3TE6A

Crystal structure of the s. cerevisiae sir3 aaa+ domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
304
Chain Sequence
PNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELMDALYEKIWFAISKENGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein SIR3
publication title Structural basis for the role of the Sir3 AAA+ domain in silencing: interaction with Sir4 and unmethylated histone H3K79.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 88
structure length 304
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17872 AAA_lid_10 AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3te6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3te6A01
5KYKA 1JR3A 1DS6A 3TKLA 4DCUA 4L4UA 3TBKA 3ICEA 4MGIR 2D7DA 1AJEA 1E2LA 5B2ZA 3IHWA 1ZU4A 4LBYA 4JYCA 3ADDA 3DEFA 5H1YA 5JSZA 2P6UA 1Z47A 5CK4A 3OIUA 3V9PA 4R98A 4DSUA 1S96A 2LWIA 4Q7KA 4FMBB 1FPMA 3UATA 5BWMA 1HQCA 4MA4A 3T61A 1K6MA 3GEIA 1NN0A 3QF4B 5TB5A 2XGJA 2IYVA 1TU4A 2ZI5A 3SJBA 1ZW6A 2X2EA 2PX3A 1RYHA 4LYAA 2GVDC 4TYPA 3SZRA 4RD1A 4BFZA 3Q3JB 4DCVA 2A5DA 3REFA 3T1QA 2QQEA 3D31A 3UIEA 4MITA 3OE7A 2NIPA 2IUTA 1RFLA 3GFOA 3NDPA 2ZUBA 4P31A 1G4AE 1ZM4A 1US8A 2ZJ2A 2QU8A 5AR1A 2R9VA 5HR5A 1IJEA 4RD2A 5BYKA 4C7OA 3DOEA 2QMOA 5BW8A 4MKIA 3KQKA 4A2QA 2GCOA 3BB1A 4JMPA 3KJGA 2ANCA 2JEOA 2HUPA 2ZIAA 4MQBA 4OQLA 5FUXA 421PA 2B7CA 1E2DA 2CDNA 2KWIA 3LWNA 1S9DA 1H8ED 3LQRA 2OCAA 1ESNA 1GAJA 1TNDA 4QGAA 4IOKA 1Z06A 2ZSFA 1FW6A 5EE3A 5GJWC 2G0NA 2FNAA 2FF7A 4DC9A 1F5NA 4IDHA 1P3JA 2PZEA 4M8NE 2QPAA 5E7IA 3R7WB 2Z0MA 2BWJA 4PHHA 1F2UA 4P3YA 2KSQA 2FJUA 4L9SA 1KSGA 1IN4A 1EX6A 1D5CA 3WYGA 4BRUA 1XJQA 2BOVA 2BM0A 4BZPA 5F3WB 1CS4C 3U7EB 3WP0A 4AC9A 1RPZA 1AZSC 4RFVA 2OBMA 2C04A 2QORA 3TGPA 5JRJA 3EZFA 4CDGA 3D3QA 3VX4A 4J0QA 1Q1QA 3KJHA 3ZVNA 3LW7A 5F9FA 2BHRA 1DARA 3RAPR 1RC8A 1NY5A 3SDZA 4NU0A 1JNYA 1Z0DA 3DKVA 1HH4A 4LJ9A 1FX0B 2DFTA 3VU9B 1OYWA 4HAVA 2ZS7A 2RHMA 1X1RA 3AF3A 4LHYA 1CJTC 2CK3A 5K8LA 5FTLA 3MJHA 4BLSA 3T15A 3DDCA 2BMFA 2OHFA 3BD9A 2QUZA 2ZYUX 2G6BA 3WBJA 1UAAA 4ZO4A 4MGKR 2RB4A 2ZTSA 1YZGA 3SYKA 3AVWA 3NC0C 2NO9A 3GD7A 2DY1A 3R9XA 1KK1A 4QNMA 3B8HA 1L7VC 5FR2A 4OBEA 2N42A 1Y63A 2CHGA 2QMUA 3EIEA 4EJSC 2C95A 2WPDD 3WHLA 2O8DB 2ZRNA 3N70A 5KTYA 1ZCAA 1OH8A 2QG6A 5FOTA 2GZAA 2IEYA 2C96A 1C1YA 2O8DA 3A37A 4DZZA 1JALA 1G3QA 3CO5A 3BRWD 1N6HA 3LBNA 4NONA 5K8TA 2IS1A 4GOJA 4TL6A 1MT0A 3QSYA 4LYJA 2OSBA 3GJ0A 5FOXA 3SS8A 3SJZA 4KV9A 4NCHA 2YKGA 4GRAA 4C0LA 2JLZA 4Z8YA 5JHHB 3P20A 5BN4A 2IS6A 2RGEA 2YC4C 1Z6GA 1T9HA 3RSLA 1L4YA 1FOEB 4IDOA 3LH5A 4V0MA 2WJHA 1XP8A 4UNNA 1JAHA 1AKEA 5EE5B 2IUSA 4L5BA 4HZIA 2W2XA 1IAQA 4XWKA 3IEVA 1KHTA 5EQTA 4I81A 2GILA 3CPJB 2HCBA 5BN5A 2NG1A 1XPOA 4TZ0A 4GPTA 3THOA 1EGAA 4LYFA 1YR7A 1W47A 1G8GA 3GLHB 4FINA 2REBA 4AYXA 1NVWQ 3NH9A 3UWKA 3WHKA 4DEYA 1YZKA 3MCAA 2N1BA 1YR6A 2OBNA 2GJSA 2XTNA 2ONJA 4TLCA 3KB2A 3K0CA 3TQFA 1COWA 1QRAA 4I1SA 4WBSA 3X1YA 4US0R 1S9HA 1XTSA 2W6IA 3CF6R 1TADA 4LWZA 4MRSA 4RKEA 5J4YA 4HLUC 2ZQ5A 1PLKA 3BORA 2AL7A 4LV5B 4RZXA 1DADA 5FPTA 2JLQA 2RMKA 2G88A 3ND9A 2EFHB 1II8A 1XMIA 2IUUA 2FV8A 4O3MA 3KJIA 2JLVA 3LLUA 4PO8A 1Y3AA 4BLOA 1W36C 4PC7A 3LVQE 3W8RA 3SQWA 1EFRD 4JL6A 5G53C 3DKPA 3DM9B 1Z07A 4EJSB 3CB4A 1P9WA 3DMNA 1G3RA 2J45A 1Z3IX 2NO6A 4DHEA 1U0JA 3FMFA 1KO1A 4C0SA 3WY9A 4AG5A 4EUNA 4Q9KA 1OB2A 3BJIC 1N0VC 3RRYA 3SI7A 2IYLD 2XOKA 1VIAA 1Q1EA 2HYDA 1GM5A 3Q8XB 4M1SA 4V0LA 3E70C 4I1VA 3SFZA 1KO7A 1ZUIA 1E1QA 3QI2A 4JSTA 2R6DA 2WIBA 3RSOA 4B75A 4B71A 3ICQB 4OK5A 3U7FB 1W7AA 4B34A 4QBGB 1JXOA 1OIVA 1EFUA 2O52A 3QBTA 3VHLB 2R6CA 4WOPA 3U5ZB 1KNXA 2JJ2A 4TWZA 2XITA 4PZZA 1JPJA 1G3MA 3MG9A 4HUTA 4TTPA 2OBLA 2PJRA 2JLWA 1XD2B 4B2LA 5KNDA 1MR3F 4QG7A 1MOZA 3LAWA 1XTJA 4BASA 1GNQA 1M7GA 2JDIA 2ZSEA 1W4CA 4B3BA 2IWHA 3QOFA 3TR0A 2OEPA 2IYRA 4KO8A 3A4MA 4XH9B 1SVWA 1W4BA 1CEEA 3FKQA 2FEMA 2OCPA 3P4XA 2D06A 1G6OA 1D9XA 1TF2A 3HU1A 3PEUA 1E6CA 2FSGA 2QGNA 3JVUA 4NP6A 4BUJA 3KFVA 4QOSA 1S0UA 3U60B 4KFTA 2HXYA 3TLXA 3GLHA 4QJ4A 1Q20A 2H57A 1DAGA 2V6IA 2OLKA 3QF7A 4DLTA 1ZM2A 2PT5A 3QVVA 3CRRA 2F1HA 4BZXA 4CEJB 2RGCA 1W48A 2IYZA 4Q1BA 1B0UA 3AVXA 4U00A 4V0OA 3GEHA 2OILA 4ITRC 2CL7X 1AQUA 4G3XA 1H8HD 4MKFA 4OK3A 621PA 4BEBA 3RNLA 2HYIC 2IYTA 2QTVB 3AH8A 4V0NA 4C4PA 1R6BX 3EZ6A 4JVSB 4ZCLA 3BXZA 2PBRA 4IEIA 5AJWA 2GA8A 2BJVA 3ZZTA 3BWDD 2K5UA 3K0AA 3ADKA 2PL3A 3CH4B 3NBYC 4CVNA 3J81k 1KY3A 4JBWA 2FDCA 4DDWA 4Q4AB 4CEJA 2ZI4A 3ZD7A 4GI7A 4FD2A 1WBBA 2O8EB 3A8TA 3IPYA 2FG5A 4Q4AA 3RC8A 1VG1A 4D0NA 5H8WA 1TL7C 3H4MA 2QT1A 1YKSA 4LCBA 4M1WA 1UF9A 1KDPA 3L8ZA 4EAQA 5KDOA 4G5OA 5KPDA 2MSDB 3BK7A 1W44A 4CEIA 3SNHA 4A1FA 1UDWA 3QEJA 2QE7A 1IN7A 4B35A 2ZXUA 1VG9B 1E2PA 1ZD1A 1MO3A 3LFUA 2J7PA 2J7PD 4LHWA 2C03A 3K9NA 1M6NA 4BWYA 1KJZA 2WVJA 1G7SA 4Y0AA 1HUQA 1IOZA 3I8XA 5LBIA 4JLOA 2J0SA 4DSTA 3SJAA 2DFNA 1JEEA 2PMKA 3RDPA 3ZVMA 2AWOA 2QT0A 1FUKA 2I4IA 2BCGY 1M2OB 2KB0A 2D7CA 1E4YA 2GJAA 1UBFA 1KI6B 3SEAA 2ZYTX 4Q1CA 4BQSA 2Q9CA 2EFGA 3CF2A 1IONA 1UPTA 3HP1A 3MSXA 4NKRA 1VTKA 2VF8A 5C2JB 1NF3A 1XMJA 2JLSA 4LJ8A 4B3GA 2GK7A 2QAGC 2KBFA 3THXA 2JLXA 4LV6A 3R7WA 3N2EA 1BS1A 1KOFA 2JATA 3PUYA 1LY1A 1TF7A 5LDDC 1DO0A 1NLZA 1UKZA 5TDHA 5B58C 2N46A 2UKDA 1J70A 2R65A 3IDQA 4HZUB 4W5JA 4K8OA 4LY6A 1G3UA 2VQSA 4DXAA 4Z54A 3UK6A 5CLLA 4AD8A 5AUOB 3R9WA 1WXQA 4MKHA 1GL9B 5HE9A 1ZC4A 5GVRA 1QHSA 1FUUA 1E9RA 1XCGB 1A2BA 2ZANA 3C7KA 4GFDA 2IHYA 3T34A 3U3JA 1E9EA 4L15A 5JRZA 1T8UA 4A8JB 3KQUA 3WYAA 4MDFA 3AF1A 2WJVA 1G20E 3FFAA 2F43A 4DUGA 5G40A 1P72A 4O25A 4FN5A 2C77A 4BLPA 2G0TA 4G01B 1EK0A 1NVVR 3W3AA 1VPLA 2P3SA 1IXZA 1AS2A 2WM9B 3CONA 4GT1A 4LHZA 2IXGA 1I2MA 2EWVA 4O2LA 1ZIOA 1ZCBA 4ESVA 2OZEA 2HXSA 2ZPTX 3IGFA 3SC3A 4FCVA 3RS5A 2QAGB 2VSXA 4M1TA 2Q6TA 2XTZA 1N5JA 2VF7A 4B3DA 1ZAKA 2DYKA 1ZIPA 3C4JA 1CJMA 3TSZA 4DT1B 1ZNWA 2JJ1D 2AKAB 1OFHA 2ORVA 2IL1A 2FFBA 2C98A 3IHLA 1E94E 2FZLA 2OESA 4F92B 3AF0A 3B1WA 4ZCIA 3BBPA 3W6NA 3CRW1 1L8QA 4RFSB 4M1KA 4KVGA 2ZSDA 3A1UA 1E2MA 2ZAOA 2GWHA 2WBLC 2ZI7A 6Q21A 1KI6A 1GRNA 4DB2A 2JASA 2WICA 2OXRA 3QY0A 4A0RA 2OFOA 3L0PA 5FOSA 3CIOA 1CJKC 1G41A 3ZYCA 4ZCMA 4AKHA 1GKIA 2O8CA 1N6RA 1YR8A 1U9IA 2NO7A 1E9SA 2YOFA 4OQXA 5IDVA 4AI6A 1G7CA 2HJVA 1JR3E 4E5UA 1OB5A 1AN0A 1Q1ZA 5E95A 4LHXA 2HF8A 4PHGA 4FWTA 2GJ8A 5JI3E 1V43A 1VECA 5DHFA 2B7BA 2D2EA 1HA3A 4KLZA 3ZIAA 2F1RA 4DLYA 1CR2A 4OHWA 1D6JA 3Q85A 3VNUA 4A36A 2NZJA 2NPFA 1M7BA 4EPWA 3FTQA 2I1VB 2VEDA 2RGBA 1PUIA 3H2YA 4M53A 1TMKA 2D3WA 5FTJA 3FDIA 2H8KA 1M74A 1A1VA 2NMVA 1S3SA 2X19A 3B78A 3M0EA 1DVRA 1G8YA 4JJZA 1PV4A 2DWPA 2CXXA 2W6JA 4LX0A 4L9WA 1UBEA 1BO6A 1JR6A 3CWZA 1KNQA 1XTIA 1CP2A 2RGAA 4CF7A 3GLFA 3TSOA 4ACBA 2FFQA 3PUVA 3UKDA 1ZC3A 3EC1A 4HLQB 2W6JD 1Q12A 5FBVB 5FPSA 1KY2A 1U98A 3LW8A 2KE5A 5SZHB 5GJVC 1HURA 2XEXA 4LJYA 1SXJD 4V02A 1E2GA 2A5JA 3A58B 1K5GA 2WWWA 1RZ3A 3EPHA 1KK0A 3OEED 2NTYC 2FSIA 2CNWA 1JECA 1XXHE 2IYWA 1QDEA 3P26A 2ZJZA 1P73A 4LJAA 1ZU5A 3CNNA 1NLFA 5C4MA 1T91A 2RGNA 3EA5A 2O8BB 1YZTA 3EZ9A 1NJFA 3W5IA 4TYYA 3U2QA 2IF2A 1E2IA 3NWJA 1R10A 3X1WA 4EFLA 3K09C 1MO6A 1DOAA 4RD4A 3EAQA 2E9SA 3EA0A 5HKKD 1SVSA 2B8TA 3FOZA 4KJZA 2BC9A 1OXSC 3WYFA 2V3CC 5DYIA 1GNRA 1OIXA 2GRJA 2NO1A 4NYMR 5P21A 5HCIA 4G5SA 1VCOA 2O0HA 3H0KA 4PFSA 4A0HA 2VPPA 1SKYB 5A5GA 4TMVA 1YRAA 1Z63A 4LSGA 3U3KA 2IS4A 1CR0A 2Q9BA 1QHXA 1JI0A 1Z6YA 5KO2A 1L4UA 4P0TA 1P4SA 4OQFA 4TSFA 3ZS9A 4I1OA 4BFXA 4BGDA 3AVYA 1G5RA 3ECCA 1G5PA 2X8AA 1FTSA 3RRZA 2F1JA 2PEYA 4CT5A 1X8KA 3QPUA 5LPNA 2QE7D 1NVUQ 3Q7PA 2GNOA 3RS4A 1N2CE 2QPTA 4E09A 1NBME 1XD2A 3OAAA 2H17A 1F60A 2RHDA 2Z5FA 1W36B 2J59A 2BJWA 1QHYA 5KSYA 1QHGA 2D74A 4OL0A 3QKSA 5KOYA 2ORIA 2GJ9A 1EWRA 4A82A 4A0FA 2A78A 5KU1A 3QIAA 3I1FA 2WWGA 1YU9A 4TT3A 5AJZA 2UZIR 2RGXA 4PQYA 4DJTA 4Q18A 2IT1A 1E2NA 3M4YA 2MMGA 2ZVQX 1OHHA 4JVNA 5JSZB 3TAHA 3EXAA 3LBIA 4EJSA 2IYYA 1KGDA 1Z29A 2GCPA 2IF0A 2IYXA 4Q7LA 1PJRA 1KI8A 4W5WA 4N0DA 4M0LA 4JL5A 2XXAB 1CIPA 2PH1A 2BEKA 2FGJA 3AGPA 1ETUA 1GVNB 1NI3A 3X1ZA 2FFAA 2GK6A 1H8HA 1MABB 2PCJA 4D0GA 5K8IA 2ZITA 3PUWA 5A0FA 1IN6A 2AD1A 4Q7JB 2JAQA 4Q1AA 5DO9A 4JS0A 1G1MA 4C2UA 1NN5A 3OEHA 2V9PA 3WNCA 4TLDA 1S1CA 4QXAA 2MSCB 2WAYA 2IXFA 4MRRA 5AK0A 2ZJ5A 4IXNA 5SZJA 3GQBA 2ANBA 2RGDA 1LTQA 3KKNA 1G6HA 4TL7A 5CJ2A 5HCNA 2GXQA 2BBOA 1R8SA 3L8YA 4GZLA 2G1JA 1BMFD 4JLNA 4JVMA 4M2LA 1N6OA 3QVUA 3AGQA 5DISB 4URWR 4IFBA 4HLDA 2WWHA 5F98A 3K9LA 3UG7A 1UFQA 4YLGA 1YZUA 1TQ4A 3NC1C 4V03A 1OKKA 2LKCA 1NKSA 1JPNA 3C5HA 2C99A 1ZNXA 2ODEA 4PAMA 4TMKA 4F4CA 2ONKA 1G16A 4US1R 2DB3A 2ZI9A 2ZREA 3C5CA 2OG2A 4Q9IA 1E2QA 3AEZA 4U02A 2JJ1A 3KDSE 2REOA 3ETLA 3FHCB 3WRXC 1FQJA 1NG9A 3ZDQA 3HPQA 3W34A 1NLYA 3U3MA 4PPQA 4TQAA 4D26A 1SVLA 1P61B 2NPIA 4FMDF 3ADBA 2J1LA 3LXRA 3BIFA 3TJZA 3NBZC 5E4FA 2F9MA 4IDNA 1Z6AA 1P6XA 2IHBA 4FCTA 4IEEA 4M22A 4QGFA 4DLWA 3O8DA 5EP2A 1XNJA 1Z2AA 3NH6A 3GCGA 4MYHA 4D80A 4ZDJA 2QTHA 2XZOA 2H92A 2OUKA 4LYHA 4M9ZA 5TXGA 5EP1A 4Q21A 3HYTA 3AQ4A 3CH5A 3PG5A 3TAUA 4BZQA 3TUIC 3W8NA 2O8EA 1XD9A 4PSAA 4E03A 4B73A 3O8BA 5JHGB 2AD5A 2VBCA 4NDZA 4DSNA 4G5QA 3F0TA 8OHMA 2XB4A 3NHBA 4IFEA 4A2WA 4PX9A 4CT4B 1OH6A 1GKUB 3K70C 2AWNA 1S8FA 2CVHA 2KI5A 5CYOA 1SVMA 4K46A 2WIAA 4KBFA 1ZD9A 2GF0A 1WBDA 3FHOA 3MFYA 1F48A 4P4SB 2FH5B 2BBSA 4GMXA 2JLYA 3NIBA 1SZPA 3TIFA 2EW1A 2IWRA 1AM4D 3CBQA 4HUQB 3RABA 1ZBDA 1EFCA 4DCTA 3EPKA 2L0XA 4HB2A 3W9YA 1P2UA 1OH7A 4DUGD 1UJ2A 1X6VA 5E7JA 4HAUA 3F5FA 1QHIA 2WKRA 2ZRCA 3V4FA 2CK3D 5D3QA 2FX3A 2VP2A 3EZ2A 2VSOA 1ZD8A 2VYFA 3GMTA 4LGMA 5IK2A 4WW0A 2PEZA 4RZ2A 1E99A 3GFPA 3HR7A 3TW8B 3Q7QA 3M6AA 1XPUA 4YONB 3GJ4A 2OFXA 1JJVA 4XSGA 4NH0A 4Q9JA 5DHAA 3V4RA 1ONBA 4ARZA 2ZE5A 1A2KC 1ZNZA 1HV8A 2F55A 1W2HA 1X3SA 3PIRA 4CIDA 3PITA 4LPKA 2DWQA 1M8PA 5BQ5A 2ZRBA 4DSOA 4LBZA 5GJBA 1YZLA 4M21A 3SBDA 3DMDA 1CULC 4TSFD 4TMWA 1ANKA 1TX4B 3NKVA 1KMHA 2EU8A 3FKSA 1P75A 2CL0X 5EXTA 4OHZA 3PVSA 4A2PA 3RYTC 1KO5A 4JT4A 1KMHB 1CR1A 4IVQA 3A6PC 4L16A 3WMGA 4DLUA 1LB1B 3FHTA 5JI2E 5LB4A 1RRCA 1UKYA 3ZH9B 1LS1A 4C0AC 1SXJE 1AS0A 5JS7A 4RFSA 1U8ZA 3AM1A 5L3SA 2WOOA 2C9OA 5FR1A 1P9RA 3VKHA 4D6PA 5DE3A 1T3LA 4A4DA 2YHSA 1IHUA 1ZJ6A 3MRSA 5CB6A 1Z0FA 4RY2A 1G7TA 2VO1A 2ZVPX 3CZQA 4YMSA 2G3YA 3P27A 3ASYA 2V7QD 5L3QB 3B13B 2H16A 4S35A 1BMFA 3U44B 2QRNA 1NMXA 3KKQA 4UNSA 5EXPA 1DAKA 2NGRA 2ZE8A 1W0KA 3QE0A 2C2HA 3C8UA 4FMDB 3C14C 3KFXA 3MGCA 3K0FA 3NXSA 4QHTA 1ZNYA 3FMIA 3LA6A 2ZETA 1NL3A 1XPRA 1GOTA 3ZJYA 3PFIA 3EZ7A 2WZQA 3KXKA 1AQYA 3EW9A 3THYA 4JBYA 1KSHA 4HEJA 2PT7A 1J8MF 5EP3A 1L2TA 4WXRA 1AKYA 1KJYA 4NPHA 3QKSB 3WMFA 1Z08A 1DAHA 4AKEA 4YXWD 3CX6A 4UXJA 3Q5DA 4JKYA 2PX0A 3RS2A 4JL8A 4QC2A 2FPLA 4B32A 1LW7A 4PQFA 4GBMA 4RCYA 5JLJA 3GJ6A 2G77B 1FNMA 2ZRJA 3K0EA 2GTPA 4XVQA 5EUMA 4DIEA 4EQ6B 3CF0A 4YXWA 2A5GA 3AP2A 4MGYR 2VP6A 2WJGA 1GWNA 2I1QA 2YWEA 4KI0A 1R0XA 1E1QD 1LF5A 3ZQ6A 3K09A 3B7GA 1LS6A 3ZIAD 4D4LA 5FTMA 3QJYA 5DI9A 2IYQA 2W0MA 4G5GA 2HCJB 5TY0A 1AA9A 5CB8A 4D0LB 4F4IA 5JJKA 3VR4A 2R6AA 3LVRE 3GJ5A 1JJ7A 2CLCX 2Z83A 5DIFA 1SQ5A 3ASZA 3TW4A 3UMFA 3VQTA 4YQFA 1CXZA 1IN8A 4FMCF 3ZZ0A 4YMVA 5CK5A 3IIKA 4KVAA 1WP9A 3QKRA 1N6PA 1R5NA 2J3EA 2RGGA 4DB4A 1GDDA 1I4DD 3EASA 5JEDA 3B2EA 4GMDA 2ZUCA 3B9QA 1XCMA 2PJZA 2VTKA 4DLZA 3LNCA 3HU3A 2YOGA 1J8YF 3O8RA 3NEYA 2V1XA 3IQWA 1I4LD 3VR1A 4BFUA 4LBWA 4C0HA 4NHOA 3I32A 1NSTA 1OV4A 2ECKA 3MMPA 4GP6A 2OV2A 2WAXA 4RKFA 1II9A 2A7QA 4Q1EA 1XEFA 4CGZA 3MWJA 1Q22A 1N5LA 3PQCA 4L8GA 1T5IA 5KDLA 3LX5A 2BIFA 1EFTA 2WHXA 3THWA 2CCJA 2HLDD 4XIGS 3FMPB 4DDVA 2GXSA 4NCJA 3SHFA 2F6RA 1O3YA 2YINC 2XNDD 3W90A 4B44A 1CLUA 3BE4A 4Q9HA 5D3MA 1E96A 1TPZA 2GHIA 4WVFA 2YWGA 4N3NA 2WSMA 3EIHA 4Q1DA 3BOSA 4W9MC 1AGPA 1GZSA 2YC2C 2IXEA 5L3VA 1WF3A 5JMTA 3PUZA 1EXMA 1R0YA 1UEIA 4UJ3A 3BH7A 4URXR 1XDBA 4JLAA 3C15C 5IK2D 1XEXA 2JGNA 1U8YA 2B21A 3EX7C 4TYNA 2OM2A 1X1SA 2OAQ1 4N0EA 1Q1BA 1LVGA 3B85A 1SVOA 4A92A 3GEEA 3NTUA 2OCYC 1KZGB 1DEKA 1KMQA 2AFHE 4JLMA 3VFDA 2O8CB 4XWAA 3HDTA 1XD8A 2E87A 2X77A 1D8TA 3DO6A 2QL6A 2A3RA 4MUAA 4Z1MA 4DCNA 1NJGA 3FFBA 5JWHA 4LK2A 4LUCA 1E3MA 2ZRIA 3MWYW 4Q9LA 4PZLA 3X2SA 5L3RA 1CKEA 3IO3A 3SR0A 2FGKA 2IC5A 5JWRA 4Q01A 3ZZUA 1DO2A 4DRZA 3RLFA 1PLLA 2VP5A 2C5LA 4JKIA 4XOIA 2Q3HA 2O8FB 2PLRA 4HLUA 5IHPA 2FPMA 1G5TA 1Z28A 2ZUDA 4CW7A 3VNVA 5KNCA 4PSKA 4IDQA 1OIWA 2ZE6A 3CPEA 3RS3A 1RRFA 4O2RA 1B23P 1OPXA 2XTMA 1WCV1 1A7JA 3EPLA 3AB3A 4XJXA 4OI2A 1JXMA 2AXNA 2R8RA 3CX7A 5HPYB 3QPWA 1ZM9A 3SHWA 2GF9A 2AHOA 4EFMA 1SGWA 1KO4A 3E2IA 1G21E 1W2GA 3DZ8A 3KXLA 1Z5ZA 4HAZA 3BGWA 3TSWA 4ACAA 4EPTA 3IUYA 1TAGA 3OHMA 2CHQA 4FI3C 1SVKA 5FTNA 2JJ2D 4ASUD 5EE1A 2WPDA 1R2QA 1XCPA 4P4TA 5J4HA 2F3RA 3KTAB 1XTQA 4H1VA 2RAPA 1IY2A 3B6EA 3LV8A 4NMMA 4TN1A 3I92A 4FXPA 5FFMA 2YVUA 4MYUA 5DI3A 1AIPA 4JYBA 1N6NA 4V0KA 3T5GA 5CM9C 1RKBA 3ZLJA 1G8FA 3U3RA 1VYVA 1AZTA 1ZINA 2BKEA 2D2FA 5BXQC 3AP1A 4B48A 2A5FA 4QKQA 2NO0A 3R8CA 4DDTA 2ZRMA 5F2EA 5FUVA 3RWOA 3ZVLA 4B47A 2FE4A 5EZ5A 1W0JA 3BH0A 1HYQA 2QNRA 4ABYA 3SN6A 1D2NA 2AK2A 4ZKDA 1S2MA 3RWMB 2FEOA 5FOVA 3S1AA 3T5DA 4PXAA 4QNRA 5JS8A 4BFVA 3DM5A 4G5RA 4PC3A 3TH5A 2QBYA 2O5VA 1X86B 2C9CA 5FL7A 4TMZA 3U7GA 1RRPA 4S2EA 1EG7A 3SJCA 2DBYA 3B1ZA 3IEUA 5J4LA 4FIDA 4I4LA 3ZD6A 1COWD 4NYIQ 1SVIA 3GFTA 1HEIA 2JLUA 3I72A 1JAIA 2CHVA 4TYWA 3QG1A 3OFND 4OHXA 1NKTA 3T35A 3TR5A 2WMNB 2FWRA 3WXMA 4P4SA 3RS7A 1UKVY 1YRBA 2ZR0A 3BH6A 2OCBA 4QFMA 3WBKA 3KQLA 4RZ3A 3AVQA 4GP7A 5LD2B 4DLRA 1J90A 3RHFA 4BECA 1RW4A 3K70B 4Q19A 5J40A 4KHZA 1OKKD 2Q9AA 2WJJA 2ZS8A 3CKLA 2P65A 5CLQA 1SULA 3WRYC 2V54A 1WA5A 2V1UA 4UJ5A 2OXCA 3Q5EA 1QHNA 4TT3D 1F2UB 4URYR 221PA 4JSYA 2G1KA 3A1SA 3KL4A 4JJKA 3S1AB 1CU1A 2Y8EA 1GP2A 4LRWA 4Q7MB 4Z51A 2GEVA 2JCSA 2QAJA 2ZRAA 1T6NA 5EUQB 5JZVA 4LJ5A 5JCPA 5C1BA 1UKEA 1Z8FA 5AJVB 1W4RA 3U61B 4PQRA 4R71A 5FBRB 4E07A 3CRVA 4AKGA 2VL7A 4JVLA 1ESMA 4D4MA 4PC1A 3KUDA 1FP6A 4GZMA 4I99A 3NDBB 1ZM3A 4KODA 2ZSBA 3LD9A 2EYQA 1W46A 2GEDA 4MUBA 4JT2A 3V00A 3KQNA 4LDJA 1KI7A 4K81B 4DLVA 1A4RA 2FPKA 4OYHA 1IM2A 1KKLA 5BYJA 1GUAA 1JQJC 3ONWA 1G8HA 1E2JA 2BCJQ 1U2RA 4QBHA 5SZIA 3MJRA 1Z0AA 1G4UR 2XAUA 2EYUA 4F38A 3IQXA 1NIJA 3KTAA 1GKYA 1N3BA 3EWSA 4UNQA 1DTSA 1F3OA 3PEYA 2IEZA 3MUFA 1OXUA 4UXIA 1KK2A 2ZRDA 3SU8A 3WMEA 5CDFA 1VCNA 3SBEA 5L3QA 1G291 5KNBA 3HWSA 3SFVA 5FPYA 2ZRFA 3NBFA 4AKIA 2KJQA 2VHJA 2VH5R 4ZI2A 2R2AA 5CJPA 4IOJA 1NNEA 5EXSA 3MWLA 3L2OB 1KI2A 4PO1A 1E32A 4GOKA 3DOFA 5HE8A 4AYTA 3IPXA 3TQCA 1QF9A 2W00A 1Z2CA 1XXHA 4BFYA 3VR2A 4YMWA 1QZXA 4OQNA 2C9YA 5ELXA 3PXGA 3G0HA 3CR7A 4UNRA 3GLGA 3GJ7A 1XU4A 2P5TB 1U81A 3RRNA 3HPRA 1E79D 3QPVA 5M04A 1DAMA 1QBKC 3G5UA 2XNSA 2ZM5A 4KFSA 4KBGA 5H68A 4HZUA 3U4QB 2Q3MA 3T1VA 1TUEA 1Z22A 5SZKB 5EJEA 4LBVA 1XZPA 1KKMA 3LXXA 4P4UA 5ANRB 3DVLA 3KKOA 4U7DA 3PJRA 4Q4HB 3OZXA 2YV5A 4CEHB 1XXHB 3DHWC 3THXB 3UWOA 3TNFA 1E9AA 4XVUA 2ZJAA 5FPKA 5TVKA 1VIYA 4ON9A 4ERNA 3AV0B 5B30A 1LFDB 3LQQA 1XTKA 1PZNA 1I2DA 4BPBA 1E0AA 2QN6A 1SHZA 2GXAA 3BC1A 1ZYUA 2ZS9A 5DLQC 3B1VA 5GADl 1TQ2A 3HU2A 1OHHD 1XX6A 1SXJC 3X1DA 4KAXA 1VCMA 2RCNA 2GVZC 2ZI3A 1KIMA 1E79A 1FMLA 1OYYA 3KX2A 2J87A 2VA8A 5DH9A 1T0JB 2QQ0A 2A2ZA 1OF1A 1R0WA 4URVR 2LKDA 3A1WA 4JZKA 2XJ9A 2X2FA 2AKYA 4NYMQ 1Q0UA 4EFNA 1N6LA 2ZRHA 4RCZA 1KSFX 4HUQA 1RYFA 3L0SA 2IBMA 1FQKA 1UM8A 3FPAA 4LJ7A 1VYTA 2CVFA 2ZE7A 1G8PA 4W7SA 3H1TA 2W2TA 1IXSB 1QHHB 2AFIE 4IVRA 2D62A 5AUPB 4OI0A 1RJ9A 4KSBA 2ZR9A 4PTLA 1M1YE 3RS0A 1UDXA 4Q4JB 2J0UA 1CR4A 3U3OA 1T0HB 2WWIA 2EQBA 3B82A 1BH2A 3VR6A 1I4TD 4DDUA 3EG5A 2QM8A 2H5EA 1CF4A 5CM8B 3GJ8A 3LO5A 3QNUA 1Q3TA 3QKUA 2ODWA 4H9GA 4Z8XA 4C2TA 5CITA 4DLXA 3CPHA 5FBLB 1EFRA 2VRWA 1U94A 4KXFB 2VHTA 4QHSA 1WQ1R 4OHVA 1GITA 1YJ5A 1VG8A 3GJ3A 4M1OA 1XEWY 1WB9A 4XD7A 4QRHA 4NTZA 1FNNA 1XTRA 2CE2X 2CJWA 3CR8A 1JQLB 2YOHA 2ORWA 2P6NA 1GL7A 3B9PA 3CWQA 4C9BA 3K0SA 3QEOA 1D2EA 1FFHA 4YMUA 3QXSA 1NMZA 3W6OA 2BBTA 2ZRGA 1E2KA 3K53A 3OEHD 1Q44A 1DAFA 1XWIA 5JEEA 2FA9A 3IO5A 5G41A 4Q5IA 1FX0A 2O0JA 4WXPA 1II0A 1IBRA 2QENA 2VIIA 3FGNA 3I3SR 3JZMA 5B57C 4BFWA 3SYNA 4LOAA 3AP3A 3U7HB 1E2EA 3OIVA 4B6FA 1XF9A 2QTFA 4Q47A 4OHYA 3UANA 3U44A 1KDOA 4QGGA 1K5DA 2W58A 3AUYA 3OIWA 4QJ5A 4W5HA 3IIMA 2F7SA 4NL4H 4DKXA 721PA 3FKSD 3L0IB 5FOUA 1IY1A 4MRNA 4MGZR 1JBKA 2PLFA 2P6RA 3B1XA 1OXTA 2IYSA 4Q00A 3LBHA 5GVSA 2CNWD 4TLAA 4B33A 5TMPA 1S4QA 5CIWA 1LV7A 1MABA 1KAOA 2PZGA 5EE0A 1U90A 2GCNA 3PR1A 1W5SA 2YZ2A 2J46A 1QG2A 4GL2A 1ZUHA 2BMDA 2QY9A 3RC3A 2F43B 1OJLA 4ZI3A 2EFDB 2JA1A 4C7OB 1K8RA 3HR8A 2JIZA 2QEQA 4PR0A 2Q0HA 4II7A 2P67A 4M1MA 4ILEA 2BMJA 2V7QA 3BB3A 4AIIA 1G64A 3FE2A 2BMEA 4KYIB 3ZGXA 3NHAA 2GZHA 3U6KA 1XEWX 1YVDA 2QMHA 4LC1A 4QM7A 1R7RA 3W3ZB 2FZ4A 1MKYA 1XEXB 3PEVA 4LHVA 2B8WA 1A5TA 1VMAA 5JCZA 1YE8A 3W6PA 2E1RA 2CL6X 1YHNA 4OJKA 2OE2A 1MRNA 4MYCA 4PHTA 5IT5A 2FN4A 2RH5A 3GP8A 3RRMA 1P2SA 1MO5A 2H7VA 3I5YA 4HI0E 1KI4A 1IJFA 1OH5A 1WMSA 2YJTD 1BYUA 1Z6XA 2OFWA 2B92A 1Q21A 2BV3A 3CNLA 4IKEA 3AVVA 4AYWA 3CLVA 3E1SA 4IHQA 2ZYWX 2HDNB 2Q3FA 5D3MB 5AJYA 4E22A 4EKDA 5JBQA 1P5ZB 2Z4SA 4C0JA 3NVAA 3JVVA 3PV0A 1GFIA 2HJGA 4Q66C 3AF4A 5DI3B 4KSCA 5F9HA 4RD3A 5GJCA 1E69A 3OEEA 1NBMA 4XVRA 2MSEB 3P4YA 4TL8A 3GLFB 3K1JA 3ND8A 4HAXA 4F7WA 4JLJA 4D81A 4YDHB 5L8VA 3GLIE 4JIMA 3IBYA 2KBEA 2QROA 1NSFA 3R8FA 4D25A 4QL3A 4BFSA 1E98A 5C4GB 3K9GA 4B3XA 4DBLC 1QG4A 1TEVA 2P0EA 4KLNA 4NE2A 3ZQJA 2RGNC 4MH0R 4PC2A 4OKSA 1G7RA 1KTVA 1H8EA 2ERYA 4FW9A 5KSPA 1CJUC 1PVOA 1HTWA 4DWJA 4LJ4A 2R6GA 1DE0A 1EWQA 4AY2A 2QI9C 2ZR7A 4BLQA 1DAIA 2XJ4A 3AKYA 2AXPA 4TYQA 3QBVA 1M7HA 5FUWA 3PEWA 3ADCA 2GXUA 2R62A 2GESA 3BFKA 4HAWA 3IIJA 3EPJA 1W36D 1R5OA 4ZDIA 3B60A 1KYIA 2CCKA 3D7MA 2X1VA 1KK3A 1Z83A 4B2PA 1E1RA 1E1RD 5B64A 3GLIB 1T3HA 1QVRA 4C30A 2V8OA 2IYUA 2QSYA 4DIDA 2PMDA 2BEJA 4UKDA 3KKPA 1R0ZA 4IOLA 2H18A 1J7KA 1EFHA 2IX3A 4FMCB 2IA5A 3SQXA 4WZBE 1PUJA 4PZYA 1YR9A 2OO7A 3UMSA 4PAOA 1X8LA 3TE6A 2ZEJA 4NYJR 2DHRA 4B43A 3VAAA 3GLGE 3QUSA 5EP4A 5J4VA 4CYMA 4GOXA 2V4ZA 1E9DA 2WV9A 2EFEB 3CX8A 2HT6A 4CEIB 1J2JA 2GEUA 1NVVQ 3L0OA 2JLRA 3QG5A 2VHCA 1WDTA 3L82B 2NOAA 1NIPA 4Q48A 3TMKA 3A1TA 1UADA 2G83A 2ZJOA 1HY3A 2WOJA 2WKQA 5HZHA 1KO8A 3QQ5A 2XB2A 1P9NA 1P60A 2CEAA 3AVUA 2BDTA 3REGA 1US8B 3DZDA 5EE9A 1OFUX 3NBXX 1N0WA 2DCUA 3X1XA 4AWXA 3VMFA 3LLMA 1E9FA 5E7MA 2Z6VA 1T8TA 4MDEA 5DYGA 3AKEA 3LY5A 3CZPA 3T1TA 5H70A 3NEJA 1XMVA 4C3ZA 2ZI6A 4TTRA 2J7KA 5FI1B 1DAEA 2REXB 5G3YA 2SHKA 3SOPA 4C0QC 1XFAA 2XSZA 2FOLA 2FMXA 1XRJA 4X8OA 3N2IA 4A8JA 2BKUA 3B5JA 4EPXA 121PA 5HTKA 5CIQA 5CYPA 1N25A 1F6BA 3MD0A 5EZ6B 4DLSA 1Q3HA 1G9XA 1HE8B 1S1MA 3AUXA 4JLVA 1YZNA 2ZRLA 3AKCA 3HYRA 4R9UC 4NCNA 1OW3B 3AVOA 4A0GA 3PUXA 1X8JA 2F9LA 3KKMA 4X8HA 5FL7D 1IY0A 3QXXA 4XWOA 5E3HA 5TV2A 3U4QA 4R7ZA 2FSHA 1RE0A 4U5XA 3VR3A 2O8FA 1ZVQA 1G17A 2WTUA 2FFHA 3FWYA 1W0JD 4HATA 1CTQA 1KJWA 1XZQA 2D4HA 2QM7A 5JFGA 1XJ0A 1CRPA 1NVXQ 4TMXA 1HT2E 3SE0A 2RKOA 2XSZD 4NYJQ 1WRBA 4QJ3A 4LJ6A 1UBGA 3H84A 1N0UA 2QP4A 4YDSA 2ZSAA 4ZV4A 2QMEA 2VLIA 3GLGB 3UPUA 1KDTA 1OFIA 4XSHA 4ARZB 5C18A 3D8BA 3HJNA 1HE1C 4M4SA 2HT1A 2ZU0C 1BYIA 1NN1A 4ZIRA 4OK6A 1YQTA 1CBUA 2HEIA 2WSSA 1FTNA 1DELA 3FVQA 3LX8A 3OF5A 3P32A 4DT1A 2WWFA 5JJLA 3VKGA 3CRQA 4YC7A 4ZDWA 3K0CC 1LNZA 4P32A 4TZ6A 1KSJA 5KSZA 1BKDR 2ZRKA 5J47A 1IN5A 4FWIB 1VHLA 1NG1A 4IW3B 1SXJB 3OAAD 4R2IA 1G18A 1XBTA 3A36A 3CM0A 1MH1A 2CMKA 2PCLA 1P62B 2PZFA 2WMOB 2LCFA 1KAGA 4TLEA 2O0KA 4KITB 5FI0B 2DWOA 1V5WA 3THWB 5KSOA 4Q4LA 3KZ1E 4IXMA 1KZ7B 1ZM7A 2YWFA 3K9HA 1PLJA 3W5JA 4A6XA 1G3IA 2AX4A 4QM6A 2CE7A 1N5IA 5FL3A 1CRQA 2J0VA 4F91B 4PHFA 2A5YB 4JBXA 4KYUA 5A4JA 4UQOA 1Z0IA 1F2TA 1GIAA 2XNDA 1OFTA 5BN3A 5CDFE 1OSNA 2H1LA 1U99A 1GSIA 3C16C 5HZKA 4HDCA 2HLDA 4WAUA 2W6ID 2OAP1 4QHYA 4IDPA 4M9SA 1TF5A 4EIWA 4HB3A 4D4JA 3TRFA 3AVTA 2ZJYA 1BIFA 3B1YA 4B2IA 3OFNA 4LC0A 3GPLA 3VHXA 2XOKD 2GAAA 2HF9A 1XMSA 2F1IA 2ZJ8A 4JLDA 2FSFA 3BB4A 4RD6A 3RANA 4WZAE 1DG1G 5J4KA 4MRVA 5DSZA 1AS3A 1E0SA 3PENA 2IK8A 2EVWX 4ESHA 1TUIA 2W83A 4EDHA 4B3CA 3ZS8A 2VP0A 1AGRA 4UNPA 3K0AB 1ODFA 1GG2A 1MV5A 1H65A 4US2R 3IKJA 1FL9A 1KI3A 3I61A 3T1OA 4A8JC 4HDOB 1D9ZA 3BFVA 4KFUA 4MYTA 4D82A 2EWWA 1VDZA 4KU4A 3Q9LA 1UBCA 5HKKA 2XZLA 1FP7A 1ZUNB 2GBLC 2W0SA 1F2TB 2ZJBA 5EXXA 4EQ6A 2GETA 1S3GA 3MLEA 1E2FA 1RVDA 5FBQB 3U6BA 2ASEA 2JDID 2QBYB 4GDFA 1SKYE 3VR5A 4YMTA 2A30A 5AWFC 3R20A 2A9KA 3KJEA 5AUNB 4QBIA 2BBWA 3KUCA 4CRWB 4ZDKA 4Q02A 4WIAA 2AK3A 2GZDA 4IVPA 1DPFA 1QHHA 3K0FB 5FOWA 3I4LA 1VKJA 4EPVA 4C0BA 4PSVA 4G1UC 2CLDX 4URZR 2YWHA 2WSSD 5DN6D 1KI9A 3GJXC 2JJ8A 1IQPA 5FUYA 1VCIA 4Z1MD 3BAFA 2GAOA 2OT3B 1Q57A 4TQUS 4LV8B 5JECA 4N1AA 2GJKA 2P2LA 1OXVA 3OIYA 3EARA 5G3ZA 4CZ2A 3E5HA 3LRPA 3CRMA 4M1YA 2BM1A 2I3BA 4HYYA 4PPNA 3QF4A 4RD0A 3AF2A 4QGHA 4X8MA 4LPSA 2JIZD 1RIFA 1E0KA 2GDJA 1E0JA 2J41A 4RSGA 5IF9A 2QSZA 4NCIA 2ODNA 2QRZA 2VSFA 1E4VA 2WKPA 3I62A 4WZ6A 2CBZA 4POAA 3A4LA 1VG0B 5KUTA 2QP9X 1C4OA 1GNPA 4FCWA 1DBSA 3DPUA 1UEJA 4ZKEA 4H1UA 3QXHA 4HB4A 1NY6A 4A9AA 1W0KD 1D2MA 2MMCA 3I73A 4BLTA 3GLHE 5AJXA 1N5KA 2F3TA 1NN3A 3DL0A 1ZRHA 1Z6TA 1VHTA 1TQ6A 3KXIA 5LD2C 5C46F 2WWYA 4LZZA 4NCKA 2QP3A 2AR7A 2VP9A 3RVBA 4NYIR 2G9NA 1II8B 3G82C 1R8QA 1TEXA 1WE2A 3BERA 3TUZC 2BVNA 2ERXA 1NMYA 1O87A 2WJYA 2R6FA 3K70D 4F93B 2TMKA 5AUQA 5K8UA 4IOMA 4NBSA 4BLRA 1EX7A 3PCRB 2ZRPA 4HSEA 4ZIRB 2QGZA 4GNKA 1U0HC 1P2VA 4KFRA 3JZAA 2XZPA 2DFLA 3FB4A 3A1VA 2IS2A 3BS4A 2IW3A 3I8SA 4KCGA 4LI0A 4URUR 2UVQA 2J9RA 1XJCA 4DEXA 4Q4HA 1W5TA 1NRJB 4CEHA 2YYZA 3K8YA 1LF0A 1N6IA 3LDAA 4M9QA 3OE7D 4B6EA 4D4KA 3I5XA 3VTKA 3ZVRA 2WWXA 3THYB 1G19A 2VHUA 2ATVA 4OI1A 2O8BA 4X8LA 3QKTA 4XD7D 2ATXA 3GLFE 3VX3A 4DCSA 1U8AA 3O8CA 1E9CA 4IRUB 1GRRA 1KDRA 2QPOA 3QXJA 4JLBA 1ZP6A 2W2VA 4XTCS 4JLKA 4HDQB 4MKGA 3VKWA 4TL9A 1R4AA 1GTVA 4Q4JA 1EESA 1IXRC 4Q03A 3C41J 4AK9A 4B76A 1OT3A 3D6TB 2C8VA 1OLOA 4UXHA 1T3SA 1W1WA 3OESA 4XTRA 2AN9A 3SYLA 3MAAC 4M9XA 4V0ME 2V6JA 4RZUA 3AKDA 4Y0VA 2XXAA 2CCGA 2ZYVX 3QXCA 4PPFA 3TUJC 3H86A 2DPXA 3WNDA 1ZMXA 1XB2A 1T4GA 1YZQA 4OQMA 1A82A 1FMJA 3R9IA 3CUEF 3MWKA 1E2HA 4MRPA 3F3YA 1P2TA 2YNMA 2Q21A 4BE7B 5FTKA 4OI4A 3EWAA 2UZ3A 1OE0A 4D2IA 1FZQA 1RRGA 1P7CA 1U9IC 4QBFA 3EIQA 4TQ9A 3Q72A 2GKSA 2J5XA 5DNYB 2WJIA 4JLPA 1ELOA 1RJ9B 2QZ4A 2XX3A 1AK2A 1OXXK 1W49A 3AVPA 2Z4RA 3VU9A 1TU3A 1GILA 5IRCD 2ZROA 4P33A 4PANA 1HT1E 1N6KA 4EPRA 2NZ8A 4GSYA 1NP6A 5FBWB 3CNOA 2DR3A 2ZU6A 2C78A 5FH9A 2QA5A 2GBLA 3TK1A 1C9KA 3QKRB 4HB0A 1Z0JA 1VYUA 1W4AA 5J5CA 3IILA 2DFKB 1SHKA 5TARA 1CJVC 2FU5C 3P1JA 4OJQA 3CW2A 5DN6A 3UMRA 1DG3A 2NQ2C 4R2HA 5UKDA 3TVDA 5DGXA 4PO9A 2HV8A 3IBGA 3TVTA 4AURA 3M1IA 2VP4A 3NG1A 3KB1A 1KI1A 1GL6A 2CJWB 1TQDA 2Z43A 1T5LA 3GLIA 2ZAMA 3WNBA 5JWOA 1J99A 4G0NA 4B74A 4PPGA 1BOFA 1JB1A 4Q1FA 4HAYA 1MO4A 2J0UB 5KHOC 4NZYA 2QAGA 1HQYE 3EC2A 4ASUA 2J0QA 2EFCB 4A15A 4PAQA 4C0KA 1TTTA 1GRQA 1SXJA 4EPYA 5JJIA 3BFXA 3L43A 4AG6A 5KDDA 3KQHA 2GCOB 4IJMA 1M34E 4RVCA 4BEJA 3A4NA 4TLBA 4RJLA 821PA 4TTQA 3FYHA 1JEDA 5L3SB 1U0LA 2VHQA 4A6PA 4I1UA 1R5BA 2V55B 1NBMD 1QVAA 3F8TA 4PC6A 3QENA 5LB2A 2B6HA 1SKQA 4WA7A 2R44A 521PA 5KPJA 2ODBA 3N5CA 3O47A 1E9BA 4O0MA 3T12A 2P5SA 4BRWA 3UG6A 4B3FX 2OLJA 4TMTA 1MRSA 4HLCA 3T06B 1JR3D 3FMOB 2CLSA 3WP1B 4BFTA 5FPHA 1Z0KA 4DVGA 4ZPXA 3UXMA 4F4JA
chains in the Genus database with same CATH superfamily
1LJLA 1JR3A 2FK8A 3Q9UA 4J9VA 1Z18A 3S2FA 4G0WA 2FOIA 4L4UA 1K7CA 1Z0ZA 2H4FA 3HB1A 2IOFK 1GQ2A 1E2LA 5B2ZA 1YFJA 2P9ZA 4NFHA 4MV6A 4K0KB 4LBYA 1SAYA 3T1YM 1FFXA 2ENWA 4JYCA 1NJSA 2BY4A 2P6UA 1CUYA 1ORIA 1HDIA 1Z47A 5BSTA 1K97A 2B30A 1S96A 4Q7KA 1GQFA 3RD5A 3AFMA 3AZPA 1Q3CA 1FPMA 1NPDA 3UATA 3W77A 2ZWOA 1UFOA 4MA4A 1K6MA 3GEIA 2PSDA 4IHAA 3IQEA 4XWYA 2HPVA 4U8GA 4C06A 5AESA 5JARA 1NF8A 5ENZA 5KQSA 1NJ8A 1DGHA 3BTOA 5HKLA 3KAQA 4P1ZA 3UZUA 3Q8MA 1E6EA 2K2WA 1YSYA 2PX3A 3HN6A 4LRYA 2I7NA 4BFZA 3Q3JB 1ML4A 1V6AA 1SQFA 3KZXA 3T1QA 3K05A 3R9XB 4Z2YA 3VOTA 3D31A 1J23A 1YRYE 5IVHA 1FYVA 1VB3A 4MITA 3ZEIA 4BQEA 4CKXA 3GFOA 3NDPA 1XVIA 3TSAA 3UT5B 2I7TA 1G4AE 2X8JB 3UK2A 1ZM4A 4E5PA 4Y2SA 2F59A 5E8JA 1X7GA 2P4QA 5C34B 3IRVA 4Q3EA 4NY1A 2D3TA 1PVVA 5BYKA 4C7OA 3VK8A 3FROA 3ICVA 4MKIA 5BW8A 3KQKA 4A2QA 1V3UA 3KJGA 2ANCA 3TLYA 4JBLA 1H2XA 4OQLA 4RS4A 3WYDA 4BQIA 1RD4A 2B7CA 2CDNA 5AHRA 1FTGA 5J5VA 1WCYA 2BMAA 1L4GA 2GSDA 3DTNA 3V97A 5LA6F 4A5SA 5I4KA 3TWOA 1G2QA 1D0SA 1WY5A 2OCAA 4MWOA 5JBNA 2VJLA 1P1HA 1TNDA 1JW9B 3KBBA 3FDZB 2EX1A 2CP8A 3GB9A 1OU4A 4QGAA 1A2QA 3G5LA 4DXDA 4HQ0A 1MN6A 4KX3A 4WMLA 2ZSFA 1O5TA 1KFBB 3R0XA 4N82A 1JLKA 5IDYA 2R7KA 4CODB 1T0UA 2XTJA 2G0NA 3C8DA 1MEOA 2JFBA 1J0XO 1KFEB 1X80B 5G02A 1F5NA 1S2OA 3KO8A 3I04A 2Q1UA 2BWJA 2XNJA 2Z0MA 2H5LA 1KS2A 2W8BB 4LJKA 3PVZA 3W2FA 1NJ2A 5A7FA 4TXJA 4Z3OA 2BM0A 7ADHA 4LXIA 5F3WB 1CS4C 1ZKMA 5AVZA 3TMYA 4TV9B 1RPZA 3IEIA 4W5QA 1AZSC 2I6TA 1T29A 5J59A 2QORA 3TGPA 1OZAA 2Q4TA 4HLNA 4ZVPA 3WICA 4A27A 1H69A 1ML3A 1ZRMA 3ND7A 2RJ3A 3N86A 4CM8A 1WHCA 1BDIA 3LW7A 2BHRA 2PR2A 3T7TA 3G6KA 3CSUA 3RAPR 5JNLA 3ZWCA 1Y3BE 2UYYA 4BBPA 1HBJA 3OT1B 5IASA 4IIGA 2VNIA 2QG9A 2Z3WA 3DKVA 3VU9B 3AFOA 1AC5A 1NUSA 2D1SA 3ZCQA 3EQZA 4X60A 4DR2M 2DUWA 2R66A 3AF3A 5AM1A 3TJMA 4LF6M 2DQYA 5IKOA 4X45A 2C29D 1GZDA 2I6GA 3W3AD 3PDCA 1K3UB 2X2OA 3BSWA 3DDCA 1YKGA 1FRQA 1Z16A 3QTLA 5A7HA 2Y4NA 3DBRA 2ZYUX 4DSZA 5ALIA 4FLEA 4IMPA 2DULA 4RA9A 3DFUA 3NOOA 3HVIA 4UAGA 3VOBA 5K20A 1MMFB 3SYKA 4L78A 2QMQA 3HY3A 3NC0C 4O4JF 4OMCA 4NE7A 4P5DA 4AS3A 4EB0A 3GD7A 4JXZA 1N33M 4RA9B 1KZ1A 3TLZA 5LZ5A 3Q9NA 1FE8A 1W87A 2D2VA 3FOBA 4OBEA 3FI0A 1XZMA 1JHAA 2AMVA 2FW9A 2JS7A 1OTHA 2ZRNA 2CRUA 1JQEA 1CUJA 3EODA 5JG7A 4D3DA 2Z2YA 3FN4A 2GZAA 1GPWB 1C1YA 1I6KA 3HA3A 4DZZA 5L9AA 2VDQB 3TLKA 3PP8A 2O1EA 3V1NA 1TU0A 5DBOA 2G1UA 3AZOA 1JG6A 4PLVA 4RZIA 4F3TA 4TL6A 1MT0A 4TS9A 2PIAA 1KY4A 1YCHA 2OSBA 3GJ0A 4LYJA 4KGDA 5FOXA 4KV9A 3WIEA 3LUKA 4CIZA 5J63A 2QM3A 4NCHA 4X6XA 1PBNA 5K3EA 1HE4A 1M10A 3H13A 2QYHA 1M5TA 1P2GA 2JD2A 2IS6A 1YJ8A 2FN8A 2RGEA 3BWMA 1HI9A 2EQAA 3L1UA 3RSLA 1L4YA 3WLMA 2HZBA 4IDOA 5D5QA 1I6MA 3LH5A 5E2AA 1KXZA 1XP8A 3I2IA 4UNNA 4XQGA 3E58A 2IHJA 5EE5B 2DHQA 4PX3A 1PDOA 1RQRA 1USGA 1ID1A 2J6IA 3BZUA 1QFXA 4XWKA 4NENB 4ENTA 2GILA 4RIIA 2EKFA 4OYRA 3ISVA 1PYOA 4IQGA 3CPSA 5BN5A 4HNSA 2NG1A 4AROA 1XPOA 1PS8A 5IX8A 4MM3B 4B3IA 3THOA 4FR2A 4DR3M 2G3QA 5F1YA 1CW2B 4EI8A 1YR7A 2JFYA 3P5BA 4HKTA 1JT9A 1ISMA 4AYXA 3NH9A 3NVMB 4RJ2A 2NADA 4GOMD 4XJVA 1WVMA 4CKBA 2L7IA 5FWDA 1H05A 4CM4B 4OSEA 1SD2A 2HW8A 4B4VA 3KB2A 3K0CA 4A8PA 1W30A 1E63A 3RIYA 3RE8A 5LMUB 1JWLA 5IW8A 1VJ0A 4LWZA 1FDRA 4ROTA 3EPHA 1DHTA 2YQ5A 3E48A 1G5QA 2QTMA 4LV5B 2WIFA 3BORA 4PGFA 3CNHA 4BIMA 1AXGA 2WFZA 3JQ9C 2V7EA 3ND9A 2Q4BA 3JYNA 4RJIA 4B4UA 1IM5A 1XMIA 4O3MA 3A3OA 3KJIA 2HHCA 1W85A 1WETA 1XMQB 1VJGA 1Y3AA 4NFSA 2IDZA 1RXWA 1FZTA 4YO7A 3COZA 4B40A 5ALPA 1RXUA 1O54A 1DT3A 1YBHA 3DKPA 3CB4A 4N0PA 4PVDA 3DMNA 3E7FA 3W9SA 2J45A 1SB8A 1U0JA 2XA2A 4JT4A 4U2GA 2ILTA 2X3FA 3WY9A 5I6DA 3O4JA 4BO9A 4JI4B 1KMIY 4DUZM 4R0NA 3U39A 2Q50A 3BJIC 1I7QB 2IYLD 1DG9A 3EF3A 1QUFA 1VI5A 3I2YX 1Q1EA 3GPPA 2HA7A 3BD6A 3PXBA 2OOBA 3S2UA 4CIVA 1QDLB 3U0BA 1UT8A 3C6BA 5LQUA 3H2JA 5K3SA 1KO7A 1ZUIA 3QI2A 2EZ4A 5BMVF 1XDSA 5FWXB 4OK5A 3QX7A 2P9GA 1EWYA 4LY0A 2PRIA 4YCBA 3PKJA 2Y1OA 3T9CA 1W7AA 2OZPA 3IXQA 2VTEA 1OIVA 4UU7A 3VHLB 4TKVB 3W7AA 3USZA 1KNXA 4UUOA 4HD8A 1RS0A 4HUTA 1SHUX 1BVYF 2ZULA 4TTPA 4P3KA 2PVCA 4I9GA 1XD2B 4FHEA 3HWRA 4B2LA 5KNDA 2NP6A 1VJCA 5BURA 3O9ZA 3X1KA 1ADFA 1GNQA 3OLQA 1M7GA 4BASA 5HYVA 1GGKA 1ZOPA 1W4CA 3CSDA 2IWHA 2ZTMA 3OEWA 3QOFA 2XKAA 3B6KA 4N6OA 2OEPA 3QU2A 4XH9B 1FF9A 3A4MA 4B4WA 1VE3A 2QNBA 1W4BA 2GLUA 4YPFA 2O1SA 1QIKA 4DBVO 4BQPA 1REQB 3F74A 3P4XA 3PEUA 1C7RA 1G6OA 4Z86A 2V6BA 4P16A 2CWDA 4MW6A 1Z34A 3KFVA 2MR6A 1FYXA 2P6PA 3ZHSA 2JKYA 4ROSA 1WL8A 5B3KA 3Q3IA 3GLHA 1DAGA 3IERA 1PTKA 3FD9A 3E1GA 2P5TA 1CG6A 1NFFA 3DFMA 4KQWA 3RYFA 4DLTA 4N7RA 2BGJA 4EHLA 4CEJB 5AW1A 2FR8C 3PHLA 2ZWAA 1JZTA 3GEHA 3JQRA 4G3XA 1WSDA 3IUSA 4AX4A 4FR5A 4FGZA 4IY1A 4S1VA 4BO4A 3IOBA 5B7PA 1SXPA 4C1BA 4MKFA 4OLFA 1PHPA 3RNLA 4IDDA 4YALA 3RVLA 1IHPA 1PJZA 1RZVA 2AJCA 3CX3A 3D6HA 2JHPA 3K32A 3NHKA 3M6IA 5EWJA 3DOHA 1KYXA 3KSJA 4M8KA 1J2TA 3C3CA 3EZ6A 3BILA 1E6LA 1P1CA 1QIHA 8AT1A 1Z68A 4I50B 4IEIA 3AEQB 3L1JA 2BJVA 2YIJA 3BWDD 3QYJA 3FPKA 3A11A 1EFDN 1VA4A 1ONSA 5TT1A 3RGWS 2G36A 2PL3A 3CH4B 1D1QA 3EQ2A 3NP9A 1KY3A 3LT0A 4FKZA 2OHXA 2OKGA 3BJZA 5LP6C 4D3SA 3C8MA 4IIJA 2H07A 1YUNA 3BE6A 5LMCA 3PC2A 4C4ZA 4XPZA 3SR4A 2LH0A 1O96A 4FD2A 2X42A 3DONA 3DL7A 3AR7A 1J06A 4C20A 4O63O 3IPYA 3U80A 3IHPA 4UD6A 2UUBB 2IYNA 1VG1A 4K3VA 5KPDA 3OJFA 1UF9A 1XWWA 1I5EA 3BWYA 4G5OA 4GD3Q 2C4WA 5AW3A 2AEJA 4BVFA 5BQOA 3E53A 4JOSA 4R68A 3TX2A 4A1FA 4CLDA 2QE7A 4WCVA 3A7DA 3OBBA 1JB9A 2ZXUA 1E2PA 1ZD1A 1MO3A 1OWOA 1NNSA 2EG9A 2J7PD 2LBPA 2ZB7A 3KQVA 3OSZA 1M6NA 3R40A 2WVJA 1G7SA 1QFZA 2WSYB 4H7EA 1RLJA 4WCDA 3PNYA 1UJNA 5LBIA 2QD1A 3RB8A 1TKBA 3MERA 3RM3A 4YCJA 4DSTA 4JHLA 1M6VA 5IU6A 4PRLA 4RBNA 3EUEA 2WFLB 2DBQA 1FYWA 4MLCA 1CDZA 3KQWA 4OHCA 4BNNA 3FWZA 1IQRA 2AWOA 2I71A 1UJ5A 5AVKA 1FUKA 4Q4CA 2QM0A 4M54A 2NU7A 4FFOA 3J7AS 4FYJA 2H0QA 2KB0A 3HY4A 2ZBFA 1PM5A 4LNHA 1E4YA 2BKLA 4KR7A 1JWBB 5BUZA 2WVAA 5G4KA 3ETCA 4Y2HA 3KLBA 1DKUA 3PEFA 4Q93A 1Y7LA 4N3BA 1C81A 3L40A 4Q1CA 3INNA 4BQSA 3AOGA 1OROA 3D3JA 1DGFA 2G9ZA 2EFGA 1QXSA 2Q46A 4JX8A 1AKWA 1UPTA 2O2HA 2V3WA 3NPAA 3CLKA 4UBOA 5DGTA 4EAAA 4YUXA 3HDGA 3BKWA 1A5ZA 1OVGA 4KIGA 1U9ZA 4O0LA 3HWX1 3P9RA 4AZWA 5B36A 2EAUA 2VDLB 4ZICA 3TWKA 2E85A 4WZBB 3H9QA 3C5VA 4D9BA 1RVV1 3FZEA 2JLXA 4Z9YA 1G8MA 4LV6A 1Y8QA 3N2EA 2CXUA 2AJLI 1L6IA 1XB2B 2WZCA 3SHVA 3AR8A 3ZWXA 3DOJA 3OLZA 5LLTA 1NLZA 1UAYA 5TDHA 1EB8A 1YL5A 1NYLA 4C0WA 1CDOA 5K51A 4W5JA 4Z54A 4G84A 4LY6A 1DP4A 2VQSA 4K8OA 4MDHA 5MF6A 16PKA 2YHBA 5BUSA 7REQA 2A33A 1UC5B 4MKHA 5C3UA 4G41A 1JXAA 3M4XA 3NWPA 4IIEA 2VNSA 4C08A 2VHWA 4X65M 1I1OA 5C8ZA 3UBMA 4YRBA 1ZC4A 4FU0A 3TCNA 2MYUA 4H2DA 2K7ZA 2O54A 5DP2A 1V92A 1XCGB 3K35A 2XCUA 3C7KA 1NJ5A 3O7WA 1PE0A 1ZK2A 2IHYA 4GFDA 4PGAA 5ALXA 5JRZA 1T8UA 3FYUB 3WYAA 2ZTHA 4P34A 1L7EA 3BF8A 3AF1A 2WJVA 2VZ8A 3L7OA 5ALRA 3FFAA 1D6MA 3KFUG 2O7QA 1JQDA 1JQ5A 3OOWA 1XAIA 3UWPA 1HNNA 2YHIA 3LHKA 5G40A 3W9BA 1VLLA 4HGPA 4P35A 1T9CA 4O25A 4NABA 2C77A 3HH8A 3N5KA 3L9XA 4G01B 4JYMA 3N0XA 4YRSA 3CLTD 5BWBA 2CF6A 1Y8CA 3LMMA 3VHQA 1VPLA 2AF4C 2P3SA 4J1NA 4BJHB 1IMOA 1DOHA 1IXZA 1ULSA 3INYA 1MA3A 3TFOA 2FZGA 4GT1A 2MSWA 5AW7A 3CINA 1ZSNA 3KQLA 2ZPTX 3AMVA 3DLHA 3WBBA 5DU2A 3IGFA 2WABA 3QU5A 1YCFA 4MO9A 1YDEA 2HREA 1QH8A 1G2OA 1XTZA 2Q6TA 2GN2A 2XTZA 3DTVD 2DFPA 3FBGA 1WEHA 1EP1B 1TCAA 4DV5M 4WOKA 3BVPA 3H4TA 1ZAKA 3C4JA 3TSZA 4WXYB 3BF7A 1PJ8A 1N1MA 1FLVA 4GM0A 4ALNA 2FFBA 4U2KA 3WWDA 4QSMA 3VPGA 1JSRA 3FBTA 4F92B 4OVZA 2JNWA 3B1WA 1O0BA 2QUAA 1L7NA 1L8QA 4UZFA 2FRDC 2M60A 2ZBKB 1E3DA 1BHSA 2IDJA 2QV0A 1RAGA 2ZSDA 1ND6A 3G9ZA 3M83A 3NNNA 2F3PA 4G5FA 5FCDA 5KOHA 2GWHA 3IHKA 2B2NA 1C1DB 2NPOA 4OQ4A 2WBLC 2Z95A 2ZWMA 1IEQA 5BPHA 6Q21A 1OI2A 4D45A 4DB2A 3ACBA 1HF3A 2JASA 2PD4A 2R4TA 3ILSA 2XGNA 4ZAVA 4PFJA 3TIVA 2OXRA 5J2UA 2ZUVA 3QQPA 2WTAA 5ICFA 3CIOA 2R4UA 2GUWA 1KP3A 2OZVA 2ZBUA 5AHXA 2DFVA 4RPIA 1GKIA 1QFJA 3VGPA 3C1AA 1YR8A 5HJ5A 1GUDA 2BSXA 4OQXA 3KFLA 2FK7A 3M4ZA 1JMKC 1G7CA 1QVZA 2UZ1B 3P9IA 1JR3E 4GPIB 4O29A 1E5QA 4R1OA 1Q0ZA 3UGQA 5EIBD 1Q39A 4W1QA 4LHXA 3EDCA 4B3MM 5JCJD 5DTEA 1RXCA 2I2WA 1VECA 2B7BA 1MG0A 1IBCA 1CR2A 1Z2DA 3VPCA 5A2GA 4S0XA 5DBIA 3Q85A 5K4HA 5L7TA 3VNUA 3PL5A 2YVQA 3LX4A 3L7YA 1M7BA 3EZLA 3REQB 3F8WA 5FLYA 3GP1A 3THRA 5FT9A 4TXNA 3WE7A 3WKBA 3HYLA 4O02B 4PF1A 2D3WA 3BSYA 4RVFA 2G82A 3P0HA 5J9FA 3FJ1A 1RJDA 1M74A 1TZJA 1PJIA 3LE8A 1SCQA 3KJFA 2AI3A 4WJLA 1RXEA 3AEUA 3TBHA 1RZRA 1DJPA 1X2EA 1RI2A 3M0EA 4IZIA 5JZBA 4B3SB 4BFVA 2Q2WA 1T0BA 3HJAA 3GG9A 2I78A 4YJ3F 2VUHB 4DJJA 5E4TA 2AEFA 4N76A 2O19A 4EVIA 1O96B 3TSOA 1ORWA 3AOEC 3IEXA 4ACBA 1TTQB 2B82A 3J7AC 3D7RA 3EK2A 2ZTLA 1V1RA 3EC1A 4HLQB 3WLHA 2W6JD 2C0QA 2WPNA 3F1LA 3OQBA 4ZI7B 1U98A 3DP9A 3ZDZB 5I4IA 3OQMA 1QYRA 5GJVC 3ACDA 4E51A 5KYTA 1M2FA 1BS9A 1SXJD 3C1UA 3R0ZA 1DUVG 1E2GA 1H22A 5IFLA 1U2GC 2QTNA 5T6BA 1A04A 1ZK1A 2TMDA 1DTWA 4LDZA 3RT7A 3HR4A 3OEED 5H80A 3QMPA 3I53A 4C78A 1QDEA 1VE5A 3EVEA 1C14A 1CUXA 1U3UA 1K5HA 3O8NA 3P26A 5FULA 2I7PA 4IM7A 3KHUA 1JTFA 3VPFA 2NXJA 4DLKA 2E18A 3GXBA 2ONCA 1B8NA 1T91A 4KZKA 1L4EA 3ONFA 3EA5A 2QUIA 1U1DA 4EVSA 3IXMA 2FW8A 1P1JA 2IYOA 3EZ9A 2R18A 4UM8B 2DKNA 3RFXA 2CDAA 3QRWA 3GXOA 1M2JA 4UVHA 1A9QA 1WQ4A 3WVNA 5LZ2A 1PVDA 2GAJA 3K15A 1R10A 4EFLA 5HOEA 3K09C 1DOAA 4N3GA 3KAJA 3EAQA 4RHFA 4KW7A 5E9JA 5HILA 5HKKD 3NCHA 2FZ5A 3FOZA 4BWVA 2BC9A 1ULHA 1WDLA 2HSWA 3G7NA 2V3CC 1DCMA 1IUNA 5DYIA 3N0WA 4IGEA 3VH1A 2GRJA 2M98A 4NYMR 3OZAA 2DKOA 2ZJ0A 5HCIA 2J3LA 5LQCA 3W5SA 3CX4A 1NNLA 3A9WA 4G5SA 4PFSA 2P9JA 2PGIA 2VPPA 4YMGA 5JXGA 7MDHA 1NXSA 2WU1A 4NCXA 3RJZA 3HZHA 4BATA 5I48A 1AE1A 2TMGA 1PYDA 2ZQZA 4OX9Y 3P2EA 3HTXA 3KB8A 3ZS9A 2C00A 4OUDA 4X9XA 5A2QS 1EFVB 3ECCA 3HGMA 3R2JA 5LA6B 1FTSA 1YULA 2C20A 2F1JA 1H3FA 2PEYA 4Y2TA 3QPUA 3RRZA 3S29A 2QE7D 4IEFB 1AIPC 4CT5A 3DDNA 4X1KB 4MCHA 4R69A 4X93A 5I3ZA 4UU0A 1DXOA 4LZLA 5AI9A 2WYVA 2ODTX 3R41A 4BNKA 2PT9A 3F92A 4YHHM 1F60A 1GSAA 4EX6A 5MN4A 1W36B 4D4HA 1GLNA 1W93A 2J32A 1IZ7A 3PQ8A 4UREA 1VKZA 4MR9A 5LJIA 2ETXA 1GADO 4GHLA 2H5IA 2GJ9A 2P78A 3UUEA 4UM9B 4A0FA 3Q5GA 2WWGA 5AJZA 4MJXA 2AHMA 2PVSA 3GVIA 4PQYA 1U0EA 2JJMA 3CT6A 3M4YA 4FOTA 2PRKA 4WKBA 1Z5VA 2HBZA 4NZ9A 3UB3A 2IYYA 1EK2A 1KGDA 2GCPA 2XVXA 3ROTA 1A76A 3K8ZA 1IHXA 2XEPA 2PS3A 1F12A 3A06A 1PX0A 1PJRA 4FYMA 4GYWA 4R31A 4XI9A 3ZW8A 4N0DA 4MEAA 4YB8A 1X70A 2BEKA 4G3OA 4FJ2A 1FBTA 3GR6A 3IULA 1EDOA 2GK6A 5TQ0B 3KD3A 3KYCA 3SC6A 4DCOA 3WAGA 1MABB 2PCJA 3N7TA 4AF8A 2ZITA 1RRMA 5E1MA 4YQYA 4CKBB 2EP5A 5J3JA 1D0IA 1K3FA 1Y3HA 5TPWA 3WLKX 1U7PA 3ZTWA 2AZXA 5JROA 4HXEB 4JS0A 4QOHA 1KQGA 3OEHA 4FKMA 1WDKA 2XE8A 1KR5A 2YRXA 1NDQA 3I2GA 2YYSA 1S1CA 3IUBA 4QXAA 4TRJA 4TLDA 3AM3A 3QH4A 3SPXA 4PYQA 3KPWA 4MRRA 5AK0A 4RKWA 2WU0A 4YMIA 3LTNC 5ICGA 2RGDA 4B3SM 1MDFA 1LPSA 5AFSA 4OBWA 2I3AA 4GZLA 4JVMA 1LW6E 2X4GA 1B76A 3E9MA 3IS3A 3QVGB 4BQOA 5DISB 5AKZA 4CETA 4DG5A 4EUSA 1EXVA 4HLDA 5F98A 4PS1A 3K9LA 3UG7A 2PFSA 2QK4A 3KT6A 4YLGA 4DDKA 3VDUA 2VAWA 1RCTE 4N9QA 3TW6A 1TQ4A 5IAOA 2OBFA 4U6SA 2FG6C 4K9DA 4OH1A 3ZWQA 3EPRA 5C5CA 2VK2A 1PTJC 1UP4A 4XR9A 3EYAA 3A2LA 3C5CA 3NONA 2X7HA 3BL8A 4W99A 2NVBA 1SD1A 3ANMA 3KDSE 3TXYA 4XDZA 3VDMA 2A0YA 3S27A 5E6SB 5JH7F 1JFFB 1FVFA 2FUG1 3MJSA 1NNUA 2JPDA 3CE9A 1NG9A 3OZIA 4GX1A 1TCCA 5K09A 1D07A 1NLYA 3ZGZA 2F4NA 4PPQA 4TQAA 3OA2A 1IK4A 1F8GA 3FZNA 1P61B 2NPIA 3DHNA 4FMDF 3RLIA 4RJJA 4EGCB 5AVYA 2Y99A 3EGVA 2J1LA 3LXRA 4JC8A 1ESEA 2A3NA 5DM70 4C0XA 4NSRA 3NBZC 3NGXA 1BX3A 3QXGA 5JRDS 2F9MA 4LF4B 3LL7A 1Z6AA 1P6XA 3KVOA 3GRZA 3OETA 5HDQA 5K4GA 3U09A 4QQRA 4INAA 1VLQA 5EIBC 3HHEA 5EP2A 3AHIA 3BTSA 3JXEA 3FFXA 4RMIA 4ZHQB 5AVTA 4RULA 2WMDA 1QZTA 1Q0PA 1HGXA 4KUGA 1GGVA 2APLA 3AIIA 5F12A 2B4QA 2I91A 3A46A 5H02A 4GMHA 3ON5A 4QT4A 2QW1A 5BR4A 3FCYA 4MMXB 4PSAA 4YYEA 3M8KA 4AP5A 3EDRA 1E7WA 2WIJA 4E03A 3NIWA 5JHGB 1ABEA 3ABZA 1KH2A 3M70A 5IVKA 3FAZA 4DSNA 3GUCA 8OHMA 2XB4A 4NNOA 2FEKA 2QRVA 3N2NA 3NHBA 4IFEA 2VT2A 1ZXXA 5BWOA 1OH6A 4F60A 3HRKA 3K70C 1FU8A 1YB1A 1RMTA 3OPQA 5KEIA 1QTRA 1F2VA 3PWSA 1H4VB 2YN4A 2H2AA 3HBMA 3QA3E 3MPOA 4TV9A 5HFNA 2QYOA 4TKLA 4K46A 2EFJA 2WIAA 3T1HM 5LBTA 4DAEA 4DXHA 2IH2A 4CM8B 1ZD9A 1Z2PX 1C29B 3FHOA 3C39A 1X2BA 4NK5A 4I9NA 3R76A 1KXJA 1MJHA 2FH5B 4GPBA 3TL6A 1P44A 2BBSA 2GD6A 5I45A 1D1SA 3ACCA 3NIBA 1OAOA 2NXEA 2EW1A 2I7VA 4X66B 2VKTA 3WL5A 4EG4A 4BGVA 4WCFC 1XQ1A 5H83A 4ZHSA 2PSSA 4FDVA 2IDKA 1RKQA 2FKNA 4HB2A 4I4IA 5IXYA 3I2JA 1P2UA 1OH7A 4DUGD 3DLCA 3KSRA 4HAUA 1XQVA 3F5FA 3H83A 3MJEA 4JQOA 2Y1CA 3L4EA 2ID9A 3F49S 4OM7A 5CT6A 4E4YA 4UEOA 3FH0A 5EI5A 3JAMS 2VYFA 4WBNF 4TRMA 3GMTA 5IK2A 2BGUA 1V37A 5CD9A 3GFPA 4HH0A 1VBMA 4J43A 1U7DA 4OLJA 1KYWA 3M6AA 2L82A 3DWIA 3Q7QA 4G1VA 1PJTA 4NE2A 3GJ4A 4YJ3A 4XSGA 4ZRNA 5EWMA 4AUEA 3BRCA 4E1BA 1I01A 2WG2A 3V4RA 3SF8B 1A4UA 1H0HA 4ARZA 2V9ZA 2COKA 2WJZB 3EULA 4LC9A 4MS3B 1J5EM 1W2HA 4MWGA 5KQDA 4U2DA 4W1RA 1RZUA 2EL9A 3ZR4B 1TFRA 2EUCA 3PITA 5J23A 3A6ZA 4RV9A 3ESZA 1PWEA 1VI2A 1N75A 2DWQA 1U1GA 4KO3S 4GYYA 4LBZA 4GBJA 2EHDA 2BLNA 4KNVA 5EIAA 4CKWA 1C2YA 4G0VA 2Y0EA 4UBLA 3SBDA 1K92A 2FRXA 5BV2P 1OLSB 4GRIA 3EXG2 1ANKA 1VPTA 5IT9A 4GC5A 3KYDB 3LSTA 3E84A 1KMHA 5C8XA 2EU8A 2VRCA 2XUZA 3GHYA 4OHZA 3TZEA 3U37A 3KC2A 5BV8A 1GCOA 1U2GA 3LBAA 4C7JA 3VNAA 3FUWA 3L93A 1S3FA 5JO9A 4IVQA 4UTPA 4WRRA 2QTWB 3A3KA 2RHRA 3CW9A 1X8XA 5JI2E 2E5FA 1GR1A 2RK3A 2Z2JA 3GGSA 3ZKWA 4C07A 1VPWA 1A8QA 1QUTA 1F4LA 4L3VA 4LE1A 4ENPA 4RK6A 5FKJA 3W8FA 4EYGA 2FJ0A 4CISA 3O31A 1M5UA 1JQBA 1SXJE 1B0ZA 1XRNA 4L51A 3AM1A 1CRLA 2V96A 4H4EA 4KV7A 3AUUA 2CJPA 4QUJA 2C9OA 5FR1A 1P9RA 2GYWA 2ZUWA 2O0MA 4O2AA 1YS2X 5CB6A 5JD6A 3SJ7A 1YBMA 4I9HA 1JEJA 4MUJA 1G7TA 2VO1A 2ZVPX 3KYDA 4P7GA 3WJAA 1K6EA 4EZEA 3COWA 2AIRA 3QSGA 5L3QB 1K8QA 1DGGA 1XT6A 2JGFA 3B13B 4CDMA 1KYQA 3ENKA 1F51E 1DAKA 2OBBA 2PWPA 2ZE8A 4G86A 4L28A 3H3FA 4BNYA 4ENRA 5LQAA 2QHXA 4CM9A 4ILKA 4RU1A 3C8UA 5JFOA 1XAGA 2ZJ3A 4NS4A 4R2JA 1ZNYA 1YRLA 3ZY4A 4CLEA 2ZETA 2I4NA 3PFIA 2Q5JA 1IZ9A 3KXKA 2YIDA 1Q7CA 3GQBB 2CUTA 1V95A 4H1TA 2V6FA 4H7FA 4YUVA 3THYA 1LUAA 2RJNA 1PFUA 3B6IA 3BAZA 4B3HA 4F45A 2JGRA 5CB4F 3R5XA 1L2TA 2HQRA 2AXEA 4NPHA 3FLEA 3WMFA 5JO0A 5EYPB 4UE2A 4D3ZA 4MUXA 1O2DA 2I6QA 1KPIA 4GKVA 5B1EA 5FLXA 2FW1A 4YXWD 2XNKA 1N4DA 1VZ3A 3O4VA 2AOXA 3Q5DA 4JKYA 3QWAA 4U9UA 2IIBA 2OO9A 4B32A 4ZVQA 3QU7A 4KT0F 3GJ6A 3C4QA 1G6Q1 3ESCA 3K0EA 5DWVA 3ZCXA 3ZV6A 1DQZA 2VN8A 4R1MA 1S8AA 1SO8A 2VJMA 4H31A 4BQNA 4EQ6B 3CF0A 2I54A 2XA1A 3LNTA 2QS9A 3L8MA 4J90A 2A5GA 4X61A 3UICA 3W2EA 4COOA 3AP2A 2HHLA 5CEFA 3T3PB 1CJBA 2QRLA 2HWJA 3VZQA 2VYCA 3STYA 1H4SA 1H0RA 3QPBA 1MORA 5L4SA 3GGOA 1LS6A 3VBEA 2ZM6M 4D4LA 2UVPA 1V48A 2BF4A 2W0MA 2HL7A 3ENQA 3LKVA 3OJEA 3DTVB 2GNPA 4WACA 1XVUA 3T0GA 1AA9A 3K0KA 1JEYB 3TINA 1ITZA 4HMPA 3VR4A 1XRRA 2BHSA 2X7XA 3GJ5A 3AM5A 3E03A 3HI6A 3LUAA 2CLCX 1CF2O 1JA0A 2GM3A 2J3MA 1SQ5A 2QVBA 4K88A 4QPCA 3QLTA 1EEHA 1CXZA 1BW9B 1GGNA 2G9VA 5CK5A 3IIKA 4YT5A 2CV2A 2OZKA 1TZ2A 3K9OA 1HTBA 1N6PA 1Y1LA 2L69A 3I12A 4M49A 5EG5A 5G0VA 1NXXA 5U4QA 1F4PA 1GDDA 5JD3A 1NE2A 3EASA 2UZ0A 3D0KA 9GPBA 1Q7BA 3WLNA 1Y8AA 4FGSA 2C4MA 3B9QA 3OQVA 3QHPA 4M0CA 2QQGA 5HRCA 2D6FA 3IUQA 2AXQA 4PG6A 3G0BA 4CMKA 5BWCA 3X3HA 4LJRA 2VPWA 3L29A 4CQMA 4CGYB 2WC1A 1MJ5A 1YDHA 3F2IA 4HO1X 4UNIA 4EATA 3EC7A 1KEEA 1GPUA 1EG2A 2YJ5A 5DFLA 3ILHA 3VR1A 5IT4A 3EGOA 3GGCA 1AZLA 4YPVA 3B7ZA 3I32A 4NHOA 1I94M 1OV4A 4QDJA 3RPEA 4E2XA 3NHUA 1M9NA 4R8SA 3UCXA 5JQGF 1WOYA 2P41A 4XR4A 4RAOA 1QPBA 2ADFA 3GRRA 1II9A 4Q1EA 3CEAA 4L76A 4E5SA 4ZZIA 3ZOKA 4MUGA 1P6QA 1RYZA 1T5IA 2E6UX 4E6EA 2A8YA 1ABBA 4DR3B 1UBNA 1EFTA 4JEHA 3THWA 3WIBA 1QP4A 1FLAA 5DNYA 3U4IA 1ZMRA 2HLDD 4A16A 5DNUA 3COPA 1EDZA 2VBIA 3SHFA 1UZUA 4RF5A 3VO1A 5L95A 4BWFB 1U02A 2XNDD 1L5ZA 1X15A 2IIVA 3AEUB 1J42A 3BE4A 2GHIA 4H7IA 5T4FA 3SSOA 4PT5A 2H3HA 3JWHA 2V5AA 4OVZB 3K2BA 4A0QA 1OAOC 1P9OA 4IS3A 2RHWA 4DNFA 1GZSA 3VYTB 1UUFA 4FWGA 4TTJA 2PXHA 3G1WA 1I7PA 2V4MA 1UEIA 3GGDA 4ZO7A 3S1LA 4BUCA 2W43A 1XDBA 4JLAA 1ZCZA 1N7IA 4EQZA 1XEXA 2JGNA 3K1YA 4XUEA 1M34B 2DSNA 3FLBA 1NJ6A 4GVLA 4DN6A 4M86A 5BW4A 1I4OA 1DLJA 1Q1BA 1LVGA 2X9NA 2AN5A 2QB5A 1ZHOA 4MJLA 5DNWA 4A92A 3NTUA 3NWLA 2OCYC 5DM2A 1B16A 3UHJA 2B7LA 3MT8A 3X1JA 3D2LA 1DEOA 1IB0A 3B2NA 3L79A 4XWAA 3EN0A 1D8TA 3CEPB 2UXDB 4IR7A 4B5LA 4RPHA 3THSA 3RKSA 4KMSA 5E3IA 4LUCA 3FTDA 2KNAA 3K9PA 1JHXA 2RHTA 3DVAA 1YF3A 4PZLA 1GUBA 3ZE8A 1GNSA 3I37X 4X92A 4YRAA 5I9LA 1PUXA 2O5RA 3IO3A 3ZTYA 2VFAA 4KI7A 3EIWA 3VU8A 3WWEA 4DMKA 1D6SA 4HWGA 5CT5A 1M2NA 4D9GA 5REQB 4XBOA 1MV8A 1Y81A 1PLLA 3F47A 2C5LA 3AB8A 1ZWLA 2WAAA 2Q3HA 4MTCA 1RIIA 2HO4A 4HLUA 4QARA 3RNOA 3W4JA 3WOVA 3DL4A 1YUBA 3WNQA 1R0BA 3JQFC 2FPMA 1XLWA 3W7BA 1WBJB 1Z28A 2O3TA 3BIJA 3EEIA 3G7UA 4GECA 1RWVA 4PSKA 3PC6A 4GP9A 3BRQA 3N1UA 4LTDA 2JLCA 3VSAA 1B23P 2Q8PA 3OY2A 5LQDA 4C7VA 3SWWA 4J1TC 1IBMM 1Q0TA 2P5UA 4CLXA 2JBAB 1D6NA 1VHWA 3OUTA 2PZAA 4OI2A 1OFVA 1JXMA 1UZAA 3GLQA 1AH2A 1R4NB 1ZL2A 2NN3C 1USVA 1Z5BA 2GF9A 2AHOA 1BJTA 3KJNA 3IR5A 3LYAA 4M8SA 4RXUA 3W3AH 1C3EA 4UEQA 4X20A 4EFMA 2H00A 2XLBA 1XHFA 3DZ8A 3H0CA 4K86A 4NARA 5KAMA 1R74A 1U28C 1FNCA 2G5TA 3L7MA 2FPGA 4FI3C 1GSOA 4PCUA 5FTNA 3GUUA 2XE4A 4G9GA 4GI1A 2PLAA 5EE1A 3EY9A 3JQAD 2F5OA 1ZQ1A 1NFRA 2WPDA 4WNAB 4JI2B 4ZV7A 2W48A 2QE6A 1OLUB 2NYUA 2GKOA 3B1FA 4RKYA 4KQFA 1A27A 4R8LA 4YQEA 5C7YA 2OO5A 5AVUA 3I92A 2R85A 4FXPA 5B7QA 2FE1A 1IHYA 3HKBB 4WADA 4ECEA 2C2ZA 2CB0A 4DWOA 4URVR 3UYLA 3L4JA 4JYBA 1N6NA 2RI0A 1KARA 2FUG6 5CM9C 4EABA 2DHEA 1QGYA 2HU7A 1T6YA 4GKAA 2Y20A 4OHRA 4YAIA 1G8FA 1C8VB 1VYVA 2JI7A 3HJTA 3U3RA 2GPJA 1Z13A 2X5OA 3L8CA 4WLEA 4YP5A 1V4BA 2EJUA 3UNXA 4N49A 3G0OA 4YIKA 5BQ3A 2NO0A 1O89A 2RJOA 2QQFA 1W5EA 3VNSA 2O2DA 2PQMA 2ZRMA 2V97A 3BA6A 4ZO9A 5FUVA 4P93A 3RVDA 3SY8A 3ZVLA 1HYQA 3WAJA 1M2HA 3WGYA 2W98A 2QNRA 4JNCA 3H87A 4DARA 3O82A 2HJSA 4ABYA 3SN6A 2ZR8A 1E59A 4BNIA 1CIJA 5I7FA 3T5AA 4OQZA 2FEOA 1RPNA 2YIVX 2XMRA 1RADA 3DV0A 2HQBA 5IP5A 4PM4A 3CZ9A 5FBHA 2C9CA 1EGMB 4S2EA 3P4UA 3EXIA