3T01A

Crystal structure of phosphonoacetate hydrolase from sinorhizobium meliloti 1021 in complex with phosphonoformate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
Knots found
sequence length
413
structure length
413
Chain Sequence
MSKISVTVNGRRYPWPRVPAIAVCLDGCEPAYLDAAIDAGLMPALKRIKERGAVRLAHSVIPSFTNPNNLSIATGSPPAVHGICGNYLYEPSTGEEVMMNDPKFLRAPTIFQAFYDAGARVAVVTAKDKLRALLGKGLRFDEGRAVCFSSEKSDKATRAEHGIDNASAWLGRPVPEVYSAALSEFVFAAGVKLLREFRPDIMYLTTTDYVQHKYAPGVPEANSFYEMFDRYLAELDGLGAAIVVTADHGMKPKHKADGSPDVIYVQDLLDEWLGKDAARVILPITDPYVVHHGALGSFATAYLPDGCDRSEIMARLKAIQGVDVVLGREEACRRFELPEDRIGDIVLVSSENKTLGTSEHRHDLAALDEPLRSHGGLTEQEVPFIVNRVLPELPNAPRLRNFDAFFYAVTAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphonoacetate hydrolase
publication title Structural and mechanistic insights into C-p bond hydrolysis by phosphonoacetate hydrolase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Hydrolase/hydrolase inhibitor
total genus 130
structure length 413
sequence length 413
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 3t01A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3t01A01
3Q3QA 1ED9A 5GOVA 2IUCA 2D1GA 2GSOA 4LR9A 1KHLA 3M8WA 4N7TA 3M7VA 4B56A 1KHNA 1B8JA 3KD8A 4GTWA 1P49A 4KM4A 1Y6VA 3M8YA 1EW2A 1KHJA 3NKMA 1EW8A 4LRFA 1FSUA 5LRMA 4YR1A 3LXQA 3NKQA 5EGEA 1N2KA 4LR2A 1E33P 2W8SA 3IDDA 1KH9A 2GA3A 2W5QA 3MK2A 4LRAA 4KAVA 3NVLA 4LQYA 4UPHA 2RH6A 1O98A 3ED4A 1ZEDA 3UO0A 3UN3A 1K7HA 4UPLA 2GLQA 1ELYA 3BDGB 3NKNA 3UNYA 1E1ZP 2VQRA 1E3CP 1N2LA 2ZKTA 1HDHA 3MK0A 4CXUA 1AJAA 5KXAA 1EW9A 3CMRA 4UORA 3E2DA 1URAA 3DYCA 4UPIA 3B5QA 2X98A 3UN5A 4LR7A 4FDJA 4LRBA 1ELZA 3T00A 4UOPA 5K4PA 1O99A 1SHQA 3WAVA 4CXSA 3WAWA 5LIAA 1ZEBA 5C66A 1KH7A 3WAYA 3NKPA 2IFYA 1EJJA 4ZG9A 5IJSA 3A52A 4MIVA 1ALHA 3SZYA 5IJQA 3T02A 1ALKA 3SZZA 3BDHA 2W5SA 1AJCA 1ZEFA 3DPCA 1EQJA 3WAXA 1HJKA 2IUCB 5L0EA 2W5TA 4KJDA 5INHA 3OT9A 2W5VA 4CYRA 5TJ3A 1URBA 4ZG7A 1AJBA 4UOOA 4ZGAA 2QZUA 3TWZA 5HRTA 2XRGA 2W5WA 1KHKA 1Y7AA 4FDIA 4NWJA 2W8DA 5DLWA 5L0BA 3TX0A 3TG0A 5EGHA 1SHNA 2GSUA 1AUKA 5DLVA 4GTXA 1ED8A 4TN0A 2ANHA 2XR9A 5LRNA 4QAXA 2GSNA 4GTZA 3BDGA 4CXKA 2W5XA 4KJGA 5GRRA 3WBHA 5LQQA 4MHXA 3NKOA 1AJDA 4LRCA 4UPKA 1ELXA 1HQAA 3NKRA 5DLTA 3BDFA 3MK1A 4LRDA 1ANJA 3M8ZA 2G9YA 1ALJA 1E2SP 4MY4A 1ALIA 3T01A 1EI6A 4CYSA 4LR8A 4LREA 5AJ9A 4ZG6A 1ANIA 2W5RA 3IGYB 3UN2A 1KH5A 3IGZB 4GTYA 4NWXA 1KH4A 5L0KA 4KAYA
chains in the Genus database with same CATH superfamily
5GOVA 1XZQA 3PO3C 2JA8C 4MEXA 3S16K 3H3VL 4J3NA 1B8JA 3OREA 3GTKC 5M5YK 5IYBC 3KD8A 3HOXK 5IYDK 1YNNA 1EW2A 5D4DA 3HOYC 2EBBA 4BBRK 1L0WA 3L4JA 1INNA 3G4CA 4KMAA 3IDDA 1KH9A 1IQ0A 2GA3A 2W5QA 3LAPA 5IYDC 1O28A 1BS2A 3TTGA 3S2HK 5E68A 1O98A 2JA6C 3UN3A 5JFEA 3S1QC 3BDGB 3UNYA 4A3DK 2VQRA 1N2LA 4P9SA 1RU0A 3S15C 1HDHA 4CXUA 1AJAA 1VH2A 3GTJC 3E2DA 3AH5A 3HOUC 5TMFA 2A69A 3S1MK 3B5QA 1USOA 5IP9K 4GTCA 3GTLC 3RZOC 4QJVB 4C3IK 1I6HC 3HOWC 3GTKA 3I4MK 1O99A 1YCLA 4CXSA 3WAWA 4G7ZA 1ZEBA 2A6HA 2NVXK 3CAGA 1Y1WA 4AH6A 1KH7A 4OINA 3NKPA 2V6UA 1EJJA 1I50K 1ZYRA 2YU9C 4OIQA 4GTEA 3A52A 3S1MC 4G0UA 3V4GA 1I50A 4MQ9A 4XSXA 2JA7C 4KM8A 5CHPA 3WAXA 2IUCB 2O5JA 1XPPA 3S15K 5L0EA 4WILA 1Y1VK 5INHA 3M3YC 1HI9A 2CW0A 3AD9C 1JOEA 4Q4ZA 4MEYA 3TWZA 3OEPA 2E2HA 2W5WA 3M4OC 4FDIA 2JH3A 3TG0A 3TX0A 2NVTC 4A3JC 2GSUA 3ERED 4GTXA 1J6XA 4KMHA 4GTZA 3GEHA 1WQGA 4MHXA 2JA5K 4LRCA 1WCMC 4A93C 1HQAA 3HKZL 3BDFA 1EH1A 4GT9A 1ANJA 4OIPA 4A3CC 1ALJA 2RGRA 1SMYA 5M3MK 4G0WA 2NVXA 5IOTA 2YU9A 1Y1WK 1O26A 5C4JC 3IGYB 3VA7A 4A3FK 3S14C 4KAYA 3LAJA 3G4AA 1O2BA 4N7TA 4LR9A 1KHLA 4KM9A 1TWGA 1TWHA 2R7ZC 3HOVK 5IORA 1P49A 5M3FK 3QX3A 1J6VA 2XCOA 1O24A 4GTDA 3GTMA 4KATA 4YFKA 1TWAK 4YG2A 4LRFA 1FSUA 2VUMK 4BXXK 4YR1A 2WB1L 3GSIA 3GTOC 5EGEA 3FKIC 3OPFA 1I6VA 1ZXOA 4LLGA 2W7VA 4BBRC 3MK2A 4LRAA 4KAVA 3MMLB 3NVLA 4LQYA 2GAHC 2R7ZK 1WQFA 2PHCB 3S1QK 4UPHA 3S1NK 3HOZC 4GTLA 5FLMK 3M3YK 1AB4A 2PMZL 2R92C 3ED4A 5C44K 1ZEDA 4GZYA 4UPLA 1F9NA 2BE5A 1SFOK 4LJZA 2ZKTA 5M5XK 3A8IA 5C4XK 3H3VD 1SFOA 3CMRA 4UPIA 3HOVC 3S1NC 3AQPA 4KMUA 3UN5A 4KMDA 4OIOA 2PA8L 3TFIA 1ELZA 4GTAA 4P5BA 3T00A 2ZUEA 1B4BA 4UOPA 3GTOK 5M5WK 3FKIK 3JSTA 2B63C 3RZOK 2JA7A 3AQOA 5LIAA 4BY1K 2A6EA 3GTOA 3FKIA 3RZDK 4Y52K 4LOWA 1F93A 5IJSA 2JA7K 1WSVA 2Y3PA 3K7AC 4DDQA 4MIVA 4A3LC 3SZYA 4A3FC 2R92K 3GTMC 2WAQD 3S2DC 4WJ4A 1ALKA 3SZZA 4KAWX 2W5SA 4KC6A 3DPCA 2E2IC 1VLOA 1G51A 1ZQ1C 3H0GK 2D6FC 1TWFK 2NVQK 3OT9A 4Y7NC 1PJ6A 1WOOA 4Y52C 3RZDC 4G0VA 1TWFA 5HRTA 1UV7A 1Y1VA 2P8TA 1TWAC 1XZQB 1Y7AA 1DD5A 4PAAA 5JVOA 4WJ3M 1JQWA 4C2MC 2PPBA 5DLVA 4C3JK 4KB2A 2GAGC 4TN0A 2XR9A 5LRNA 5IP9C 2B63A 2JA6A 3GTLK 4JK1A 2W5XA 3WBHA 5LQQA 3I4NK 3I4MC 1PJ5A 3NKOA 1ZBSA 1AJDA 3K7AK 1WSRA 5C44C 1BGWA 2Y0SD 3NKRA 5DLTA 4C45A 1XZPB 3PO2K 4LRDA 3M8ZA 1SFOC 2G9YA 4FM9A 1ALIA 4ZG6A 1EI6A 4CYSA 4LR8A 5AJ9A 1YX2A 2PMZD 3BP3A 3IGZB 5L0KA 1KH4A 1IE0A 1O25A 3AD8C 3AD7C 1R9TK 3I4NC 2NVYA 3Q3QA 4BY7K 2R93A 1WOPA 2KWAA 1ED9A 2IUCA 2D1GA 4B56A 4OIRA 1KHNA 2NVYK 4GTWA 4KM4A 1O2AA 5FJ8K 5IOSA 4A3GC 4A3MC 1Y6VA 1KHJA 3NKMA 3S1RK 3M4OK 3S17C 4ILDA 3LPXA 5LRMA 1DCPA 4A3EK 3NKQA 4A3DC 3GIRA 3GTMK 1TWCA 1TWAA 2W8SA 5HL8A 2VUMA 5FLMC 1V5VA 4QIWL 1C0AA 3HOUK 1VGXA 4A3GK 3GTLA 3S0XA 1F7UA 3UO0A 4LK0A 1BDFA 5IP7K 1J6WA 2E2JK 4C3IC 1I6HK 1ELYA 2JA5A 2CFAB 1E3CP 4BLAA 4G7HA 3GTPC 3EQLA 3MK0A 1O2FB 2NVXC 4A3IK 1GE9A 2YU9K 1URAA 3DYCA 5IOQA 1ISEA 4LR7A 1R9TA 4KARA 4FDJA 1EQRA 5K4PA 3TFHA 4XLNA 4PABA 3WAVA 3GTPK 1TWHK 2R93C 5C66A 4A3LK 3L4KA 2V6SA 4X6AK 3FOEA 3GTPA 3BP8C 3GTQK 2JA5C 3FOFA 4BY1C 2ZFZA 3NUHA 3S2HC 3T02A 1VRQC 3FHZA 1B4AA 3GEIA 3GTQA 1AJCA 1ZEFA 1EK8A 2R92A 3HKZD 1O27A 5IYCK 2W5VA 3N3YA 4A3IC 4CYRA 5TJ3A 4QJVA 5IYBK 1URBA 4ZG7A 4KDDA 2QZUA 1J98A 2XRGA 1KHKA 1K83A 2W8DA 5L0BA 5C4XC 1DCHA 1SHNA 4AYBD 1AUKA 1XXAA 4BLBA 1Y1VC 1EFWA 4QAXA 5C4JK 4CXKA 3S14K 5GRRA 4KJGA 4UPKA 4GFQA 2B63K 2JA6K 1ELXA 1WOSA 4C3HC 4A3BK 3GTJA 4MY4A 5TMCA 1VJEA 1PJ7A 4LREA 1ANIA 2ZUFA 4M1XA 3UN2A 1IBAA 1KH5A 1XZPA 3GTJK 4NWXA 3GTKK 2GSOA 3H0GC 3M8WA 1WCMA 2XCRB 3M7VA 1R9TC 2NVTK 5L46A 4A3CK 1WIHA 3H0GA 4G7OA 4ZH4A 3IPJA 4Q5SA 3M8YA 4X6AC 1EW8A 4KN7A 4YFXA 3N0BA 3LXQA 4A3KK 1KQ4A 4A3MK 1N2KA 4LR2A 1JVIA 3S1RC 1E33P 1ZVUA 4KN4A 4QIWD 2FQOA 3CQZK 2RH6A 3ADAC 5IYCC 3HXAA 2V6TA 1WORA 4BBSC 4RMFA 2VUMC 4BXXC 1K7HA 2GLQA 3CQZA 3NKNA 1E1ZP 1IL2A 1USMA 4YFNA 1HQMA 5IP7C 2WAQL 2E2JC 5KXAA 1EW9A 1I3QC 1XXCA 4UORA 3CQZC 2WB1D 3HOWK 3HOZK 3BUEA 4BY7C 3PO3K 2A68A 2FQTA 2CFAA 2X98A 3S16C 3S2DK 4LRBA 1TWHC 2R93K 4NOIA 4AYBL 1SHQA 1TWGC 5CJ9A 2NVYC 1WCMK 4A3EC 4KB4A 4XSZA 4C3JC 3GTQC 2O5IA 5C3EK 3GTGA 1IS1A 4GTFA 3WAYA 2PA8D 3S17K 2IFYA 4ZG9A 4P5AA 1ALHA 5IJQA 3BDHA 1TWCK 1TWGK 1EQJA 1HJKA 2W5TA 5C3EC 2E2HK 4KJDA 1YNJA 1X31C 4KASA 1F7VA 3WODA 1AJBA 1DCOA 4FZBA 4UOOA 4BKWA 2JA8K 4ZGAA 4LK1A 1WQHA 4NWJA 5DLWA 5EGHA 3DXJA 4XLPA 3PO2C 4A3KC 3A8KA 1TWFC 4O2DA 2R7ZA 3GTGC 1BJTA 1K83K 1ED8A 2ANHA 2E2HC 2GSNA 4A3JK 3BDGA 1IW7A 3N0CA 3TFJA 3A8JA 4XCHA 2E2IA 2P5MA 3GEEA 4BBSK 2XCQA 4C2MK 3MK1A 1I3QA 1TWCC 1E2SP 3GDZA 2E2IK 1I50C 4A93K 3T01A 3GTGK 1K83C 4GTBA 4C3HK 3HOXC 4A3BC 2W5RA 2NVQC 2Y0SL 4GTYA 1I3QK 4Y7NK 3HOYK 1O29A 1XXBA 1Y1WC
chains in the Genus database with same CATH topology
3Q3QA 1ED9A 5GOVA 2IUCA 2D1GA 2GSOA 4LR9A 1KHLA 3M8WA 4N7TA 3M7VA 4B56A 1KHNA 1B8JA 3KD8A 4GTWA 1P49A 4KM4A 1Y6VA 3M8YA 1EW2A 1KHJA 3NKMA 1EW8A 4LRFA 1FSUA 5LRMA 4YR1A 3LXQA 3NKQA 5EGEA 1N2KA 4LR2A 1E33P 2W8SA 3IDDA 1KH9A 2GA3A 2W5QA 3MK2A 4LRAA 4KAVA 3NVLA 4LQYA 4UPHA 2RH6A 1O98A 3ED4A 1ZEDA 3UO0A 3UN3A 1K7HA 4UPLA 2GLQA 1ELYA 3BDGB 3NKNA 3UNYA 1E1ZP 2VQRA 1E3CP 1N2LA 2ZKTA 1HDHA 3MK0A 4CXUA 1AJAA 5KXAA 1EW9A 3CMRA 4UORA 3E2DA 1URAA 3DYCA 4UPIA 3B5QA 2X98A 3UN5A 4LR7A 4FDJA 4LRBA 1ELZA 3T00A 4UOPA 5K4PA 1O99A 1SHQA 3WAVA 4CXSA 3WAWA 5LIAA 1ZEBA 5C66A 1KH7A 3WAYA 3NKPA 2IFYA 1EJJA 4ZG9A 5IJSA 3A52A 4MIVA 1ALHA 3SZYA 5IJQA 3T02A 1ALKA 3SZZA 3BDHA 2W5SA 1AJCA 1ZEFA 3DPCA 1EQJA 3WAXA 1HJKA 2IUCB 5L0EA 2W5TA 4KJDA 5INHA 3OT9A 2W5VA 4CYRA 5TJ3A 1URBA 4ZG7A 1AJBA 4UOOA 4ZGAA 2QZUA 3TWZA 5HRTA 2XRGA 2W5WA 1KHKA 1Y7AA 4FDIA 4NWJA 2W8DA 5DLWA 5L0BA 3TX0A 3TG0A 5EGHA 1SHNA 2GSUA 1AUKA 5DLVA 4GTXA 1ED8A 4TN0A 2ANHA 2XR9A 5LRNA 4QAXA 2GSNA 4GTZA 3BDGA 4CXKA 2W5XA 4KJGA 5GRRA 3WBHA 5LQQA 4MHXA 3NKOA 1AJDA 4LRCA 4UPKA 1ELXA 1HQAA 3NKRA 5DLTA 3BDFA 3MK1A 4LRDA 1ANJA 3M8ZA 2G9YA 1ALJA 1E2SP 4MY4A 1ALIA 3T01A 1EI6A 4CYSA 4LR8A 4LREA 5AJ9A 4ZG6A 1ANIA 2W5RA 3IGYB 3UN2A 1KH5A 3IGZB 4GTYA 4NWXA 1KH4A 5L0KA 4KAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3Q A;  1ED9 A;  5GOV A;  2IUC A;  2D1G A;  2GSO A;  4LR9 A;  1KHL A;  3M8W A;  4N7T A;  3M7V A;  4B56 A;  1KHN A;  1B8J A;  3KD8 A;  4GTW A;  1P49 A;  4KM4 A;  1Y6V A;  3M8Y A;  1EW2 A;  1KHJ A;  3NKM A;  1EW8 A;  4LRF A;  1FSU A;  5LRM A;  4YR1 A;  3LXQ A;  3NKQ A;  5EGE A;  1N2K A;  4LR2 A;  1E33 P;  2W8S A;  3IDD A;  1KH9 A;  2GA3 A;  2W5Q A;  3MK2 A;  4LRA A;  4KAV A;  3NVL A;  4LQY A;  4UPH A;  2RH6 A;  1O98 A;  3ED4 A;  1ZED A;  3UO0 A;  3UN3 A;  1K7H A;  4UPL A;  2GLQ A;  1ELY A;  3BDG B;  3NKN A;  3UNY A;  1E1Z P;  2VQR A;  1E3C P;  1N2L A;  2ZKT A;  1HDH A;  3MK0 A;  4CXU A;  1AJA A;  5KXA A;  1EW9 A;  3CMR A;  4UOR A;  3E2D A;  1URA A;  3DYC A;  4UPI A;  3B5Q A;  2X98 A;  3UN5 A;  4LR7 A;  4FDJ A;  4LRB A;  1ELZ A;  3T00 A;  4UOP A;  5K4P A;  1O99 A;  1SHQ A;  3WAV A;  4CXS A;  3WAW A;  5LIA A;  1ZEB A;  5C66 A;  1KH7 A;  3WAY A;  3NKP A;  2IFY A;  1EJJ A;  4ZG9 A;  5IJS A;  3A52 A;  4MIV A;  1ALH A;  3SZY A;  5IJQ A;  3T02 A;  1ALK A;  3SZZ A;  3BDH A;  2W5S A;  1AJC A;  1ZEF A;  3DPC A;  1EQJ A;  3WAX A;  1HJK A;  2IUC B;  5L0E A;  2W5T A;  4KJD A;  5INH A;  3OT9 A;  2W5V A;  4CYR A;  5TJ3 A;  1URB A;  4ZG7 A;  1AJB A;  4UOO A;  4ZGA A;  2QZU A;  3TWZ A;  5HRT A;  2XRG A;  2W5W A;  1KHK A;  1Y7A A;  4FDI A;  4NWJ A;  2W8D A;  5DLW A;  5L0B A;  3TX0 A;  3TG0 A;  5EGH A;  1SHN A;  2GSU A;  1AUK A;  5DLV A;  4GTX A;  1ED8 A;  4TN0 A;  2ANH A;  2XR9 A;  5LRN A;  4QAX A;  2GSN A;  4GTZ A;  3BDG A;  4CXK A;  2W5X A;  4KJG A;  5GRR A;  3WBH A;  5LQQ A;  4MHX A;  3NKO A;  1AJD A;  4LRC A;  4UPK A;  1ELX A;  1HQA A;  3NKR A;  5DLT A;  3BDF A;  3MK1 A;  4LRD A;  1ANJ A;  3M8Z A;  2G9Y A;  1ALJ A;  1E2S P;  4MY4 A;  1ALI A;  3T01 A;  1EI6 A;  4CYS A;  4LR8 A;  4LRE A;  5AJ9 A;  4ZG6 A;  1ANI A;  2W5R A;  3IGY B;  3UN2 A;  1KH5 A;  3IGZ B;  4GTY A;  4NWX A;  1KH4 A;  5L0K A;  4KAY A; 
#chains in the Genus database with same CATH topology
 5GOV A;  1XZQ A;  3PO3 C;  2JA8 C;  4MEX A;  3S16 K;  3H3V L;  4J3N A;  1B8J A;  3ORE A;  3GTK C;  5M5Y K;  5IYB C;  3KD8 A;  3HOX K;  5IYD K;  1YNN A;  1EW2 A;  5D4D A;  3HOY C;  2EBB A;  4BBR K;  1L0W A;  3L4J A;  1INN A;  3G4C A;  4KMA A;  3IDD A;  1KH9 A;  1IQ0 A;  2GA3 A;  2W5Q A;  3LAP A;  5IYD C;  1O28 A;  1BS2 A;  3TTG A;  3S2H K;  5E68 A;  1O98 A;  2JA6 C;  3UN3 A;  5JFE A;  3S1Q C;  3BDG B;  3UNY A;  4A3D K;  2VQR A;  1N2L A;  4P9S A;  1RU0 A;  3S15 C;  1HDH A;  4CXU A;  1AJA A;  1VH2 A;  3GTJ C;  3E2D A;  3AH5 A;  3HOU C;  5TMF A;  2A69 A;  3S1M K;  3B5Q A;  1USO A;  5IP9 K;  4GTC A;  3GTL C;  3RZO C;  4QJV B;  4C3I K;  1I6H C;  3HOW C;  3GTK A;  3I4M K;  1O99 A;  1YCL A;  4CXS A;  3WAW A;  4G7Z A;  1ZEB A;  2A6H A;  2NVX K;  3CAG A;  1Y1W A;  4AH6 A;  1KH7 A;  4OIN A;  3NKP A;  2V6U A;  1EJJ A;  1I50 K;  1ZYR A;  2YU9 C;  4OIQ A;  4GTE A;  3A52 A;  3S1M C;  4G0U A;  3V4G A;  1I50 A;  4MQ9 A;  4XSX A;  2JA7 C;  4KM8 A;  5CHP A;  3WAX A;  2IUC B;  2O5J A;  1XPP A;  3S15 K;  5L0E A;  4WIL A;  1Y1V K;  5INH A;  3M3Y C;  1HI9 A;  2CW0 A;  3AD9 C;  1JOE A;  4Q4Z A;  4MEY A;  3TWZ A;  3OEP A;  2E2H A;  2W5W A;  3M4O C;  4FDI A;  2JH3 A;  3TG0 A;  3TX0 A;  2NVT C;  4A3J C;  2GSU A;  3ERE D;  4GTX A;  1J6X A;  4KMH A;  4GTZ A;  3GEH A;  1WQG A;  4MHX A;  2JA5 K;  4LRC A;  1WCM C;  4A93 C;  1HQA A;  3HKZ L;  3BDF A;  1EH1 A;  4GT9 A;  1ANJ A;  4OIP A;  4A3C C;  1ALJ A;  2RGR A;  1SMY A;  5M3M K;  4G0W A;  2NVX A;  5IOT A;  2YU9 A;  1Y1W K;  1O26 A;  5C4J C;  3IGY B;  3VA7 A;  4A3F K;  3S14 C;  4KAY A;  3LAJ A;  3G4A A;  1O2B A;  4N7T A;  4LR9 A;  1KHL A;  4KM9 A;  1TWG A;  1TWH A;  2R7Z C;  3HOV K;  5IOR A;  1P49 A;  5M3F K;  3QX3 A;  1J6V A;  2XCO A;  1O24 A;  4GTD A;  3GTM A;  4KAT A;  4YFK A;  1TWA K;  4YG2 A;  4LRF A;  1FSU A;  2VUM K;  4BXX K;  4YR1 A;  2WB1 L;  3GSI A;  3GTO C;  5EGE A;  3FKI C;  3OPF A;  1I6V A;  1ZXO A;  4LLG A;  2W7V A;  4BBR C;  3MK2 A;  4LRA A;  4KAV A;  3MML B;  3NVL A;  4LQY A;  2GAH C;  2R7Z K;  1WQF A;  2PHC B;  3S1Q K;  4UPH A;  3S1N K;  3HOZ C;  4GTL A;  5FLM K;  3M3Y K;  1AB4 A;  2PMZ L;  2R92 C;  3ED4 A;  5C44 K;  1ZED A;  4GZY A;  4UPL A;  1F9N A;  2BE5 A;  1SFO K;  4LJZ A;  2ZKT A;  5M5X K;  3A8I A;  5C4X K;  3H3V D;  1SFO A;  3CMR A;  4UPI A;  3HOV C;  3S1N C;  3AQP A;  4KMU A;  3UN5 A;  4KMD A;  4OIO A;  2PA8 L;  3TFI A;  1ELZ A;  4GTA A;  4P5B A;  3T00 A;  2ZUE A;  1B4B A;  4UOP A;  3GTO K;  5M5W K;  3FKI K;  3JST A;  2B63 C;  3RZO K;  2JA7 A;  3AQO A;  5LIA A;  4BY1 K;  2A6E A;  3GTO A;  3FKI A;  3RZD K;  4Y52 K;  4LOW A;  1F93 A;  5IJS A;  2JA7 K;  1WSV A;  2Y3P A;  3K7A C;  4DDQ A;  4MIV A;  4A3L C;  3SZY A;  4A3F C;  2R92 K;  3GTM C;  2WAQ D;  3S2D C;  4WJ4 A;  1ALK A;  3SZZ A;  4KAW X;  2W5S A;  4KC6 A;  3DPC A;  2E2I C;  1VLO A;  1G51 A;  1ZQ1 C;  3H0G K;  2D6F C;  1TWF K;  2NVQ K;  3OT9 A;  4Y7N C;  1PJ6 A;  1WOO A;  4Y52 C;  3RZD C;  4G0V A;  1TWF A;  5HRT A;  1UV7 A;  1Y1V A;  2P8T A;  1TWA C;  1XZQ B;  1Y7A A;  1DD5 A;  4PAA A;  5JVO A;  4WJ3 M;  1JQW A;  4C2M C;  2PPB A;  5DLV A;  4C3J K;  4KB2 A;  2GAG C;  4TN0 A;  2XR9 A;  5LRN A;  5IP9 C;  2B63 A;  2JA6 A;  3GTL K;  4JK1 A;  2W5X A;  3WBH A;  5LQQ A;  3I4N K;  3I4M C;  1PJ5 A;  3NKO A;  1ZBS A;  1AJD A;  3K7A K;  1WSR A;  5C44 C;  1BGW A;  2Y0S D;  3NKR A;  5DLT A;  4C45 A;  1XZP B;  3PO2 K;  4LRD A;  3M8Z A;  1SFO C;  2G9Y A;  4FM9 A;  1ALI A;  4ZG6 A;  1EI6 A;  4CYS A;  4LR8 A;  5AJ9 A;  1YX2 A;  2PMZ D;  3BP3 A;  3IGZ B;  5L0K A;  1KH4 A;  1IE0 A;  1O25 A;  3AD8 C;  3AD7 C;  1R9T K;  3I4N C;  2NVY A;  3Q3Q A;  4BY7 K;  2R93 A;  1WOP A;  2KWA A;  1ED9 A;  2IUC A;  2D1G A;  4B56 A;  4OIR A;  1KHN A;  2NVY K;  4GTW A;  4KM4 A;  1O2A A;  5FJ8 K;  5IOS A;  4A3G C;  4A3M C;  1Y6V A;  1KHJ A;  3NKM A;  3S1R K;  3M4O K;  3S17 C;  4ILD A;  3LPX A;  5LRM A;  1DCP A;  4A3E K;  3NKQ A;  4A3D C;  3GIR A;  3GTM K;  1TWC A;  1TWA A;  2W8S A;  5HL8 A;  2VUM A;  5FLM C;  1V5V A;  4QIW L;  1C0A A;  3HOU K;  1VGX A;  4A3G K;  3GTL A;  3S0X A;  1F7U A;  3UO0 A;  4LK0 A;  1BDF A;  5IP7 K;  1J6W A;  2E2J K;  4C3I C;  1I6H K;  1ELY A;  2JA5 A;  2CFA B;  1E3C P;  4BLA A;  4G7H A;  3GTP C;  3EQL A;  3MK0 A;  1O2F B;  2NVX C;  4A3I K;  1GE9 A;  2YU9 K;  1URA A;  3DYC A;  5IOQ A;  1ISE A;  4LR7 A;  1R9T A;  4KAR A;  4FDJ A;  1EQR A;  5K4P A;  3TFH A;  4XLN A;  4PAB A;  3WAV A;  3GTP K;  1TWH K;  2R93 C;  5C66 A;  4A3L K;  3L4K A;  2V6S A;  4X6A K;  3FOE A;  3GTP A;  3BP8 C;  3GTQ K;  2JA5 C;  3FOF A;  4BY1 C;  2ZFZ A;  3NUH A;  3S2H C;  3T02 A;  1VRQ C;  3FHZ A;  1B4A A;  3GEI A;  3GTQ A;  1AJC A;  1ZEF A;  1EK8 A;  2R92 A;  3HKZ D;  1O27 A;  5IYC K;  2W5V A;  3N3Y A;  4A3I C;  4CYR A;  5TJ3 A;  4QJV A;  5IYB K;  1URB A;  4ZG7 A;  4KDD A;  2QZU A;  1J98 A;  2XRG A;  1KHK A;  1K83 A;  2W8D A;  5L0B A;  5C4X C;  1DCH A;  1SHN A;  4AYB D;  1AUK A;  1XXA A;  4BLB A;  1Y1V C;  1EFW A;  4QAX A;  5C4J K;  4CXK A;  3S14 K;  5GRR A;  4KJG A;  4UPK A;  4GFQ A;  2B63 K;  2JA6 K;  1ELX A;  1WOS A;  4C3H C;  4A3B K;  3GTJ A;  4MY4 A;  5TMC A;  1VJE A;  1PJ7 A;  4LRE A;  1ANI A;  2ZUF A;  4M1X A;  3UN2 A;  1IBA A;  1KH5 A;  1XZP A;  3GTJ K;  4NWX A;  3GTK K;  2GSO A;  3H0G C;  3M8W A;  1WCM A;  2XCR B;  3M7V A;  1R9T C;  2NVT K;  5L46 A;  4A3C K;  1WIH A;  3H0G A;  4G7O A;  4ZH4 A;  3IPJ A;  4Q5S A;  3M8Y A;  4X6A C;  1EW8 A;  4KN7 A;  4YFX A;  3N0B A;  3LXQ A;  4A3K K;  1KQ4 A;  4A3M K;  1N2K A;  4LR2 A;  1JVI A;  3S1R C;  1E33 P;  1ZVU A;  4KN4 A;  4QIW D;  2FQO A;  3CQZ K;  2RH6 A;  3ADA C;  5IYC C;  3HXA A;  2V6T A;  1WOR A;  4BBS C;  4RMF A;  2VUM C;  4BXX C;  1K7H A;  2GLQ A;  3CQZ A;  3NKN A;  1E1Z P;  1IL2 A;  1USM A;  4YFN A;  1HQM A;  5IP7 C;  2WAQ L;  2E2J C;  5KXA A;  1EW9 A;  1I3Q C;  1XXC A;  4UOR A;  3CQZ C;  2WB1 D;  3HOW K;  3HOZ K;  3BUE A;  4BY7 C;  3PO3 K;  2A68 A;  2FQT A;  2CFA A;  2X98 A;  3S16 C;  3S2D K;  4LRB A;  1TWH C;  2R93 K;  4NOI A;  4AYB L;  1SHQ A;  1TWG C;  5CJ9 A;  2NVY C;  1WCM K;  4A3E C;  4KB4 A;  4XSZ A;  4C3J C;  3GTQ C;  2O5I A;  5C3E K;  3GTG A;  1IS1 A;  4GTF A;  3WAY A;  2PA8 D;  3S17 K;  2IFY A;  4ZG9 A;  4P5A A;  1ALH A;  5IJQ A;  3BDH A;  1TWC K;  1TWG K;  1EQJ A;  1HJK A;  2W5T A;  5C3E C;  2E2H K;  4KJD A;  1YNJ A;  1X31 C;  4KAS A;  1F7V A;  3WOD A;  1AJB A;  1DCO A;  4FZB A;  4UOO A;  4BKW A;  2JA8 K;  4ZGA A;  4LK1 A;  1WQH A;  4NWJ A;  5DLW A;  5EGH A;  3DXJ A;  4XLP A;  3PO2 C;  4A3K C;  3A8K A;  1TWF C;  4O2D A;  2R7Z A;  3GTG C;  1BJT A;  1K83 K;  1ED8 A;  2ANH A;  2E2H C;  2GSN A;  4A3J K;  3BDG A;  1IW7 A;  3N0C A;  3TFJ A;  3A8J A;  4XCH A;  2E2I A;  2P5M A;  3GEE A;  4BBS K;  2XCQ A;  4C2M K;  3MK1 A;  1I3Q A;  1TWC C;  1E2S P;  3GDZ A;  2E2I K;  1I50 C;  4A93 K;  3T01 A;  3GTG K;  1K83 C;  4GTB A;  4C3H K;  3HOX C;  4A3B C;  2W5R A;  2NVQ C;  2Y0S L;  4GTY A;  1I3Q K;  4Y7N K;  3HOY K;  1O29 A;  1XXB A;  1Y1W C; 
#chains in the Genus database with same CATH homology
 3Q3Q A;  1ED9 A;  5GOV A;  2IUC A;  2D1G A;  2GSO A;  4LR9 A;  1KHL A;  3M8W A;  4N7T A;  3M7V A;  4B56 A;  1KHN A;  1B8J A;  3KD8 A;  4GTW A;  1P49 A;  4KM4 A;  1Y6V A;  3M8Y A;  1EW2 A;  1KHJ A;  3NKM A;  1EW8 A;  4LRF A;  1FSU A;  5LRM A;  4YR1 A;  3LXQ A;  3NKQ A;  5EGE A;  1N2K A;  4LR2 A;  1E33 P;  2W8S A;  3IDD A;  1KH9 A;  2GA3 A;  2W5Q A;  3MK2 A;  4LRA A;  4KAV A;  3NVL A;  4LQY A;  4UPH A;  2RH6 A;  1O98 A;  3ED4 A;  1ZED A;  3UO0 A;  3UN3 A;  1K7H A;  4UPL A;  2GLQ A;  1ELY A;  3BDG B;  3NKN A;  3UNY A;  1E1Z P;  2VQR A;  1E3C P;  1N2L A;  2ZKT A;  1HDH A;  3MK0 A;  4CXU A;  1AJA A;  5KXA A;  1EW9 A;  3CMR A;  4UOR A;  3E2D A;  1URA A;  3DYC A;  4UPI A;  3B5Q A;  2X98 A;  3UN5 A;  4LR7 A;  4FDJ A;  4LRB A;  1ELZ A;  3T00 A;  4UOP A;  5K4P A;  1O99 A;  1SHQ A;  3WAV A;  4CXS A;  3WAW A;  5LIA A;  1ZEB A;  5C66 A;  1KH7 A;  3WAY A;  3NKP A;  2IFY A;  1EJJ A;  4ZG9 A;  5IJS A;  3A52 A;  4MIV A;  1ALH A;  3SZY A;  5IJQ A;  3T02 A;  1ALK A;  3SZZ A;  3BDH A;  2W5S A;  1AJC A;  1ZEF A;  3DPC A;  1EQJ A;  3WAX A;  1HJK A;  2IUC B;  5L0E A;  2W5T A;  4KJD A;  5INH A;  3OT9 A;  2W5V A;  4CYR A;  5TJ3 A;  1URB A;  4ZG7 A;  1AJB A;  4UOO A;  4ZGA A;  2QZU A;  3TWZ A;  5HRT A;  2XRG A;  2W5W A;  1KHK A;  1Y7A A;  4FDI A;  4NWJ A;  2W8D A;  5DLW A;  5L0B A;  3TX0 A;  3TG0 A;  5EGH A;  1SHN A;  2GSU A;  1AUK A;  5DLV A;  4GTX A;  1ED8 A;  4TN0 A;  2ANH A;  2XR9 A;  5LRN A;  4QAX A;  2GSN A;  4GTZ A;  3BDG A;  4CXK A;  2W5X A;  4KJG A;  5GRR A;  3WBH A;  5LQQ A;  4MHX A;  3NKO A;  1AJD A;  4LRC A;  4UPK A;  1ELX A;  1HQA A;  3NKR A;  5DLT A;  3BDF A;  3MK1 A;  4LRD A;  1ANJ A;  3M8Z A;  2G9Y A;  1ALJ A;  1E2S P;  4MY4 A;  1ALI A;  3T01 A;  1EI6 A;  4CYS A;  4LR8 A;  4LRE A;  5AJ9 A;  4ZG6 A;  1ANI A;  2W5R A;  3IGY B;  3UN2 A;  1KH5 A;  3IGZ B;  4GTY A;  4NWX A;  1KH4 A;  5L0K A;  4KAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...