3X0DA 3HY3A 3L7DA 2H0RA 4S1VA 1N2OA 2J4CA 2CB0A 4YMVA 2A1TR 1AHIA 1Z0JA 2WAXA 3HCOA 1V3TA 2PJZA 3MPOA 5D84A 3UMJA 4QJ3A 4HAYA 3HN6A 3QUQA 2B83A 2FEWB 1N33B 2J59A 1RJ9A 3JSAA 1CVRA 1Q84A 4HJXA 4JP1A 4WUVA 2GZ3A 1AY0A 3WYGA 1N5JA 3C4JA 5ENVA 2YV3A 2QTFA 4RE5A 3UFBA 3HVKA 3HEAA 1ACMA 4CEHA 1DGQA 1N6KA 2I1QA 3MLBA 3A1FA 4HQNA 4EYQA 5J4YA 4QX6A 1SCUA 3KVYA 3LPAA 3FMVA 1TE2A 3SJBA 2IXBA 2JCVA 3DCJA 5FJIA 5L53A 3F90A 2XNHA 1PWXA 5M29A 2OCDA 3DAYA 5A0VA 2X9GA 1YUNA 3K0EA 1N1DA 3WYAA 4DJAA 1GPUA 2COKA 1Z5NA 4GI3A 4HLUA 2VRNA 3WRYC 1XTUA 2B9EA 3A9RA 1M6VB 1N6RA 1RJFA 1BN6A 4J16A 3WNCA 3TE6A 4NKRA 2H07A 4K9SA 3TFQA 4BJHB 5JSZB 4OV6B 2JCBA 1WMEA 2JIOA 2FPXA 3RT7A 3MTGA 1LFDB 2UZ3A 4U9IS 4MPPA 1YIDA 4G3XA 2VF5X 4QO7A 1R2QA 5AJZA 1LLCA 1F60A 2HM7A 2W2TA 2YV2A 2ZYGA 4I1YA 2YKGA 5HZKA 1XQVA 1YZQA 2G9VA 3BWDD 4D4MA 1Z4OA 3CISA 4DRXB 2PKQO 2O8BA 1KIMA 4MI1A 5G02A 1FDOA 3CIOA 3OCZA 1EM8B 4YX9A 2RGNA 5DHQA 3PU6A 4UULA 4YAKA 2OMEA 1XLTA 5GOZA 1FX1A 2Y6UA 1HTBA 1YGYA 3NC0C 1EUQA 4WKNA 2YQ4A 1P3Y1 3AF3A 5IABA 2A92A 3SXJA 1KOLA 3D2LA 2R25B 2X8LA 2O07A 1KC3A 4GFDA 2ZWAA 1Z5OA 1CKEA 3QUAA 4WNCA 4L4RA 4HQOA 1YDGA 2DG2A 1ZGBA 1S2DA 3N0RA 2VXBA 2YZKA 5FOVA 1E1LA 3RG8A 3BRCA 1JQAA 3U1VA 2XXJA 3PS9A 3B53X 5JS2A 2H3HA 2ISCA 2W6CX 2FUG6 3VR2D 3EJWA 1EHIA 5ESDA 5KNLA 2RH5A 4MX8A 3LBIA 1MNQA 3X1YA 4TWRA 4BX0A 5DLYA 4UTRA 3HO8A 5AW7A 4D6PA 1Z0ZA 3K31A 1K4KA 1WY5A 4C0LA 1OYYA 2DTXA 3MD9A 3OESA 3DP7A 4D79A 5PNTA 1UBKS 2D8AA 4U7PB 5FHQA 3GQBB 3MRTA 1FE8A 4MR9B 3ELDA 3T0FA 3V8MA 4DEXA 1JMKC 2IIPA 1K0FA 2ZP1A 4FYWA 3RSHA 4X65B 2JJ1D 1T5IA 5D86A 3EWIA 4O2BB 3M70A 4Y1RA 3T1YB 5FNVA 3L6BA 4ZV4A 5IBQA 5C80A 3M1YA 3R6GA 2VCYA 3J7AC 3H18A 2HK8A 3AFHA 2R1TA 3AGPA 3ESDA 3UMCA 2RCNA 1BD3A 4MVJE 3W5CA 3OP4A 3EIHA 4XM0A 5CAEB 2B2NA 3TSCA 3RC8A 2G0AA 4MVCA 3ECSA 1HTTA 2DHEA 4OI2A 3VHXB 3LFUA 3HCNA 5B7PA 2P2SA 2Q6IA 1KDYA 3VMFA 2PXAA 1HOXA 3U4AA 4C08A 1Q0LA 3PHGA 1AK9A 4BAGA 1DEAA 2XA1A 3R9IA 5G1OA 1GY8A 4UOEA 5HPYB 2QTWB 1QHSA 2C4TA 3A1UA 4RELA 4ZWNA 3TQOA 4TM8A 3QBTA 4JQZA 4WY5A 1ZGJA 1Q2XA 2Q46A 3DOCA 4YAWA 1KAEA 1NVGA 1W6RA 3Q40A 2CZGA 3S2SA 4B3JA 1PZMA 3O8LA 3GGPA 4NYMQ 5HUJA 1J2RA 2FQYA 4BP9A 1MGOA 3JD1A 1DV2A 3MTBA 2JZCA 4V39A 4YRKA 2ZS9A 3O8QA 2WUGA 3E1GA 3A2LA 1E8NA 1YK0A 4N5DA 1G98A 3HPRA 3MT0A 3LV8A 3E35A 3CLHA 4TZ0A 1FRNA 4TT8A 3GLGB 1WSAA 3EASA 3NH9A 3OKAA 1HF3A 3F46A 3DHWC 4LJ4A 4MO2A 2PZ8A 2QLLA 2WSBA 1YVUA 3MRVA 3OF3A 5CW2A 4ENRA 2IUYA 1R5NA 2FW8A 4NG4A 3SQOA 1TZMA 1YUBA 2IH4A 2HHJA 1PG5A 2Q5JA 4P2BA 2W9XA 3MJTA 4TYPA 5KYTA 3EIUA 3PYXA 3LT4A 4JN6B 1O97C 2EOAA 4BO3A 2NOAA 1BO6A 2VXOA 3PWSA 2WAAA 5CNJA 4P5DA 1G5QA 1RMTA 1RLIA 2MSCB 3QVLA 2C2KA 2W0SA 3KLOA 5HZGA 3RHTA 3PRJA 5G2OA 1IN4A 4DL9A 5E9JA 4IKOA 2WU3A 4MUEA 1QFSA 5LQJA 2RGUA 5A7FA 1OUMA 5JC8A 3DEIA 1Z2AA 3H5WA 5B6JA 1COWD 2RHGB 3B6JA 2BONA 5KWIA 2KJQA 1MQ8B 1KZ7B 3M6AA 1Z5PA 1C0IA 2N3ZA 3PEFA 1JTFA 1L3CA 2GHTA 2K6GA 1BOFA 2XVXA 1C0LA 4IQ0A 4JP5A 1P7YA 5DNUA 4LJ9A 3J80A 2GQ0A 1VRWA 2X0JA 1RRCA 3RUPA 4D82A 3DL7A 3L0OA 1EFVB 2PBZA 4PVCA 4Y2SA 4IVRA 1W2GA 2VDLB 1E9FA 3DWFA 1OKKD 2PX6A 2WOJA 3A6HA 3RS3A 3HBLA 5F1OA 5EUMA 1I3KA 3S1AB 3ZU6A 4EDFA 5CVTA 1G63A 2PAAA 1E1NA 1OBCA 4IIBA 4UDOA 3WR5A 2C1EA 3NVAA 3KYBA 1UJNA 3FPBA 5KAMA 4G5RA 2R7MA 1HYEA 2HLHA 4IIHA 5EFOA 3LPNA 2C8VA 4KBGA 2VNSA 2ADOA 4RPIA 4M9UA 3RF6A 4DMGA 4OHPA 2BN4A 3IOCA 4I08A 3IEUA 4XEHA 1DCTA 1E32A 2XMGA 3AR6A 4FJ2A 1JA9A 5CYOA 2DLNA 3IHLA 1YBAA 1CULC 1LPSA 1M3SA 3GA0A 3QE4A 2D1QA 3QU4A 1G21E 4ILEA 5JDIC 3KM0A 1CY1A 5IAEA 2X1MA 3ELYA 4PZZA 4J0JA 1DTSA 5CDUA 1C3LA 2DPGA 4B4UA 3S4YA 1AUPA 5K6TA 3AM5A 2WM9B 2WTAA 2FGJA 1UAGA 4XGQA 2A1UA 3V1TC 4K46A 3W9BA 4OX9Y 2BF7A 1NNUA 4EA8A 4JSTA 2YX1A 4AMYA 2P5YA 3OLYA 1DQYA 2OZLA 3QUSA 2JZNA 3NT4A 2FFJA 1RI2A 1EK6A 3FG9A 4K3VA 4CMGA 1CY0A 3OQ6A 1KE2A 4ZI7F 2D62A 3VM6A 4Y9UA 1P1FA 1ADCA 1GGHA 1JV2B 2O2CA 2XUIA 2ZQ5A 1D6MA 2SECE 3B1WA 4GRDA 3RBAA 1G5HA 3EIWA 4L8GA 3THXA 1D4AA 3KR2A 3CW9A 5JV5A 5IP5A 1DT5A 2ZYWX 4QLBA 4M9ZA 2VSQA 3L8CA 1N2JA 2NXWA 2V5UA 4PC1A 1NBIA 4LDAA 1D4OA 2EFGA 4QDZA 5K8JB 4XWTA 1EFCA 1XMOB 5BN5B 3KTAB 2AFVA 3KVOA 1MVNA 4EFLA 5CDSA 5EKXA 1G5RA 4WHMA 1LVHA 3BWXA 3L9WA 3QVUA 1JFVA 4JJ7A 1QYIA 1DRUA 4YP1A 4M8LA 4KO3S 4DPKA 1T6BY 4ZCIA 1E7MA 2XUFA 4HDMB 5HDBB 2V6IA 3AHCA 1N75A 4O5OA 3ZDQA 4D9KA 4JLWA 1UKYA 1EAYA 1QYVA 4JQYA 1XA4A 4L5BA 2OFWA 5J5VA 5TXGA 4CKEA 3LPDA 2BLNA 4CMJA 3BWMA 3DFMA 5K45A 3CZQA 4LDZA 4PO3X 1J0XO 2O7RA 4Q02A 2EKQA 1Y3IA 2CJXA 3O8OA 2VL7A 4LFBB 3F9IA 3OMLA 3TLEA 3HJNA 3CPHA 4BKPA 1P61B 2LXNA 1Y1RA 2ZYSA 4AS3A 2EYUA 1J42A 1E2EA 2Q9UA 2GJ9A 5BRNA 3R74A 3SYMA 1OVGA 3VKWA 3VYRB 3ZXSA 4B2YA 2O8EB 2B0JA 1YO6A 3PQ7A 4TTIA 3DL0A 1ULAA 1MTZA 3EGEA 3OUZA 3SOPA 3ZEAA 2QJRA 3GN1A 2GEKA 2BFEA 4FJ1A 4JBGA 2VTEA 5HCIA 2DB3A 3GROA 4K6FA 2QG4A 2FKNA 3H4VA 2EFYA 4UUOA 3UKJA 4BRWA 3U9TA 3TTYA 4XVHA 3W4JA 4QU0A 3W8RA 2R7AA 8GPBA 4YJHB 5IAGA 2V0GA 3PUKA 1U0RA 1L1QA 2WYUA 2Y1KA 3UUWA 2H4YA 5JW6A 1D5WA 3MGCA 5GVSA 5EZYF 4WZBE 4X63A 2WUFA 2UXDB 3V48A 4PG4A 4E6PA 3G6KA 3CLUD 2DWOA 1KYWA 1FUKA 4K8RB 2RC6A 2FN9A 2J5QA 1AHHA 5EA2A 4JP2A 5GJWC 5LB4A 3V2IA 8LDHA 2HLPA 3E48A 1ZW1A 3NPMA 5JQGB 1GZSA 2WWXA 2J0SA 2FSHA 4FFDA 1UKAA 2WV9A 1CQIA 2NZUG 3QWBA 5CJPA 1YS9A 2YH2A 4NHEA 3TD2A 2QW0X 1OQAA 2XZPA 1GZDA 2PH5A 5EJ6A 1DC8A 1B76A 3LC2O 1J4AA 5KS2A 1UP6A 1XZMA 3BRWD 2Y8EA 4FSXA 2ZYIA 4INZA 1YQXA 2R8OA 3DG9A 4GKAA 2PLFA 3ETLA 1U2GA 2GTHA 2IVZA 2QTCA 3B8EA 1ZK3A 2WILA 1KZ4A 2CK3D 3H3JA 5IJ9A 3EFEA 1DC3A 2RKWA 1JBEA 3FMIA 3KKLA 4WERA 5BSUA 2I4OA 1SO8A 1UPUA 2HU7A 4JVOA 3DLPX 1YCHA 3ZCVA 1EXNA 4IM7A 3I9KA 1KJIA 3C3AA 1CNFA 1Q3KA 2JIRA 2XVYA 5GPBA 5BRAA 5BWLA 4X85A 4HRYA 5C37A 4DJ5X 1GCIA 1K06A 1E62A 1K7SN 2W48A 3ZZTA 2F7SA 3UKOA 1BWRA 3OKFA 3Q1LA 1ZIYA 5FB3A 1MH1A 1XF9A 3VHRA 2P9JA 1T0IA 1FVXA 5KYWB 1T6NA 3IT2A 5IFLA 4BAZA 4TMVA 5K0CA 3LSYA 1O1YA 1YQEA 3FCOA 3VR5D 3RTCA 1KDRA 3ILHA 3GEBA 3LT2A 3GZ4A 3MQFA 4YT8A 1U8ZA 1RWMA 1EP1B 1C50A 1IBRA 2HUPA 4MP8A 3E18A 5LD2B 1IAQA 2I4NA 1RI1A 2HYIC 2Y67A 5KYVA 3L7IA 4UFPA 3C7TA 4ZTBA 3CNLA 2VHTA 4OP2A 4CL8A 4YMHA 5IJAA 2Q5OA 1RXIA 4KREA 2WJ4A 4K5QA 5AOBA 1X0VA 3E5MA 4DAOA 1DE0A 4RIFA 1OAKA 1MC8A 2VYNA 4KJXA 3OIWA 3ZWMA 4FD3A 4NH0A 4KR9A 2Q5IA 5BMOA 4QVIA 1V1MA 3H5IA 3FSGD 3QWHA 2X86A 4YNBA 3AERA 3K6KA 4X94A 2IZ5A 3OTGA 1RWXA 1ZM2A 3EF3A 1GZ3A 1SPXA 2EV9A 3PNVA 2P7IA 1PJSA 3OPXA 3NONA 5F3RA 3IP1A 3TAXA 5I7SA 4B84A 2R2AA 4K9NA 1WZUA 3E7PA 3OJOA 3EZ7A 3SFZA 4OQZA 3RJ5A 4G26A 3ZHUA 2O2GA 1RWKA 1OGJA 4W5WA 2EHJA 4LE1A 3ZDYB 2O8VA 4IGIA 4P58A 3F6EX 1IM5A 3FLMA 2ZUVA 3OWXA 1SHTX 2QX6A 2ZI7A 3K2QA 4DCJA 2XPCA 4I4IA 5CBKA 3AR3A 3UWDA 5JD6A 4Q12A 2J87A 4KAJA 1OI7A 4TL6A 621PA 1KFEB 4QTUB 3AR9A 3D9QX 4C89A 2A0YA 2PUEA 2QL9A 2EWMA 3ZE0B 1Z6YA 3Q7QA 5CCDA 3T9EA 4X7MA 5IZ4A 2P2CA 3TD6A 2VPIA 1CQJB 3VZPA 3AKEA 1AGPA 4D5GA 1V1MB 1NLYA 4WECA 1ZVMA 2YVKA 3LRPA 3MEQA 3VR0A 4E13A 1PR3A 1IQ0A 3I2JA 4JK3A 4CT0A 1XROA 3GRFA 1Z12A 1E1RA 2CD7A 3O2NA 3GPDG 1UDCA 3A2NA 3CG0A 1N6HA 2FRDC 4AURA 4G2TA 2BKEA 4IVPA 5CX1B 4HN4B 2V4MA 4KSYA 5HRAA 1N7HA 3GLFB 3GFQA 1E6UA 5A05A 5HTOA 3D8HA 4LXYA 3JQAB 3HR7A 2RCYA 3LRTA 3MUOA 4MQ5A 2AC2A 2DQYA 3H1GA 3T3DA 3X2FA 3GFFA 4I66A 4RIEA 1N8TA 3GEMA 1Y6JA 2W6ZA 5ER9A 1YI8A 2QK4A 4Y2VA 1LZLA 1V7QA 2JFZA 3RRXA 2FW7A 3ETCA 1IVSA 2Q7OE 2CKDA 3OPVA 1XD2B 4CEJA 3EFOA 5M04A 4HQ0A 3UHPA 5CVVA 4M1YA 3PXBA 3D3WB 4NPHA 4P83A 1L5HB 4P31A 3ORRA 1ABEA 3THWB 3SC3A 5JO9A 1Y6ZA 1AOXA 3DA8A 2DPXA 5E0OA 3NALA 4IDPA 4W5QA 3CVXA 4KZKA 3VAAA 3ZLBA 3NNSA 2QZ4A 1CZLA 1BX0A 2WWVD 2YUIA 3EOAI 4ND7A 1VYUA 3KBBA 2O50A 3WLQA 4EAQA 1YQQA 5ICMA 3HBAA 5H4HA 5K03A 1J2JA 4PPQA 1RAIA 4BZZA 5JEDA 1YVPA 2WU4A 4KO8A 3VC2A 3GGCA 3HDQA 4IDEA 1DIBA 1XZKA 4ZRNA 4EJSA 4ZO4A 5ITWA 1KR2A 3ZDFA 4D4GA 1Y3FE 4CL2A 4B81A 1MV5A 5FQNA 4B3RB 4HGYA 3K6SB 5KU7A 4F5DA 2A14A 2HMTA 5DCWA 3T7JA 4W9NA 1NZFA 3NBQA 2IS4A 1KIFA 1T4CB 4URVR 4GBJA 3IVMA 5EP4A 1XDUA 5JPDA 1ADBA 3T9FA 2RIRA 3NHAA 2FUG1</