3TWZA

Phosphorylated bacillus cereus phosphopentomutase in space group p212121
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
Knots found
sequence length
391
structure length
390
Chain Sequence
KYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 139
structure length 390
sequence length 391
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3twzA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3twzA01
3TX0A 4LR2A 1E3CP 1SHQA 3TG0A 1ALHA 3NVLA 3SZYA 5IJQA 4UPIA 3T02A 4FDJA 3WAXA 4CXSA 1HJKA 3A52A 3WAYA 1AUKA 5DLVA 4KAYA 2X98A 4LR9A 2W5VA 3WAVA 1EI6A 2W5RA 4LRCA 3LXQA 3NKNA 3B5QA 3SZZA 2W5SA 2W5QA 5INHA 1N2KA 1P49A 5K4PA 1O98A 2GSUA 4YR1A 3NKPA 1FSUA 3OT9A 3BDHA 1ED9A 1ALKA 4UOPA 4NWXA 5LRNA 1AJAA 1URAA 4KM4A 1E1ZP 2GLQA 1ANJA 2IFYA 2IUCB 2XR9A 1SHNA 1HDHA 2RH6A 4KJDA 5IJSA 1ED8A 1KHNA 1ZEDA 1AJCA 3UNYA 1KHJA 1ZEBA 4B56A 3M7VA 1EW8A 1E2SP 3MK2A 4MHXA 1O99A 1E33P 3KD8A 4LREA 1ELZA 4ZG7A 1KH7A 4LRDA 4LR8A 3M8WA 2G9YA 3M8YA 5HRTA 3UN3A 1ANIA 4GTXA 1AJDA 1EQJA 2W5WA 1KH5A 3MK1A 3ED4A 4TN0A 1KH4A 2W5TA 1EJJA 3UO0A 4UORA 3IDDA 1ELXA 3Q3QA 3IGYB 5EGHA 2IUCA 3IGZB 4LQYA 2VQRA 3E2DA 5LRMA 5DLWA 4CXUA 1AJBA 4LR7A 4ZGAA 3TWZA 4CYSA 4GTYA 2GA3A 2ANHA 3NKQA 1Y6VA 5C66A 4LRBA 3NKRA 3DYCA 4CYRA 1ZEFA 4UPLA 4UOOA 3UN2A 4FDIA 4KJGA 5AJ9A 3BDGA 4LRFA 4GTZA 4UPKA 5KXAA 1EW9A 1KHLA 3NKOA 5LQQA 2W5XA 4QAXA 3T00A 1ALIA 1KH9A 4LRAA 3NKMA 2D1GA 1ELYA 4GTWA 2ZKTA 1B8JA 5LIAA 3WAWA 3BDFA 5GRRA 1KHKA 4CXKA 5L0BA 2XRGA 2QZUA 4MY4A 5TJ3A 2GSOA 4UPHA 5L0KA 2GSNA 1HQAA 4MIVA 4KAVA 5DLTA 4ZG6A 3UN5A 4N7TA 2W8SA 1Y7AA 5GOVA 3M8ZA 3CMRA 3BDGB 1EW2A 1URBA 4NWJA 1K7HA 1N2LA 3WBHA 3T01A 4ZG9A 3DPCA 3MK0A 5EGEA 1ALJA 5L0EA 2W8DA
chains in the Genus database with same CATH superfamily
2DGTA 4TYBA 3G9CA 3LWMA 1NKEA 1APSA 1LWCA 2GC8A 3S01A 2W2NP 1ALHA 2A2DA 2HZAA 5IS2A 5LJ3Y 1DTQB 4EI2A 1TL1A 4J9RA 4NWBA 3U1NA 4FDJA 2KVIA 5CXTA 3TUPA 1RBLA 1K0TA 4ZP8A 4PWDB 2BANB 2HIQA 3LW5C 4H4KC 4G65A 2DY9A 3N6MA 4PQUB 1TL5A 3KG1A 5IQQA 3GFHA 2HBRB 2FGCA 5K8MA 2M0GB 3I32A 4U9RA 4LRCA 4C6AA 5IT0A 4DLEA 2RMLA 1T95A 4DL7A 3K0JA 4ZVEA 2HNDA 2HS4A 2IM0A 2ZBQA 3W62A 2D3OR 2XRGA 3W5XA 4LT6A 4OX7A 4NCGA 1Q7YT 3UR3C 4UOCA 4WXOA 4F3OA 2VONA 1I94J 1FT8A 3K5MA 4PCQA 1DTTA 3AHPA 3QNWB 2HQCA 2YH1A 2FJXA 2B5JA 2MKIA 2HWIA 2ASLA 3ZZUA 3FSXA 4KQZA 2XHCA 1ACMB 1XWLA 3NBPA 1HBOB 2RQMA 3NG8A 4KBIA 3OL8A 2MLYA 2ZUAA 2LQBA 3O6QA 1KLMB 3EZUA 1REGX 3C19A 3UNGC 3GSDA 1B99A 2MQQA 1RAAB 4PUOA 2F7VA 1ED8A 3KJNB 3GSIA 1V3RA 1EW8A 2XGQA 1L3KA 1O8BA 3L7PA 5DQIA 3UE2A 1RT4B 2DH9A 3I82A 1KH7A 3MCOA 5DQGA 1CJUB 3NCRA 5CYQB 4ZIWA 4DR2J 3IAS9 3CMES 2BE9B 1P6TA 2WW4A 1X9WA 1TMMA 1KWMA 3MEEB 1KVKA 1XC9A 2KFNA 4X4NA 4OJHA 1YKWA 4S0MA 1LWEA 2V50A 2HHUA 5J2PA 3W8PA 2ZH8A 1YQHA 2ERRA 1O6XA 4DL3A 2KM8B 3N0VA 4O3PA 4DN9A 5IT9U 2V2VA 5F0UA 3RR7A 4TLRA 1AJBA 2FUG9 2JNJA 3PJXA 4IG3B 4OZ2A 4F8RA 1XR7A 2HAIA 2DGXA 3V2UC 5KFTA 2XMTA 1S1VA 4ZK7M 2W7OA 3NKRA 3JSYA 2GAHC 4N8OA 2VFUA 1KP6A 3TZZA 3FBFA 3BDGB 2E5GA 5DGBA 1Q82T 1DJ0A 2DNKA 2VBWA 3PRVA 4NLVA 2Y1JA 3V5RA 4JI0J 1S9EA 1MROB 1SXLA 2AYGA 1VIOA 1HYSA 1K0VA 3BM7A 3KMSA 2CADA 5HROA 1EW9A 2H48B 2P8IA 5LQQA 3ETMA 2N3LA 1NO8A 2VL1A 4FNHA 4B3TJ 3KLEA 2KYXA 2MSTA 3V6KA 1IM6A 3IWLA 1ZA1B 3WDOA 3J7AN 3R2CJ 2BKOA 4RJVA 4DPYA 3ZZRA 1IBMJ 2RU3A 2BJ7A 5IM0A 3UD4P 3WAWA 4NLPA 3D2WA 2IAJB 4KH1B 7FDRA 1RTJB 4RW6A 2BJDA 1WOPA 3K8VA 3QT8A 2V4JB 4I7FA 2R7XA 5D15A 1S57A 3M8QA 3SEOA 2CAJA 2GSNA 2QX0A 1M1HA 1RAFB 1YGYA 1FFWB 2KO1A 2YQ3A 2E5LF 1QAIA 2HFVA 3CJTA 4PWWA 3HHLB 3QFWA 3VAIA 2HGNA 1XMOJ 1PYTA 1UVIA 1YRUA 2VDHA 4DR4F 1KFDA 3OR2A 1WOOA 5KFJA 3T01A 2YNHA 2JC0A 2V4RA 2NUHA 2AJ0A 3MECA 4IFYB 2CPJA 5EHHA 1IVZA 4DZ6A 1FJ7A 4WJBA 1HBUB 1R3NA 2GGPB 4IFVA 1N56A 3KKFA 1YSJA 3NS5A 4AQYJ 4RWXA 4LJMA 3IGNA 2GZOA 4DV3J 1OMSA 4ZPTR 4OI1A 2JWNA 2AKWB 3EPGA 4LF8F 3BGLA 2PDAA 2W9CB 1B4SA 1HW9A 1RKIA 4ECSA 4RNHA 2DNNA 4RNNA 1VGYA 2NZCA 4BHQA 4K4WA 2YX4A 2KDOA 5ITHA 4DR1F 3KLGA 3PCOB 3HDSA 5F8MA 1I5OB 2E44A 2YQ1A 5A2QU 4DSFA 4J9PA 3GILA 3FSYA 4Y6IA 2H4WB 1OWXA 3BH7B 1S4EA 4J37A 1GNKA 3G8QA 1TP7A 1QJHA 2DNHA 5AXLA 4C3MA 1WSVA 4UOGA 5B09A 1PCAA 3VAJA 2Z2YB 5B0FA 5IXUA 3ZZZA 1WD6A 4IFVB 1IKVB 3OSNA 2Q79A 2EK1A 2C2ZB 3DRPA 5LSOA 3OSPA 2BQUA 3SQGA 2V8PA 1RWWB 2Z4PA 4RR5A 1FJGF 1SV5B 1OQ6A 1DQAA 1TAUA 2WSCC 4M63A 2HHTA 2YY3A 3BDPA 3C66A 3KOAA 1ELZA 4DPUA 1ITPA 3DGVA 1A9NB 1JLCA 1NBEB 3POTB 2CYYA 2NCKL 5DGAA 9RUBA 1UVLA 4QQBA 2IBOA 2DGSA 1VBKA 4ID8A 2ZD1A 1TUVA 2HFOA 2QYCA 2YNIA 3EX7B 4LMZA 4NLYA 3TANA 2FJEB 1FKAF 3BKUA 1IKXA 4PG6A 1K8AT 2NXNA 4LSNA 1RT1A 4PWUA 1S10A 1JMTA 3T41A 3M6XA 4OJGA 1U1PA 4ED2A 1PYSB 2HRYA 4KIAA 3UQSA 4USJC 4CO2A 4LQYA 2CPFA 1DURA 3U7JA 4IH5A 1Y5LB 4JI2J 2GIRA 2BVZA 2UU9J 3KK3A 3G8SA 1VRQC 2V4JA 5DG9A 3CC2S 2XZTB 4Y28C 3CC7S 1FKOA 5DDPC 2B0GA 4LF5J 2ZBRA 2RE1A 4OZ3A 1IR0A 4YDDB 4I6AA 3W60A 2B43A 3EXYA 2MKYA 4X65F 2YNGB 3CCES 4C8ZA 3B8HA 4LRFA 1LW0A 4NLQA 3UCUP 3D5MA 1RCXB 2WVEA 2CQGA 1IBLJ 3CD6S 1G2EA 2D1CA 1NDPA 3G8TA 3TQ1A 2CWKA 1KHLA 2E1CA 4KHPF 4LF7F 1UFWA 2PSZA 1CC8A 1JQGA 3ICLA 2YKNA 3D66A 2XQCA 3FUYA 2RSQA 1KQKA 1F6TA 5D6GA 3NKMA 1VR6A 2LFVA 4CI0B 2NS1B 5BYSA 1LFPA 4NYZA 2OH2A 2D3O1 1IBKF 2EXUA 2AU0A 3BDFA 1X0PA 4NA2A 2UXDJ 5GRRA 3GP9A 4AL6A 3SSQA 2V34A 2NLWA 4Y2KA 2FTRA 4AE5A 2RS2A 4UUWA 3AA9A 3ZTPA 2FLOA 5FDLA 5HI7A 3SDEA 1WTBA 2H4YB 2DHAA 4G1QA 4EGLA 4RU9A 2ZH6A 3M32A 3J81Y 2QFJA 2V9KA 1ULRA 2M7SA 1C0UA 2OUGA 4NOHA 4U8YA 1WDDA 5DQHA 2VIHA 1YDLA 2APOA 1RWUA 3PYEA 5K5MA 4WPAA 3R7SB 2B7BB 1JKHA 3DMJB 4QBUA 1EJ7L 3H42A 3M6WA 4ZG9A 3VVUA 2Q6BA 3R5JB 2AJ1A 5L0EA 2HHVA 2NREA 3TEGA 1U25A 2IIHA 4JI1J 1AT1B 3DRYA 3TX0A 3MM5A 1WKJA 2A10A 3HFVA 4OHWA 4X66J 6FD1A 2KXFA 3DXSX 1N5SA 4C0BA 2MKSA 4WYLA 5BYRA 1VK3A 4DQRA 1QAYA 2GV1A 3DRPB 3GFYA 3KWMA 2CZ9A 3EE3A 2QFIA 1W2BR 1U49A 2HMIB 3RB4A 1KQFB 2IY5B 3J7ZT 3BBBA 4Q2MA 4MJKA 3OJSA 5E2QA 4MAKA 3EZ5A 2UV8G 1S97A 2KZZA 1Z2ZA 3QO9A 2R7QA 3BDEA 3ET6A 1U1OA 4PXCA 1N32F 4V1Ak 5EUHA 2ZBPA 1VFJA 1U1LA 1P49A 4B9TA 2HIYA 4CH1A 2C2MB 4F25A 2VOOA 1CBKA 1YZ6A 1HBMA 3NKPA 1SJ1A 4DF4A 4IOBA 5HVHA 2NPIA 3KHHA 3V4IA 2V9WA 4DSLA 1C4AA 2D74B 4ZHRA 3CJ5A 4W92B 2YKQA 4A8SA 4OYPA 1YJRA 1XNRJ 5GADU 5HL7Q 1VRTB 1U26A 1N88A 1FJCA 3RZAA 4IQMA 2ALZA 1YITS 4J9LA 2O1PA 4ELTA 1NPPA 2N7YA 2ZC3A 3HVTB 3LOUA 3NKYA 1GXLA 3QGPA 1QTNB 1RWNB 3ILIA 1VC5A 1FK9B 5KG0A 2QA4S 4EYIB 2V69A 1Y3KA 4EUVA 5H9FK 4EZ9A 2FHJD 2FLPA 1RWVB 4P73A 3BYRA 1RISA 2MKJA 4F04B 2YPZA 5E3AA 5LSRA 3ILJA 1I51B 2MZ1A 2JLEA 5GVQA 2UUAJ 2LEAA 2KTQA 3NXZA 1E2SP 1Y7PA 2K1RA 2OGUA 4QPTA 5I42B 1RA6A 1E33P 3QAUA 1T9WA 2DR8A 5KFOA 1LWFA 1HQEB 3IC1A 3FSIA 1FD8A 1MNEA 1P1LA 2OD6A 5E33A 5L1JA 4JI4J 3HHNB 3QJJA 4PWDA 2K2PA 4F67A 2W5WA 3HHKA 3DRRB 1RTIA 2ZFHA 4UZCA 1SH0A 1QVFR 3OLAA 3K59A 1TK0A 2IRYA 4FYVB 4IKAA 1C0UB 1WORA 5HQLA 4DV7F 1EIYB 2AJFE 2GJ2A 2Q3PA 2RQ4A 2RT3A 3HULA 2PA3A 2LXUA 2RJZA 2N7CA 2CJKA 4O4GB 4DSEA 2VICA 4K4UA 2B9YA 2XYHB 1MG7A 3I0SB 2HS3A 1LXJA 2ILZA 1TVRA 3B4MA 3CEDA 4ICLA 4HDHA 4K2XA 4RX6A 3WBZA 5GAGI 2X7IA 3MF5A 2HNZB 3H20A 3RBZA 5KFZA 4FDIA 2P6SA 3FMBA 2NZ4A 2OPRB 4DOZA 4M95A 4ED6A 1TV6A 3JQKA 3E01B 4ZLPA 4ZLNA 5RUBA 2PD1A 3GLJA 3L7UA 3P96A 5LT5A 2CIMA 4CTAA 3VR1A 4ZP6A 1TUGB 4I2QA 3OTDA 1S1VB 1XR6A 3QT5A 3KNGA 1CULB 2Q1LA 4USTA 4ETXA 2H5IB 2BE2B 4CLWA 3ISNC 3EVMA 3IBCB 4DL0C 2NUUG 4DV4F 3AJDA 4KHPJ 1F3FA 2XBPA 1M1KT 2BQ3A 2M5YA 4PG7A 1X9SA 1KHKA 4E8UA 2HMIA 2XI3A 3EUNA 2HKEA 2JRSA 1GQEA 2ZOFA 3NY0A 1RP5A 4QIEA 4DPOA 3MR2A 2OIHA 1R7IA 1CVJA 1U8SA 3Q2TC 1Q8IA 4ZCMA 5IOLA 4A48A 2E9RX 1RK8A 5A8WB 1PJ6A 4NCAA 4PG5A 2YWWA 4KY3A 4LFCF 2AD9A 3MDFA 3H5XA 3CMRA 2AJ2A 3BO4A 2WSFC 1JLGB 1SJQA 4DR5J 1X4DA 2NR0A 1AYEA 5SZTA 2B4PA 1KDNA 2H5JB 2DCUB 1U1MA 2RNEA 4B9LA 3MMBB 1NHKL 2YNFA 2HNYA 3DOMB 2XY7A 1H72C 4I7FB 1AZSB 1U7LA 2OEKA 3H8YA 2D7SA 4ZHRB 1H38A 3EGZA 1WSRA 2W8DA 1E3CP 2IMWP 4Q0BB 4WU3A 2Z0GA 1RT7A 2DGUA 4HTIA 4C2MA 2W2QP 4UT4A 3MI7X 4CH0S 2JEJA 1P9QC 4ZITA 3A3NB 2WVFA 4MKVA 5IM0B 1KLMA 2MZRA 2UP1A 4E2FB 3UFCX 3EGWB 1RT2B 4KHRA 1EKRA 3WAXA 1PBUA 2KHCA 3L95X 4ILRA 3HSJA 3WIUA 3PYGA 4JI5F 2XSJB 2B8QA 2B5JB 2W2OP 4DR5F 1QVGR 2Y9HA 5C5JA 1VQ4S 2F9JA 2XLIA 4O3SA 2HVIA 4ELVA 1XR5A 3LXQA 2DNYA 5KFSA 3N5BA 2VV5A 3SZZA 1UEVA 3E51A 1Y9OA 2W5QA 3J7YI 5INHA 1UPMB 5J1EA 2NSCA 4OX8A 2VKRA 3D4JA 4LUBA 3S1TA 5B0DA 1Q1KA 1UA1A 2DPJA 2Q66A 1HBNA 3GIRA 2E1MC 3O3LA 1U1NA 2VQEJ 2Y3YA 1NB7A 1HHTP 2VG6A 4RUCA 4FXDA 3IP0A 3CDUA 5L8RC 1FRLA 3FMWA 1URAA 4PEOA 4TY8B 1OO0B 2FHKA 2ZZMA 3NMAA 3AJ2A 2D9OA 2PC6A 2YX1A 3R7NB 2B6AA 1S77D 2WBRA 1HHQA 1UWBB 3W2WA 4EU0A 3T1HF 3EICA 2AF6A 4ATNA 4Y00A 1PC4A 1WACA 1NK9A 3SZYA 1WF2A 2CZ4A 3OV7A 1SQFA 3UNYA 4U96A 3FBEA 4C8OA 3HHLC 2DNMA 4RZRA 4GVLA 3MGJA 1M5KC 3T1YF 3RB6A 3BGRA 4JYAJ 2EVZA 5CAAA 3ILOA 1KTVA 2KKHA 4X4QA 2R9LA 2I5JA 2CPIA 2KXHA 2DCLA 3C6UB 1BQXA 4ZPCA 1BHNA 1CJKA 1BWEA 1IWGA 2KI2A 3DYAA 1FFGB 4Z7CA 2CQ1A 1R0BG 1Z4UA 1X5TA 4MK9A 1KH5A 3MEGA 1RI7A 1YI2S 2QSWA 2VA3A 1LXNA 2EKNA 2Y8WA 5KG4A 1IKYA 3QGHA 2BE2A 1Q16B 3I5CA 4WP8A 2LDIA 3PYDA 1RYRA 3J81j 1L3TA 2J6TA 3IWXA 2IVFB 1T94A 4Y65A 5E0OA 4F3MA 1CJTA 3CF5Q 3HX9A 2J0QD 4B3MJ 1C0TA 3M9MB 4ZGAA 1IR2A 1NXIA 4RW9A 3CSKA 1RTJA 4RW6B 2KRBA 3K5LA 5HJXA 1MWZA 5E3CA 4USKA 2CPYA 4TU9A 2BUNA 4ECUA 2V8DA 5C2GA 3JTPA 4JV1A 3L7OA 3MR5A 4KKOB 1U8WA 2IRXA 2A6MA 2VKZG 1OY9A 1T0TV 5HMZA 3DLBA 5D3GA 3HF5A 4X84A 3B54A 4K4VA 1RUSA 3HSZA 3EGVA 2HWTA 3JSMA 4DFMA 3ZZPA 1U6FA 1QDUB 1SL0A 4WBFA 1XN9A 4QAXA 3KHRA 5D0EA 3FZ2A 4WP9A 2V67A 5EWGA 3CCRS 4OI6A 1J5EJ 4DPXA 1SKSA 4UOHA 4IRDA 1HNWF 1XIQA 2FYXA 2V8GA 2J0XA 3W2VB 2ADBA 1S48A 2C3YA 1LW0B 2MDAA 3O44A 4U8VA 4FF1A 2E9ZA 3PYFA 3LPYA 5HP1A 1UW4A 2VQFJ 4LBPA 2HHXA 4L72B 4MY4A 1S1TA 1Y0HA 4PR6A 2PIIA 5H9EJ 2OJ3A 1LK5A 3M8PA 4KAVA 1KVJA 5GOVA 2LA6A 5IC4B 1SPBP 1FKPA 4R8UB 2IVMA 3DOKB 3M4XA 5HANA 5MAOA 1YVFA 3PW4A 2E5HA 2OSRA 4P2SA 5KG7A 2ZZNA 1MMLA 3GIIA 1HPZA 3OR1A 1NM2A 2E5JA 1JLFA 1OY6A 1NZAA 1S49A 3HFZB 5I4MA 2R42A 3SBMA 2BA9A 1S76D 3CCUS 1G6BA 4O44A 1C4CA 1CULA 2IA0A 1I1GA 3ONQA 2L3MA 4M5MA 2ZDOA 2MKCA 3S8SA 2JHEA 3DDKA 4P72A 3W2WB 4DL2A 3T02A 3OXGA 2CDRB 2RS8A 3R6GB 3HD2A 4BC9A 1RU2A 4GMKA 5CABA 1X5OA 1JJHA 1FI4A 1JLQA 5L1KA 3TAQA 2HEKA 3KJQB 3UD3P 1Y3JA 2X98A 3HM9A 3CIMA 5L1IA 3N6NA 1OYEA 3W3SA 2HGLA 3GG1A 4CLLA 4DZDA 4YR2A 1FE0A 2HBYB 1LWXA 1RJJA 4NEZA 2DITA 2VZ9A 4ANCA 2ZH4A 1NJXA 4Q43A 2KN4A 4NRTA 4ZVPB 4ZIVA 5C2CA 6AT1B 1VHFA 1JLBB 3GYNA 3U02A 4CYUA 1RHQB 2HQFA 2CQBA 4W98A 4QWDA 3R8YA 1WHYA 3VGVA 4ERDA 1IKYB 1Y5IB 2CG4A 3Q8PB 4RU2A 2MY8A 4YQWA 3BSCA 1KC8T 3DKDA 3TP2A 1D09B 4FXVA 5E3RA 1GTEA 2UXCF 4OJ1A 1T9TA 5L39A 3EJMA 2NXJA 2EFNA 4OZJA 3BS9A 4QIGA 4YMEA 2ATCB 3PRDA 4HHJA 4B3RJ 5CH7B 4WF9Q 4CO5A 5HQ8A 3CUNA 4LREA 4OX6A 1EAYC 1ZH5A 2FJBB 3BREA 3O1LA 2GA7A 4H4MB 5AXKA 2OMLA 3BBCA 1XNRF 3O5TB 3M8YA 1L5UA 5M2PA 2MPUA 1AXQA 2V8VA 2VFTA 2ZWPA 5K20B 3IR5B 3OXLA 4AD6A 2UVUA 4EBDA 2QL9B 2R7WA 3KLEB 1R8PA 4JI2F 1Q5VA 4X64F 4GC6A 2UVWA 5A76A 1XNQJ 3QRQA 1VRTA 3A8IA 4A4JA 2UVVA 4FXWA 5CQGA 4WE1A 2Y1RI 4I6YA 5EGHA 1FHTA 3LO3A 4FBUA 3Q83A 4NCGB 1X7VA 4RBVA 2QN6B 3R5CA 2VG5A 4C8MA 3SQOP 3T19A 5L1LA 4PUOB 2PFDA 1S6UA 4OLPA 4EYHB 3VGTA 4IUFA 2G4BA 2DEIA 2HRUA 4JI4F 3PDNA 4ES2A 4NE9C 3NAHA 4G6VB 3DYCA 2BJ9A 2GQ2A 4CRJA 2WONA 1H2UX 3WQPA 1CLFA 3ETOA 1ZEFA 2JLGA 3FRZA 1LWFB 1XNQF 1SJ4P 3N5FA 3IRXA 2B9EA 1VQOS 4K4YA 3BGOP 1JXLA 3BV8A 2X1AA 2F9DA 5KTQA 2ZH2A 1HNWJ 1X8DA 3EVOA 1VMBA 1RTIB 1Q95G 3JQMA 2DNGA 5KFMA 5GADI 4Q44A 5F9NA 2GHPA 4K4TA 4DSIA 1F2HA 1KVIA 2W5XA 2H51B 4X62J 4I0WA 3MM5B 3CCTA 1QLNA 5SUHA 4IYQA 1ZTWA 4KYZA 3W64A 4Q2LA 3ZTOA 4A8OA 3W5YA 1YJWS 4P7TA 1GMWA 3OFEA 4K4SA 3A8KA 1V3ZA 2FLLA 1EP4A 4MKYA 2ROGA 4HDGA 1E6VB 4NMLA 1NSKL 4ZLLA 5B08A 1NJZA 4DSJA 2EC0A 4B56A 3UDVA 3C15A 1IBKJ 1X0FA 4CZCA 2LU1A 1OY8A 1WKKA 3AH6A 3ENQA 4L3NA 2M70A 4ZG6A 3MM6B 3RAMA 3GYGA 5JVHQ 2BACA 2Z58B 2EK6A 1UA0A 4ECYA 1KD1T 4M5GA 1K7HA 1ZAWA 5EGEA 4RL1A 2C3OA 2GX8A 5KFRA 4CTAB 4DPWA 4P52A 5CD4A 4KFBA 3I55S 3KK1A 3KYLA 1NKCA 2DIVA 3Q89A 1S6OA 3VQTA 3HZEA 3RBEA 1VJWA 3HO1A 1HWKA 2EFGA 1IKVA 3MM8A 4NLXA 3BO2A 2Y1IA 5KFHA 4K0KJ 3GMGA 2H3EB 1PGZA 1AFJA 4BWMA 1BY9A 3G6XA 4UPIA 2YPYA 2ZKUA 1UVNA 4OHXA 3AJ1A 1FEEA 3FDSA 4L73A 3SCLE 2HFZA 3CJ0A 1XMOF 2I6WA 2VFVA 3BN4A 5HAOA 1CJVA 4DR4J 3Q22A 3A52A 3LWLA 4QW8A 1TKXA 5F8HA 3P6YC 2W5RA 2FGOA 4FN5A 4J9UE 2HFUA 4HT7A 1WDTA 1U1QA 3DLLQ 4FVCA 3PO4A 3MOJB 3ISZA 3NOCA 4R8UA 4J9OA 1GTHA 1JNRB 4DI6A 2HFSA 2DKOB 3W9IA 1U1RA 3TO8A 5A0YA 2YKAA 3K5NA 3VAGA 1BQMB 2K06A 4OYBA 5JVGQ 1MWQA 1W26A 1W2IA 2GHWA 3MPYA 2G2OA 3W66A 4C0HA 4F0MA 5T14A 1RHUB 2B51A 4OYOA 1XERA 3WX4A 1HLWA 2KT2A 4KJIA 4Q45A 2BDPA 2O3DA 4YN3B 4WE1B 2FD2A 4ECVA 1ZTTA 1RAJA 4NA3A 2XZWA 2EBEA 3IBFB 4PXEA 2MQPA 3J80Y 3HT3A 3K57A 3BKFA 2YNIB 3AB4B 3PKYA 1TL4A 2NPFA 2YWKA 1U48A 1SJFA 1JJ4A 4B3OA 2E29A 3DGPA 3WZ0A 2OD4A 2QV6A 2LDYA 2G0CA 2WVCA 4Q8EA 3KD8A 3M1VA 2UXCJ 1P27B 4ZPDA 5IWAJ 4HACB 1WUUA 2AHOB 5L46A 2UU9F 2DR6A 4NXNJ 2GVDB 1AROP 4M5JA 1QE1A 2R7OA 3P45B 3OL7A 1XK8A 3G86A 4DG1A 1FKOB 4EZ6A 3MK1A 3MCNA 4ZVHA 4FF3A 2YKMB 1BMQB 1NU4A 2VB6A 3W2VA 3IGZB 2AEMA 3CJ4A 4DFPA 4B3SJ 2B4UA 3NNCA 2M8HA 4WIQA 3CCLS 1GMUA 4TY9A 3HD1A 2EFVA 2C3PA 2OFHX 3NGUA 4QZVB 3QGGA 2J7WA 4CYRA 1HQUA 4UF4A 3QJPA 1DY3A 3RYLA 4YS2A 1NZ8A 4HEA9 3MPUB 1R0AA 1JLFB 4OHVA 4KV8A 1ZS6A 4UPKA 2B7CB 1P9YA 2KFYA 2WB4A 4Z7YA 3SZ2A 3RBXA 5ETOA 4ZPBA 1X4HA 2PO4A 3TUZC 2ZOMA 1N34F 1P1TA 4P10A 4MKBA 2MEWA 1EB0A 4HLBA 5DM7Q 3Q8UA 2N82B 4F0HA 5F8LA 3D1QA 4P74A 4DUZJ 1HARA 1N5YA 1DZ5A 1F5BA 3CDWA 2L9NA 5AJ3J 5L0BA 4QIWD 2DB1A 4ZPAA 2W2MP 4QU7A 3T6BA 2GSOA 4UPHA 1R8BA 5L0KA 1FA0A 1YRTA 3UVJA 2KG0A 1LFWA 3R27A 1FERA 1HQUB 3EVWA 2UUCJ 1S1UB 2R7SA 2MMYA 3Q8SB 3GPAA 2R3VA 1VISA 1NH7A 3CPWR 4NWJA 3AOAA 4TNOA 1YK9A 1J2VA 4QWCA 1D9FA 1VRUB 1B0TA 2KVQE 2XMAA 2DIUA 2C3MA 2OSQA 3NCQA 4K5RA 1PAUB 4P75A 3OBIA 3TRGA 5BJRA 2XLJA 4DV3F 2R8GA 2ROEA 2VG6B 3D9BA 5IT9Y 4DLGA 3DM2A 3N01A 4UQTA 1SIZA 4HHHA 1OS5A 2JSXA 3AXMA 5CHCB 3W65A 4C3KA 4JI5J 1A0OB 3NVLA 5J1EB 1FJEB 4BBYA 1FEHA 2BQRA 1REVB 2A2CA 3CDEA 3SMZA 4OYMA 3TZWA 1HYSB 1QE1B 4F2SA 1HHSA 2A0FB 4P6QA 1YJVA 1DHMA 2ZVSA 5D78A 4I68A 3KK2B 1L3UA 1D0EA 5B0GA 1Q79A 4OHZA 2P6TA 4DQPA 4HKQA 5DLVA 2QA4G 1RT5A 2L41A 1AUSL 2Z2LA 2HAFA 4MT1A 2B4OA 2DHSA 3IG1B 4OX9F 4EMDA 1UETA 3HHLA 3PNIA 3BO3A 2GIFA 3ISND 1N2KA 5EWEA 2Z2MA 1WC6A 4G1IA 1Q8LA 4NASA 3L3CA 4JYAF 3DC2A 3JTNA 3I4PA 4WCEQ 5DLFA 4CWBA 4OZ1A 1YHQS 1S0MA 1UFKA 4YR1A 2B4VA 4NZ7A 2WVDA 2J76E 1AJAA 1B7YB 2VU5A 4X4TA 4O3OA 2EFPA 4J9NA 2HBZB 1FRMA 1H74A 1Y11A 4JI6F 1YJ9S 4LF4F 1NB2A 1K9MT 2XR9A 2H54B 2IYIA 3BSAA 3KUGA 2CJ9A 3EWGA 2WCXA 3R5AA 3R7BB 3MEEA 1NH8A 4KHMA 4XK8C 2XMKA 1KNZA 3TAPA 4J90A 1UJ6A 3P8BB 4WKRA 1MMDA 5FLXY 4XDCA 2QA1A 1JX4A 1KRPA 2WTFA 3C46A 1RTHB 2MY7A 5ETQA 2JC1A 3MEKA 3ELHA 1X31C 4A8MP 3AD9C 4ECTA 3SCJE 4YB1P 2G9YA 4JV2A 1OPZA 3CD5A 1FCAA 3LAMA 4RW8A 4IOCQ 5HRTA 1FF2A 2LEPA 3OUYA 1U2CA 5KFUA 4I2QB 3OJUA 5EN1A 3M8QB 3VAFA 2J8SA 3IM9A 5D0HA 3IDDA 1VHIA 1X60A 4LIRA 1SI9A 1N5QA 3GONA 5D3GB 2LMIA 4C4WA 4RW7B 1IQZA 3W61A 1SL2A 1R43A 2LQ9A 1Q5YA 1VQSA 4ILLA 4ZP9A 1SUQB 3A3OB 4WXWA 1B3TA 2VA2A 4XO0A 1VQ6S 3MCSA 5KG5A 3Q23A 2LQJA 2IHR1 5H9FJ 1R89A 3CO0P 2D69A 4AUKA 3T5HA 1Q8KA 2LQ5A 4NLSA 3SI8A 2GVDA 4NLWA 3MM7A 3J81U 3UW1A 4X4OA 3TVYA 3HHEA 1C1BA 1SB6A 2W24A 3CD0A 3L4BC 4PABA 4U6PA 5HVGA 3KK1B 4L3KA 3FVYA 2Q43A 1NPKA 4PYDA 4F4XA 2ZJRQ 1B0PA 3QLHA 4LRAA 4C7QA 5DM6Q 3F0NA 4OQJA 3DRSA 4K50A 4DX5A 4RUAA 1DARA 3I9ZA 3TVKA 3UWTA 3M6VA 3PM9A 1RAHB 1HQEA 5IFMA 2C28A 2BRKA 4FF2A 2BEFA 1MSWD 1KSPA 1I94F 4NLDA 1VQPS 3QATA 2YNHB 4I2PB 4DU8A 3G2XA 3D54A 4UUXA 4F4YA 2Y8YA 2CQ0A 5ETPA 3HPOA 2GIQA 4WWSA 3D6FB 4E98A 4QYZK 1TKDA 3W5ZA 1HNZF 3GTYX 1PKUA 3T5KA 1GFWB 1GXUA 1WEZA 1NHUA 3M8ZA 3IG1A 4LFAJ 2FDNA 2HRTA 3DU6A 5KFAA 5J2NA 1HNVA 3OQ2A 4F4KA 1UWBA 4OIXA 3CCMS 1EW2A 1V6HA 2VG5B 2DNLA 2CKWA 3DLEA 4ZLJA 2C2OB 4CO3A 4IG0B 5J2QA 1GX6A 4J9SA 4DL4A 5T7LA 3LPEA 3GV7B 3MMCA 2JEIA 1PBAA 4NCBA 2NYIA 4M8LA 1UEKA 4U95A 3A3PB 1F2GA 4FNIA 2AGOA 4X2BA 4GKKJ 2DEJA 2X3DA 3CE8A 2JH3A 1RA7A 3NRBA 5KFIA 1IKWB 5GAEI 4OX9J 1M0SA 4NXMJ 3IA0A 3M6UA 4RBUA 3PHEA 3OTEA 5K8OA 1LW2A 2VBXA 3QIPA 4USVA 4L74A 2Y1LB 3IS9B 5DDOC 1VC0A 1F9HA 2DISA 4NXMF 3NKNA 4CLTA 3VTIA 1Y00A 2YKOA 3TJ8A 5KT7A 1F1BB 2P2CB 1JK9B 4LF2A 1JXEA 4J7CA 1KN6A 4RW8B 4HHUA 2DGOA 4K0KF 1AW0A 4EBCA 2DPIA 5KFBA 4DQIA 4PG4A 3GIMA 1ALKA 3PTWA 2MHNA 2GS8A 4LF6F 4KAYA 1LQ9A 2OPQA 2GLQA 4WK1A 3MTJA 1N6QA 4GKJF 2KT5A 1TZ0A 3KFWX 1H2TZ 1RTDA 1SHNA 3IO1A 1DTQA 2MQ8A 1JLGA 2E1RA 3H0PA 3GIKA 3W8GA 1VQ9S 4DR7J 2AYEA 3CC4S 3CDAA 3OVBA 4IQXA 3T3FA 2ZVIA 3I87A 4QR0A 4URQU 2RF2A 3FC9A 1D9AA 5A2QY 2Z8QA 2BXJA 1WNEA 3NBPB 1YX2A 3ULHA 1YBTA 1L3SA 3SV3A 1T8EA 4GKJJ 2HQDA 2CQ4A 2Z30B 4N5SA 3R1LA 4OYXA 3TA0A 2F4FA 4DX8H 5HQMA 2KM8C 2R7TA 3GJQB 3TOQA 3IN5A 4CT9A 3R97A 2J8AA 4MIBA 3BH6B 3QO9B 1V5IB 2WW8A 2P9CA 3NS7B 3FNNA 4KKOA 3GB0A 4EK2A 2HLTA 2QLFB 4FPIA 2ABYA 3MM7B 2J9DE 5EDWA 4LVNP 3ZO7A 3C16A 3KHGA 3MZIA 1T9VA 4UTGA 3CO9A 3M30B 2ZM6F 4ECZA 3HKZD 4IG0A 4OMFG 5J2QB 2XHWA 1J5EF 3NLCA 4KFBB 2OTLS 3NKQA 2FZKB 4LRBA 2KZMA 2FC8A 2MYFA 4YY3F 4ED5A 5EWFA 4AYBD 1ZM2A 4IR9A 4J9QA 2N4DA 2YWHA 2I8EA 5JUMA 2KYZA 4KTQA 4OL8A 5B7WA 1B64A 1TUWA 2VJVA 4GTZA 3KJVB 3RW6A 3QPIA 5KXAA 4OV6A 2VH7A 5A6WA 1BD6A 1ZPVA 5AE3A 4UQGA 4B3OB 2HHQA 4PYAA 5JMNA 3B78A 2XNQA 1SKWA 1ALIA 1ZETA 2I38A 3HSGA 4OLOA 1HMVA 2BKNA 5J2PB 3L09A 3N4WA 3D28A 4GVBA 1LWCB 5LL6d 2JZ5A 2MSSA 2WHOA 3R5GA 4ZA1A 2HHHF 4P71A 2AT1B 3NCPA 5K14B 3M9OB 2ZH3A 3ILLA 2HBQB 2HG4A 4LBHA 1X4FA 3R5DA 4NX9A 5KFDA 2CJAA 4A8YA 1S0NA 2DRAA 3VV2B 3M2UB 5L9NA 3D6MB 1F9EB 3J80U 4DV4J 3AOCA 1HQAA 3DFEA 3IS9A 3LGMA 4CO1A 3K5PA 5KT6A 3PO5A 2AYMA 1Y7AA 5DLTA 4JP8A 4C0OC 1H73A 1PILA 2EW9A 2CQCA 2DNPA 1C0TB 2A1BA 1N54B 5HP1B 1MLAA 1UTAA 4A47A 1NHVA 1UAWA 2UXDF 2PMWA 2ZBIA 3DI6B 1U6ZA 1GX5A 1R0CB 5C7PA 1KFSA 2J0SD 2HHWA 4WK3A 3HJFA 3TAMA 3I56S 1X4AA 3MWBA 3H5SA 2XMVA 3BPSP 4FYXB 4RNOA 5F3ZA 3G6YA 1HR0F 5IJQA 4PXDA 1GMWD 3CJ2A 4DV2J 1EX8A 3IXQA 3PRBA 1C1CB 3M2VB 2R2SA 1DLOA 4DSKA 1BGXT 4LF4J 1TL7B 2DT9A 2J9CA 3CDBA 1T02A 3CJSA 4K5SA 2ZWOA 2Z57B 4LR9A 2G13A 2DNZA 1Y4ZB 3P5TL 4RLEA 1RTHA 2DVIA 3IR7B 2W1BA 4USUA 3KMQA 5K4PA 1JNZB 3Q8QB 3FEZA 1X4BA 2PEBA 2D3UA 3DMJA 4RUBA 4J5OA 5DJBA 2GVZA 3B6BA 4M5DA 3ENVA 4M5HA 2CZVC 2HNYB 4ZCLA 2E9TA 5ETMA 4WTOB 1HKAA 2ZH9A 1ICEB 1FNMA 2XCPA 4IRKA 3MR6A 4KM4A 4DUYJ 3SXLA 2EG1A 3K2YA 3A8JA 3TYTA 1N48A 4CCHA 1H2VZ 5ETNA 2CPEA 1ZZFA 2Z56B 4CDIA 2XM3A 1CEZA 2FJAB 2R4FA 1Z2LA 2MZQA 2QYGA 3DOLA 5HMXA 1HPZB 1UEUA 1KHNA 1DLOB 3IR6B 3K17A 1JLBA 3M7VA 4CYUB 3AB2B 2VBYA 4WU2A 5GMKa 1B70B 4MHXA 3ENWA 3NGTA 1DAXA 3NGDA 4C8LA 1Q7LB 3OFHA 4Y34A 1DQ9A 1S4FA 1FX2A 2A3JA 3D6HB 3W63A 1DRZA 1RT2A 3ZZ0A 1HNXJ 4ILMA 1AJDA 1MW7A 1RYSA 1T03A 4KPCA 2VC0A 2KB2A 2PFFB 1NDCA 3PY8A 2W5TA 3UO0A 4ID5A 5CA5A 3HT0A 2HVHA 1CG2A 3MXHP 3OL9A 2VQRA 1NSQA 3DLGB 3H7HB 2DK2A 2XG8A 2AEJA 1NRKA 4MFBB 1F5AA 1HL6A 1S59A 4LR7A 5ETRA 2W8LA 4ED1A 1X4CA 2G2ZA 2X1GA 2HGMA 4M5IA 3LALA 1Q53A 5HMWA 1JJCB 3GQCA 4GTYA 3MD1A 2BW7A 2E7WA 4CLPA 1Q8BA 3BGRB 2QLJB 4H54A 1K47A 2RF2B 1ZPWX 4KSEB 5K9FA 4DCJB 2O67A 5F8IA 3PKMA 3RW7A 1TU0B 5B0BA 1RT7B 1IN0A 1CJUA 3BPDA 2CFXA 2MLZA 3LUYA 5HJYA 5K8PA 2UVRA 4PPDA 3T6JA 5I3QA 2RAQA 2F4VF 4XPCA 3OR2B 1BE4A 1UW9A 1KBRA 2VASA 4Z2XA 4DQSA 3MAQA 1LWEB 2R8JA 4CLSA 4LSNB 1KR4A 5BXIA 2ASYA 5LOQA 2QC3A 2ZKTA 4Q0BA 1G3OA 3C6TB 5G4DA 2UXBF 4R0JA 5C42A 4KR0B 5LMUF 1SJ3P 1BC6A 3QWPA 3DYAB 3LA0A 2CJXB 4NRUA 2N4CA 5DS7A 4HL9A 4DV0J 4KGXB 4QW9A 2RB7A 2M8DB 2HK3A 4ED8A 3KTQA 2B9XA 3QIPB 4RO0A 5JXSA 2KJVA 7FD1A 3PX4A 3TAMB 2CVEA 2BOPA 1VYAA 2HNDB 1LK7A 2POKA 2Q6CA 5CZVA 2FVQA 4EO6A 3AD8C 3KLHA 1SH3A 2MB0B 3A12A 1BQMA 1PYOB 1N33F 4KE5A 1U02A 1QSLA 3N28A 1HNIA 3V4IB 3I4HX 4C11A 4NI2A 1GT8A 4I69A 1HWJA 4NZ0A 1FNXH 1TKXB 2AP6A 2VG7A 1LOUA 4TYAA 4USIA 4YR0A 4G1PA 1N8RT 1QUVA 3CW2C 4TN2A 4HACA 2OEJA 2BE7D 2EG2A 3LP0A 5A0YB 4KJGA 3A1YG 5CD4H 2COLA 4B9UA 4LSLA 1FFSB 1DTTB 2LYVA 1O51A 1KS2A 5KT3A 1RKJA 5T7LB 3GJSB 4ZCIA 4DBQA 5LMNJ 2W5VA 3UCZP 4TQSA 1RT4A 4J9MA 2MGZB 3DOKA 4L6V3 2G0IA 4Y3CA 4LF9J 3PZPA 3C6UA 5E5NA 1NLKL 1KEKA 1RT6A 4DUYF 1CPZA 2OPSB 2W7AA 4DEZA 2CQHA 4I4BA 5IQ6A 2DJWA 3HVWA 2QLXA 2ZNZA 1S1TB 1OPIA 5KFLA 3HCXA 3BQ0A 2FJWA 2OAUA 3HHDA 4NXNF 2DHHA 3ADAC 3ITHA 1BQNB 3CJKA 4UY85 2C42A 2OPPA 2HQGA 4U7CA 2IFYA 2DXDA 3UR0A 2R8IA 1HDHA 2A6OA 1PJ5A 3D3BJ 3F73A 1FTCA 2PN6A 4ITSA 5KFNA 3RRKA 2CJQA 4F0KA 1OSCA 1I3OB 4KV8B 3D67A 2UUBJ 1LKZA 4FPRA 3OXFA 3IGVA 4RPFA 2P9GA 2GMLA 4CO4A 8ATCB 2ZHAA 4ELUA 2DHGA 1FXRA 4ES3A 1HNXF 3MK2A 2NYHA 4P2MA 1RZMA 4N77A 1OJ4A 5KG6A 1FDAA 4OZLA 1U0SA 2YNGA 3DLGA 4HYKA 1G1XA 4B9VA 4GC7A 2VDIA 1ZBTA 1MROA 2A18A 2RH3A 4B3RF 4RNMA 1IUJA 2AEFA 3UN3A 1ANIA 2LP4A 4PPZA 3F41A 3FQKA 4J9VA 2BABA 2XC9A 3ZFVA 2BJ8A 4M5KA 1N4LA 1WI6A 2MZTA 2JDJA 2EKYA 2W9BA 1KH4A 4UORA 2QRRA 3VALA 3Q3QA 3PEHA 3TR5A 2VJUA 2IJFA 1PO6A 1IBLF 1B7FA 1HBOA 3MUTP 2E66A 4JOUA 4LF1A 3LTOA 2WK4A 2KL8A 4R5PA 2XGPA 4H4MA 1S9EB 3E2DA 5LRMA 4QWEA 4CXUA 9ATCB 2YWEA 3W9JA 5KFWA 2ACYA 3EDQB 3V6DA 3BEGB 3W9HA 2YQ0A 2HHHJ 1K1SA 3MEDB 2V8HA 2AYBA 1H7XA 1WG1A 3PEJA 5A8KB 2C2DA 4O44B 3MM9A 1MN9A 3WC2A 2OKQA 4NPOA 3I9V9 4PKDB 4OI2A 4CNZA 1X5SA 2KFZA 4V19J 1CS4B 2PGCA 3VF0B 2W4PA 3RAXA 2PI4A 3I5AA 2MHEA 1RHJB 1YRXA 3OR1B 1RTDB 3RR8A 4NYPA 2QGFB 3FGVA 3JS9A 2BOAA 3LF0A 2IBKA 4B3SF 5CZXA 3UDLA 3H5YA 2XEXA 1F60B 3FKBA 5AJ9A 2U2FA 3HI9A 2KJWA 5D8HB 4ZDNA 2HQIA 2HSEB 4DCOB 4DV5F 5E3PA 3THTA 2XI2A 4ENOA 2E5LJ 4B3TF 1UKUA 2J7UA 4ZVSB 3CTRA 5AT1B 4D3GA 1UVJA 3DLKA 1IWAA 2YH0A 1SQGA 2CPDA 3H2LA 3US5A 2VPWB 4ED7A 1PAEX 2BX6A 2L9DA 4RWWA 1JLQB 2BM0A 1H0HB 1RT5B 3PFOA 2VG7B 4USMA 2RQCA 3V6JA 1Q78A 1NK8A 3H4DA 1IBMF 3NNHA 3F56A 1F9FA 4DR6F 2MLXA 3OPKA 1SC1B 4KAIA 4R0EA 3SFUA 5BYQA 3HZGA 2OPRA 1N0UA 1GK8A 1NSAA 3MHYA 4FBTA 1KQGB 1CC7A 1IKWA 1N2LA 2LECA 3HVAA 3MMJA 1X9MA 3H2VE 4KB7A 4B9SA 4H4OA 4DX7A 4IH7A 3M9NB 4DL6A 2QLWA 3CULA 4CQ1A 3TW0A 3DHWC 2D9PA 3MPVA 5BR8J 4X4RA 2ZH7A 5HLFA 5LRNA 3AY0A 1YZ7A 1RHRB 5B0CA 2GMHA 3BR9A 1RADB 2ZE2A 2U1AA 4RNFA 3BQ1A 1FVSA 3R2DJ 4CM2A 4Y2MA 2E1PA 1RXOB 4WKYA 3UPFA 3KHLA 1WC4A 2ZD1B 3D1HA 4JUZA 2XULA 1VDHA 1T3OA 3MMBA 1U0HB 3AQPA 2WB1D 3OUYB 4DV6J 3M32B 3UVJB 3RTVA 4UZBA 3CCZA 4QU6A 4C9DA 4NLGA 5F9LA 1H3DA 4R25A 3BN7A 4HVZA 4GRSA 4I1TA 2FVSA 4O3QA 4X66F 3KXDA 2RH6A 1VQ5S 1IBCB 2GO8A 3RRHA 4U67Q 3KUHA 1FSUA 4M5LA 2JLFA 2BJ1A 1SQEA 4O4RA 1ZM9A 3PIOQ 3V6DB 5CYJA 4DR7F 3DDIA 1RWKB 5KFGA 4F4AA 4DV2F 1VQNS 1SBRA 2CQPA 3CMQA 5GMDA 3BF4A 3CCWA 2SXLA 1ANJA 3MTKA 2ACMA 4YEAA 4KO0A 2XO7A 2BM1A 3FK4A 4R5PB 3T1YJ 4W90B 1WELA 2CPHA 3NGKA 3LP0B 3R6LB 1T9YA 4MFBA 2J7KA 3LP2B 4OI4A 3G87A 3QMQA 1XBWA 1ZAXA 3BB5A 3P49B 4DHVA 3IFEA 3TNVA 4CP5A 3MFHA 2QSFA 2AX1A 2MTLA 4OFZA 4CLYA 2R8HA 2QZ8A 2QT7A 1HQ2A 1RU1A 3HXMA 4ZG7A 1YWXA 2C2NA 4O23A 2F3JA 1FX4A 4LBIA 4KC5A 1FTRA 1A7GE 4FZVA 1XMQJ 1Q86T 4ED3A 3ZTRA 2QE5A 3D1OA 4CH7A 4O0IA 3NNAA 1TL3A 2XMMA 1WC3A 5AE1A 2FQQB 3GIJA 1TQLA 4DX6A 3GU0A 3QGIA 5HVFA 4BLGA 3BKTA 4URSA 2AQ4A 3JAMY 4TVAB 3DCAA 1ELXA 2RQKA 1S12A 2ZITA 4NEYA 2D41A 1VQ8S 5GAHI 2C3UA 1IR1A 1JLAA 3M2RB 1HNVB 1KHWA 1RABB 2GO9A 2XY6A 4IR1A 2YVSA 1S0OA 3C2PA 1PC5A 1N0VC 1FDDA 2F8EX 2V2KA 3DLKB 2MQNA 3KUEA 4ZPVR 1NDLA 3GYXB 5M2UA 2ANHA 1RCOB 2RHQB 4Y2CA 5F8JA 5DETA 4F4WA 3K89A 2UZAA 1EQ0A 4OZ5A 3UN2A 1FKPB 4DR6J 1N52B 2WOMB 4FYWB 2WSEC 4P2FA 5J1NA 4YDXA 1CJKB 1FRXA 3MFIA 1S1WA 2HZCA 3FEXB 2DNQA 1OIAA 2GQQA 5FDLB 3SDEB 1S9FA 3T00A 1TKTA 5HLFB 1WF1A 2QLBB 1RAEB 1RT1B 2V2QA 1HBUA 2GGPA 2J0WA 1V9OA 3C8YA 3T5LA 4C8YA 4K59A 4GTWA 2ZZTA 2CUYA 5CYQA 2ZUGA 2X1FA 1HD0A 3KNAA 3M8SA 3ZTSA 1ZYQA 3GCXP 1FWLA 4Z37A 4G3IA 1WG4A 1QM9A 4DG1B 3FCWA 4FYDA 1T9XA 4QCLA 2I0XA 2QJ3A 2QMUB 2VF3A 2WONB 1SL1A 3E3XA 1WG5A 4NLTA 1KQSR 1R0AB 2RRAA 2W8SA 3VQSA 5M2RA 1YJTA 2RRBA 2CPXA 2J9DA 4RW7A 1BUXA 2RKIA 4ZVRB 3TUJC 2FVPA 3DU5A 1X4GA 4ZN1A 4ED0A 1W25A 3D7SB 2ILYA 3U1LA 4AXIA 4NZ6A 2V68A 3PJWA 1S72S 1HR0J 2J6SA 3DRXA 1HWLA 1N5VA 3F44A 1CJVB 1UCNA 5L38A 1BWVA 5B0AA 4BS2A 1YJ7A 2QTWA 3LH2S 4N76A 2EC2A 3ZNUA 4WYWA 1WHVA 5FIIA 5KT2A 3IAM9 1YJNS 5C42B 1MN7A 3PW5A 5J2NB 2F8MA 1S1XB 2DO0A 3KLFB 1D1UA 3FRYA 3OHAA 2RD5C 1N32J 1CSJA 2XMUA 2RDDA 4CIOA 2KG1A 2C22A 2BV3A 1GXTA 1PG5B 1C2PA 2ZOGA 2JVRA 2NSBA 4ECXA 1LV5A 2XS5A 4WZMA 4B17A 2CG8A 3SCKE 4CLZA 2YXLA 4EEYA 2CJYB 4OI0A 2BKPA 2I5JB 3NAIA 5IC6B 4QYZJ 3BZQA 2UUBF 4CNYA 3CCQS 4JI6J 5E3QA 1SC3B 3PX0A 2V0NA 1UZHA 2YKPA 3P3DA 3BDHA 3DN9A 2N3OA 4DR3J 4D3HA 2QL5B 2GJFA 3KLIB 4QOTA 3SFGA 2NXEA 5C24B 1M5VC 3K5OA 4MIAA 5HBMA 2W9BB 2ZHBA 1YG0A 2K1RB 3HKWA 4ZKAA 4F36A 2MGZA 2ZBCA 4ZVGA 2DR5A 2R2RA 2ZE2B 2UUAF 2PEHA 1LNQA 2GQCA 1J5OA 5DG8A 4K4ZA 3C16B 3N6LA 3U27A 4JB8B 4YFUA 3BSNA 1WEYA 3GR0A 4C48A 4B9MA 3I0SA 4MTPA 4A8FA 5A8KA 4DDFA 2AX0A 2LA4A 3QRRA 3ET6B 4HT5A 1M5SA 2HFNA 3P5BP 2CQ3A 3E8OA 3WC0A 2DBBA 3KLGB 3NWGA 3IRXB 1NCLA 1REVA 3M8WA 3N9UC 3PVXA 3E01A 2IAJA 2YBVA 3M30A 4ZMMA 5E41A 4IDKB 3RBDA 1EQJA 4I64A 4YHHJ 3ED4A 1QD1A 2EWHA 3M2UA 4WFYA 2IPOB 3G82B 4RUHA 1VC6A 2I9SA 1XMQF 1VK8A 1ZM3A 1UWAA 4JI7F 3IGYB 1S6QB 5LSLA 3C6TA 2M2BA 1WOSA 1RSCA 2OPSA 1WI8A 3MUVP 2DNRA 4OYIA 3X1LB 2PMHA 2OHDA 3KDNA 2CVIA 3TWZA 3RB3A 1OYDA 2GCFA 3W1YC 4DWIA 2GA3A 1AA1B 1Y6VA 2RDIA 2XYPB 2WZ1A 2ZC4A 5KFFA 2KHDA 4ZVTB 4DV5J 1URNA 3IWNC 2OPPB 5KFCA 3CNQP 3X3UA 4ZOSA 2C2RA 2HURA 1U24A 3JSRA 3LQVA 4HI1A 2JL9A 2LXIA 3IMQJ 4KGZB 1N5YB 1D3WA 2WVBA 2MXYA 3CJRA 3PACA 2J6UA 4HR2A 4BCAA 1SV5A 3LANA 3CT9A 3CXCR 1FRHA 3OTCA 3T9ZA 2DR7A 2CQIA 2VUGA 4B3MF 3ZZOA 3AXKA 3LGNA 2ZM6J 1AB8A 3R3TA 4WFZA 4X4UA 3GG0A 1FRKA 2DGQA 2VFSA 3HMJG 2KXNB 3PG9A 3ZC4A 2X51A 4I67A 3KLFA 2IM2A 1FD2A 5ETVA 3OVSA 1NK0A 5KG3A 1VJQA 5THWA 4CXKA 2XS7A 3O2IA 4HI2A 1IJFB 2DRBA 3ZTQA 5TJ3A 4AT1B 3PX6A 3D6TB 1VQKS 3MCMA 4PG8A 1HWUA 2FHOB 1NSPA 2IRUA 4OV1A 3OTOF 4YUDA 4ANDA 5DDQC 4TKTA 2H1YA 4ECQA 4K2JA 3G6ES 1URBA 4DV6F 2OO4A 3TZYA 2QIFA 1TK8A 2EBGA 3MK0A 1SUQA 1ELOA 5KFYA 3KLIA 5C24A 3OFFA 3RGIA 3TI0A 1RE1B 3G96A 3THVA 2Y0SD 2LLZA 2RRNA 3NS6A 2GFFA 3H4BA 4HTJA 4C8NA 2V6AA 1QY7A 5F8NA 4X4VA 3TG0A 3TEHB 3WHIA 2DXFA 2WBMA 3TUIC 2R7VA 4A8KA 1RT6B 5LMNF 1WTFA 4KT0C 1J5OB 2V94A 2CNLB 3CD7A 3GWCA 3MAHA 3S6EA 4CXSA 4JI3F 3J7YU 4ES1A 4FS2A 2GMJA 2HPUA 4KH0B 3WAYA 4G1QB 2HQ3A 5HBMB 5IZHA 1DBDA 3JYTA 1S0VA 2CNKB 1ZAVA 3C15B 1EI6A 1VQ7S 3HHLD 3PR4A 2R7RA 5A8WA 1VIXA 3KJFB 3LP1A 4F2RA 4LF8J 1FWKA 3AA8A 3AODA 3R5BA 8AT1B 5DLGA 4ECWA 3FZBA 2JFDA 2X1BA 3MR7A 4F26A 2XWXA 5KAKA 1NKBA 1TL1B 4PAAA 3A8EA 3C3LA 1P8GA 3P4UB 3OT9A 5LXRA 1UVMA 4ED4A 1EETA 1U09A 1IXKA 1BLUA 1B0VA 1OQ3A 1YTYA 3TX8A 4A46A 4DV1F 2DGWA 3CMAS 1E1ZP 3EYZA 4DCPB 1VQYA 3QZ8A 2IUCB 1GMVA 4Y2IA 1NPRA 4KRWA 3VWSA 3HLUA 2V5HG 3TA2A 2CWXA 4ZCKA 1NMEB 4ZVUB 3CVKA 4NMXA 1D8YA 1C1BB 1C1CA 3M2VA 2EPIA 1QTMA 4OHYA 3MMAB 3Q24A 2K3KA 1J27A 2EFQA 5LJ5Y 1VBXA 1R27B 4ZPWR 4ALZA 5F8GA 2XY5A 1JLEA 1O99A 2X3GA 5HK4A 1EZZB 2IDLA 3GV8B 2NQPA 5D4NA 2AGPA 3AAWB 2K7KA 3FBBA 2XS2A 4NYOA 4Q5VA 3LP2A 4CLUA 4DQQA 3CCSS 3MR3A 4BC7A 2CJBA 3G6VA 1S6PA 2PI5A 4KGMA 2CA9A 3FCVA 1URRA 4C98A 4TN0A 5U47A 4O3NA 5K8NA 2IC3A 4A8QA 4LFBF 3DNCA 1U45A 4YB6A 4QIFA 5DDRC 2MJUA 3JAMU 1D9DA 1WC1A 4Q7AA 5KOXA 3O8WA 2V4QA 1XEZA 4XDDA 2YWFA 3KLHB 1U4BA 2DH8A 5ADZA 1U2RA 1WKLA 4J9KA 5HO4A 3DGPB 2B56A 1HW8A 2BZ2A 2K8GA 2O01C 2YTCA 4RKUC 4U7UK 4DFJA 3MD3A 2XB2D 5J2MB 4Y2AA 2F1FA 5I42A 1OSDA 1Q4RA 3SSSA 4ZVFA 4DFKA 4OZNA 2JEFA 2YWGA 2OLWA 4IOAQ 2AW0A 4AL7A 4DF8A 3GR1A 4I56A 2QO3A 4YB5A 4IRCA 1FXLA 4DV7J 3TVZA 3PR5B 1NK6A 4P2XA 1KONA 2DHXA 4C97A 1XQIA 4X65J 2ZJQQ 1T03B 2UUTA 3I6PA 2MZSA 3DM2B 4W4MA 5KG1A 2RDJA 4N41A 3DLHA 2CDQA 3FBCA 1IQTA 2OMOA 1ELYA 2B8PA 3MAAB 1UZDA 3CJQA 4ZS6A 3VHQA 2AV5A 1JIHA 1JLAB 3C14A 3M2RA 3QAEA 5EX3A 1S9GB 5L9XA 1UFLA 4M94A 1HBMB 1RB0A 5EGYA 1HNIB 4RW9B 5HROB 3VAMA 3NL0A 1DFDA 1K1QA 1N36J 4DMZA 4LQ3A 4UY8T 3H98A 4GKKF 1TTHB 2HNZA 2RILA 4AXJA 1SVDA 3QQCD 4TU7A 2FJDB 2XZDB 2MZJA 3NGRA 3QRPA 2IJNA 4DN0A 3LP1B 4KO0B 5KFKA 3HFKA 3PW7A 3ZXWA 1WHWA 3AD7C 4PZVA 3PHTA 2BJEA 1SKRA 2LVWA 4DXLA 1NDKA 3OTBA 3MMAA 5HMYA 1WHXA 5A8RB 2HS0A 1SKUB 1HMVB 2V2ZA 3EGNA 3PFEA 4DS5A 4KGKA 4DS4A 4LR2A 1SHQA 1PJ7A 5GAHU 3G4SS 1HI8A 1T05A 3MAAA 2F8HA 1U2FA 2CNNB 1VCTA 3CJ8A 4OZ0A 1WEXA 2BR0A 2VPZB 1XMBA 5HATA 3QZ7A 1VRUA 4LFAF 4WFNQ 3Q8RB 1RT3A 2BBEA 3RAQA 3FJ2A 5B0EA 1N33J 1JWWA 4LF9F 1AZSA 1FO1A 3M8PB 4GVBB 3CB4A 2IC3B 1S1UA 5EX0A 1JLEB 3TQEA 2DXEA 2R2TA 2AZ1A 4FYYB 1UPPA 1RTZA 2M52A 1E6YA 4QWBA 3THPA 1DQ8A 2FJVA 1EQMA 2QG9B 2JX2A 1R8CA 4LSLB 4WFXA 2O66A 1VI7A 5CCLA 1R6YA 1ED9A 5CYMA 1TL7A 2L9WA 3DI6A 1TAQA 4CM0A 3G82A 3D0GE 3MECB 2M88A 1RAOA 1ROFA 3MEDA 4IFYA 3VGUA 2YKMA 2ASDA 1H98A 1TELA 2PE8A 2JOQA 1RACB 4H4KA 4ZJQA 5FLXU 2ATLA 3ZZTA 3KJVA 4CLFA 1EKSA 2XYGB 4L76A 4U7UD 4YP3A 2YNFB 2XWYA 3DOMA 1KHJA 1U47A 1K73T 2HWHA 2VPYB 3V6HA 3U1MA 1FE4A 3HSDA 4A8XA 4DR3F 5H9EK 1CS4A 1IJEB 4LRDA 1TKZA 3B4DA 4O0NA 2CQDA 3D0HE 3HJVA 3C14B 1L3VA 3E2EA 3RJMB 1XJWB 3AOBA 2GJIA 4B9NA 2FPHX 3H90A 3VAHA 3SYZA 3GCWP 2XSJA 1NJIT 2JVOA 3PW2A 3W7BA 1HD1A 3CJKB 2XNRA 2XO6A 5LXYA 4DUTA 5KT4A 1R31A 1NNDA 2IUCA 3PIPQ 1WWHA 1S5ZA 5K14A 1GAOA 4XAKA 1KKHA 1U1KA 2AWZA 1HWIA 4LF7J 3K8WA 3GZ7A 5ETLA 3SIPB 2DR9A 4PQAA 1VBYA 5AXMA 3PV8A 1MWYA 1E6VA 2GAGC 2XMJA 6FDRA 4JI0F 4Y0FA 1HFEL 5T41A 4X4SA 4MK8A 5C66A 1BQNA 3A4TA 2LEBA 4JI3J 3DPCA 5LIAA 1RHMB 2M3DA 3M1VB 3Q2SC 3QT6A 5ETSA 2W01A 4YHHF 3MM6A 3RUBL 3MPDA 4UOOA 3TARA 2NXCA 1TKZB 2DTJA 2WAQD 3Q8YA 3QBCA 4JI8F 1S1XA 5KG2A 3I0RA 5GAGU 4ZVQB 1NK4A 2VD3A 4H4OB 3CGIA 2HVEA 2K7JA 3SSRA 3SV4A 1TFWA 3J7A1 5GMEA 5C25B 1FRJA 3GJRB 2GHVC 3MMCB 4N56A 2PA8D 4OYWA 3H40A 1QSYA 2IYGA 4NA1A 3QJLA 2D1GA 4JV5J 5DZ7A 4WFBQ 2W9CA 3PJ9A 2ZDPA 4OYZA 4YY3J 4NLUA 3EDRB 2DRDA 2FC9A 3FCHA 2ALYB 1T9UA 4LFCJ 5KFQA 2G0JA 1FNOA 2FB0A 2F63A 3D0IE 3QWUA 5CYMB 2ASJA 3ZNJ1 2W25A 4JI8J 4PQUA 5LMUJ 2ZH5A 2L08A 4AL5A 3UN5A 1GH8A 1WF0A 5DO2A 2BW2A 2FZCB 2BRLA 4RW4B 3OD2A 5I3PA 1CJTB 3KG0A 2AMCB 3EPIA 4X64J 1M5OC 2QA2A 2IFXA 2OTJS 2EI5A 2QEXS 1Q0NA 1HNZJ 3SCIE 4BDPA 1KOHA 3WIVA 4DUZF 1R8HA 1FDBA 1S7HA 2E7XA 2XLKA 3QLHB 2VQFF 3H2UB 2LCWA 2IJRA 3I96A 3DDNA 3H59A 3ZZYA 4B02A 4CLKA 4F3QA 4LIWA 1JKHB 1ZM4A 1UMJA 5F41A 4I2PA 4WIIA 1ZOTA 5H1SV 2GVZB 4QPXA 4YOEA 3BQ2A 1RQ0A 2RVJA 2EEYA 2YKNB 3DRRA 5D0GA 1RAIB 4NI2B 4N8NA 1AUKA 1A6LA 4AQYF 2JEGA 2HW3A 5JJBA 2KRRA 2Y0BB 3CCVS 3NMRA 1RWXB 5GAEU 3B5QA 2FY8A 2CPZA 1T11A 1Y5NB 2I1RA 3OHBA 4JI1F 2W5SA 2M9KA 3KDOA 2H9ZA 2CNOB 3HVRA 5HSPA 1O98A 3BBFA 2QL7B 1FRIA 1TMJA 1I6JA 2VC1A 3LAKA 1LEOA 4MKAA 2K3IA 2HVDA 4C11B 1V3SA 3V81A 2AJQA 3EMTA 4EWTA 3BJYA 4F4ZA 4UOPA 2M4MA 3PXGa 5G0RA 3UI3A 2E1AA 1D8ZA 4LVOP 4FF4A 2LU2A 1WC0A 4ID5B 1RWMB 4WZQA 3FQLA 1VQMS 1S6QA 4NLOA 4ANEA 4K4XA 4KJDA 1RHKB 4ER8A 3BGUA 3M05A 5IJSA 3ENAA 1Y10A 4PRFA 4BWJA 1MMNA 1HI1A 4K7QA 2PT0A 2OFGX 2HHPA 3NWRA 1Z1ZA 3KK2A 2W8KA 3VZHA 1H7WA 4OI3A 3S7RA 3T5JA 2BANA 3AFGA 1KLNA 4EO8A 1LW2B 5C25A 1G7CB 1O5JA 2LKZA 3TA1A 1N5TA 3BR8A 4RBTA 1QUPA 3GE9A 4HH0A 2UV8A 4FP9A 3R9LA 4USHA 1YIJS 4DV1J 2FLNA 1M1GA 4LR8A 2J9EA 4O4GA 3UDEA 4K8RA 3VCDA 3OVAA 4IG3A 2HYIB 1TR0A 2HK2A 4WFAQ 4GTXA 1RLCL 1WJ9A 2ZHOA 1TKTB 5IWAF 2MQLA 3LGHA 3DHXA 1RDRA 2C1EB 4MMOA 4UW2A 3QFHA 1N6QB 5D4OA 4LF5F 4DU7A 2WOMA 1MU2B 1S7IA 5KT5A 1WC5A 2BMBA 3I0RB 1YJUA 4C8KA 3KLVA 1FK9A 1RAGB 2XCAA 3I5BA 4DR2F 3UCGA 4KPYA 4JI7J 1TL3B 3NGSA 3K7RA 1S6PB 3HK2A 3MUMP 5KFXA 3RU0A 3G71S 5CCMA 1TFYA 1F3VA 1YBUA 4FVMA 2OEMA 2W4CA 3AQOA 1EHWA 2E5IA 2VBZA 3EXCX 2W7PA 3WX8A 1SH2A 2UUWA 2QMXA 4RW4A 4JV0A 2G9OA 3OLBA 4DV0F 1N34J 2G1HA 3SQGB 1N36F 3NP5A 2JJ4D 2DH7A 2G2YA 4LQ9A 4WP3A 1VBZA 2RU9A 4LFBJ 1EARA 2IVYA 2O5DA 4F02A 3RB0A 5IT4A 4LSZB 2RHSB 3T9NA 3TJ9A 1UL3A 1VQLS 1UJ5A 3FFIB 3GJTB 1FXDA 2P5VA 1T05B 3JTOA 2HLUA 4EBEA 1RWOB 2NXUA 1GEHA 4F50A 1R6VA 4P7VA 2R8KA 2XSFA 2VODA 1B8JA 1UP1A 2AZ3A 3QYYA 1O0PA 1TV6B 1UVKA 4GO5X 2C2EA 3JXOA 3MOZA 3KK3B 4P9SA 5D77A 3H5UA 3Q0AA 1RWPB 1AUDA 3CCJS 3V81B 2HZVA 2QZUA 1BXNA 2W2PP 2YX7A 2PMZD 1W7WA 1TVRB 2DNOA 2F40A 3QSIA 4ICLB 5J2MA 2FZGB 2ZEJA 2IM3A 1G4CA 3FEYB 4YB7A 1QAXA 1SJRA 4QYRA 5I3UA 2ZJPQ 4QIVA 4TU8A 1VLYA 4V19X 2Z2ZA 1E6YB 2D3ZA 4QR1A 1QAJA 2CQ2A 1SC6A 2LQ8A 1S1WB 1SIWB 4F7VA 4M1KA 2UUCF 1NUEA 1K44A 1FDNA 2CXEA 2IA6A 1EETB 4URGA 1ALJA 4DR1J 3JSBA 1V5VA 3ITHB 1NJYA 2AJ4A 3HP6A 1YLXA 1PSDA 3Q8VA 4FKXA 4CT8A 2H65B 2R2UA 2XTJP 4NLRA 2MJNA 4AFFA 3DOLB 2VQEF 5AXNA 1RLDA 4L75A 4EFAC 5IV3A 1U6BA 1ZA2B 3GFXA 5KFEA 4HH1A 1HBNB 2J5AA 2JFKA 3D3CJ 5BR8F 1PIEA 3K58A 3DLJA 5KFPA 2ZNYA 1HJKA 1IKXB 5FJ4A 3OL6A 5A8RA 2ZH1A 4QWAA 2IM1A 3T1HJ 2GW8A 3WAVA 1RBOB 3BGFA 1HIYA 1FWPA 4N47A 1FJGJ 2B6AB 4M5NA 4USWA 3H25A 2ADCA 1JLCB 3POTA 4O3RA 1SC4B 1S9GA 3QT7A 1XTZA 4FS1A 2GSUA 8RUCA 2MQOA 5DZ6A 2F65A 3JQJA 4WTYA 1VOMA 1U0HA 1VS3A 2H5EA 1F5CA 4NWXA 4MIWA 2VOPA 2OI2A 5D4PA 1HA1A 1JB0C 1R8AA 2KT3A 3N79A 3IRWP 3KG4A 2F5GA 2RKIB 2WRMA 3MURP 4ETZA 1S79A 5D4LA 2VFRA 4I6WA 2AIRB 3MPWA 4MYUA 4CO0A 4B08A 3JSMB 2R7UA 2L48A 1AJCA 4TLQA 5MLCV 5FD1A 4OYAA 1ZEDA 3IBWA 2XMWA 2BYCA 3T1AA 4GO7X 4XIUA 5E7OB 1ZEBA 1NK5A 1RBAA 1Q81T 4ZN3A 1QSSA 2DO4A 2DY1A 3RRGA 1YBAA 4QR2A 2W4DA 4MYTA 2C2KB 3UD5A 3VGSA 4DPTA 2FHJA 3TJAA 7AT1B 1MU2A 4MH8A 2IDEA 4LF6J 4A8WA 2MKHA 3RG6A 1JJ2R 3V4MA 2CRLA 5KOWA 2FVRA 3GFZA 1ZZNA 4M5DB 2MQMA 3VZIA 1EP4B 5HN0A 4X4PA 1IM4A 4UOFA 5DG7A 4Q8FA 3FFIA 3GV5B 2W9AA 3JB9k 1F0XA 1EJJA 2OPQB 4MK7A 5A6PA 1M90T 3DRSB 3A13A 1X5PA 2HHSA 2FY1A 1X4EA 1T3NA 1M5HA 3B82A 3CIZA 5LM7E 5I3UB 2FIUA 5KFVA 2I2YA 2KU7A 1TK5A 5DLWA 1VLOA 2RIJA 1S99A 3UDCA 5F3TA 4IO1A 3NEKA 4CYSA 4C3LA 4TXSA 1NK7A 3M8RA 4TY8A 3Q86A 4QJVA 3BSOA 1H6KX 2AGQA 4JBCA 5AJ3F 5F0WA 4UPLA 4DJBA 3BDGA 4FKYA 2P9EA 3HVTA 4YR3A 3AT1B 3OFGA 3CWJA 4ZJOA 5AE2A 3OW2R 2RUSA 3J7Z5 3VVTA 2UXBJ 3NKOA 3OTOJ 4IDKA 4ZVOB 4IH6A 3NOGA 1KH9A 3VAKA 1M5PC 3L9ZA 2F4VJ 2EFOA 2ROPA 2HVZA 5D0RA 2KH9A 2FVCA 3EZOA 4J91A 1SCJB 1KOOA 1NEEA 5DRKA 1FVQA 5ETKA 3TZXA 5J1PA 1UJ4A 4TQRA 2VHGA 1FESA 1JXVA 2E7VA 1KHVA 3DLEB 3IM8A 4ECRA 4ZP7A 4X62F 2GNKA 3PW0A 3QIDA 2OP5A 3D68A 4XTTA 5ETTA 3MEGB 1AFIA 4E0DA 1RGVA 2DD8S 2MKKA 2LXFA 5IV4A 4MIVA 3MM8B 4KGVB 2B9WA 1T7PA 4N7TA 1CQMA 3MM9B 1NJWA 3QSYB 2G1DA 2BJ3A 4FDFA 4ZJLA 4DL5A 3BYPA 2OELA 4NL5A 3EM1A 3CJ3A 4OJ3A 2DGVA 4XPEA 3R1HA 4JV5F 3I31A 3WBHA 2IMOA 2QMWA 2VPXB 1HI0P 4IO9Q 2RUGA 2DYAA 2V63A 2B3TB 1KTQA 1CQNA 1NAQA 1RT3B 3DXBA 4PXBA 2FHMA 3JYTB 5G0RB
chains in the Genus database with same CATH topology
3TX0A 4LR2A 1E3CP 1SHQA 3TG0A 1ALHA 3NVLA 3SZYA 5IJQA 4UPIA 3T02A 4FDJA 3WAXA 4CXSA 1HJKA 3A52A 3WAYA 1AUKA 5DLVA 4KAYA 2X98A 4LR9A 2W5VA 3WAVA 1EI6A 2W5RA 4LRCA 3LXQA 3NKNA 3B5QA 3SZZA 2W5SA 2W5QA 5INHA 1N2KA 1P49A 5K4PA 1O98A 2GSUA 4YR1A 3NKPA 1FSUA 3OT9A 3BDHA 1ED9A 1ALKA 4UOPA 4NWXA 5LRNA 1AJAA 1URAA 4KM4A 1E1ZP 2GLQA 1ANJA 2IFYA 2IUCB 2XR9A 1SHNA 1HDHA 2RH6A 4KJDA 5IJSA 1ED8A 1KHNA 1ZEDA 1AJCA 3UNYA 1KHJA 1ZEBA 4B56A 3M7VA 1EW8A 1E2SP 3MK2A 4MHXA 1O99A 1E33P 3KD8A 4LREA 1ELZA 4ZG7A 1KH7A 4LRDA 4LR8A 3M8WA 2G9YA 3M8YA 5HRTA 3UN3A 1ANIA 4GTXA 1AJDA 1EQJA 2W5WA 1KH5A 3MK1A 3ED4A 4TN0A 1KH4A 2W5TA 1EJJA 3UO0A 4UORA 3IDDA 1ELXA 3Q3QA 3IGYB 5EGHA 2IUCA 3IGZB 4LQYA 2VQRA 3E2DA 5LRMA 5DLWA 4CXUA 1AJBA 4LR7A 4ZGAA 3TWZA 4CYSA 4GTYA 2GA3A 2ANHA 3NKQA 1Y6VA 5C66A 4LRBA 3NKRA 3DYCA 4CYRA 1ZEFA 4UPLA 4UOOA 3UN2A 4FDIA 4KJGA 5AJ9A 3BDGA 4LRFA 4GTZA 4UPKA 5KXAA 1EW9A 1KHLA 3NKOA 5LQQA 2W5XA 4QAXA 3T00A 1ALIA 1KH9A 4LRAA 3NKMA 2D1GA 1ELYA 4GTWA 2ZKTA 1B8JA 5LIAA 3WAWA 3BDFA 5GRRA 1KHKA 4CXKA 5L0BA 2XRGA 2QZUA 4MY4A 5TJ3A 2GSOA 4UPHA 5L0KA 2GSNA 1HQAA 4MIVA 4KAVA 5DLTA 4ZG6A 3UN5A 4N7TA 2W8SA 1Y7AA 5GOVA 3M8ZA 3CMRA 3BDGB 1EW2A 1URBA 4NWJA 1K7HA 1N2LA 3WBHA 3T01A 4ZG9A 3DPCA 3MK0A 5EGEA 1ALJA 5L0EA 2W8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TX0 A;  4LR2 A;  1E3C P;  1SHQ A;  3TG0 A;  1ALH A;  3NVL A;  3SZY A;  5IJQ A;  4UPI A;  3T02 A;  4FDJ A;  3WAX A;  4CXS A;  1HJK A;  3A52 A;  3WAY A;  1AUK A;  5DLV A;  4KAY A;  2X98 A;  4LR9 A;  2W5V A;  3WAV A;  1EI6 A;  2W5R A;  4LRC A;  3LXQ A;  3NKN A;  3B5Q A;  3SZZ A;  2W5S A;  2W5Q A;  5INH A;  1N2K A;  1P49 A;  5K4P A;  1O98 A;  2GSU A;  4YR1 A;  3NKP A;  1FSU A;  3OT9 A;  3BDH A;  1ED9 A;  1ALK A;  4UOP A;  4NWX A;  5LRN A;  1AJA A;  1URA A;  4KM4 A;  1E1Z P;  2GLQ A;  1ANJ A;  2IFY A;  2IUC B;  2XR9 A;  1SHN A;  1HDH A;  2RH6 A;  4KJD A;  5IJS A;  1ED8 A;  1KHN A;  1ZED A;  1AJC A;  3UNY A;  1KHJ A;  1ZEB A;  4B56 A;  3M7V A;  1EW8 A;  1E2S P;  3MK2 A;  4MHX A;  1O99 A;  1E33 P;  3KD8 A;  4LRE A;  1ELZ A;  4ZG7 A;  1KH7 A;  4LRD A;  4LR8 A;  3M8W A;  2G9Y A;  3M8Y A;  5HRT A;  3UN3 A;  1ANI A;  4GTX A;  1AJD A;  1EQJ A;  2W5W A;  1KH5 A;  3MK1 A;  3ED4 A;  4TN0 A;  1KH4 A;  2W5T A;  1EJJ A;  3UO0 A;  4UOR A;  3IDD A;  1ELX A;  3Q3Q A;  3IGY B;  5EGH A;  2IUC A;  3IGZ B;  4LQY A;  2VQR A;  3E2D A;  5LRM A;  5DLW A;  4CXU A;  1AJB A;  4LR7 A;  4ZGA A;  3TWZ A;  4CYS A;  4GTY A;  2GA3 A;  2ANH A;  3NKQ A;  1Y6V A;  5C66 A;  4LRB A;  3NKR A;  3DYC A;  4CYR A;  1ZEF A;  4UPL A;  4UOO A;  3UN2 A;  4FDI A;  4KJG A;  5AJ9 A;  3BDG A;  4LRF A;  4GTZ A;  4UPK A;  5KXA A;  1EW9 A;  1KHL A;  3NKO A;  5LQQ A;  2W5X A;  4QAX A;  3T00 A;  1ALI A;  1KH9 A;  4LRA A;  3NKM A;  2D1G A;  1ELY A;  4GTW A;  2ZKT A;  1B8J A;  5LIA A;  3WAW A;  3BDF A;  5GRR A;  1KHK A;  4CXK A;  5L0B A;  2XRG A;  2QZU A;  4MY4 A;  5TJ3 A;  2GSO A;  4UPH A;  5L0K A;  2GSN A;  1HQA A;  4MIV A;  4KAV A;  5DLT A;  4ZG6 A;  3UN5 A;  4N7T A;  2W8S A;  1Y7A A;  5GOV A;  3M8Z A;  3CMR A;  3BDG B;  1EW2 A;  1URB A;  4NWJ A;  1K7H A;  1N2L A;  3WBH A;  3T01 A;  4ZG9 A;  3DPC A;  3MK0 A;  5EGE A;  1ALJ A;  5L0E A;  2W8D A; 
#chains in the Genus database with same CATH topology
 2DGT A;  4TYB A;  3G9C A;  3LWM A;  1NKE A;  1APS A;  1LWC A;  2GC8 A;  3S01 A;  2W2N P;  1ALH A;  2A2D A;  2HZA A;  5IS2 A;  5LJ3 Y;  1DTQ B;  4EI2 A;  1TL1 A;  4J9R A;  4NWB A;  3U1N A;  4FDJ A;  2KVI A;  5CXT A;  3TUP A;  1RBL A;  1K0T A;  4ZP8 A;  4PWD B;  2BAN B;  2HIQ A;  3LW5 C;  4H4K C;  4G65 A;  2DY9 A;  3N6M A;  4PQU B;  1TL5 A;  3KG1 A;  5IQQ A;  3GFH A;  2HBR B;  2FGC A;  5K8M A;  2M0G B;  3I32 A;  4U9R A;  4LRC A;  4C6A A;  5IT0 A;  4DLE A;  2RML A;  1T95 A;  4DL7 A;  3K0J A;  4ZVE A;  2HND A;  2HS4 A;  2IM0 A;  2ZBQ A;  3W62 A;  2D3O R;  2XRG A;  3W5X A;  4LT6 A;  4OX7 A;  4NCG A;  1Q7Y T;  3UR3 C;  4UOC A;  4WXO A;  4F3O A;  2VON A;  1I94 J;  1FT8 A;  3K5M A;  4PCQ A;  1DTT A;  3AHP A;  3QNW B;  2HQC A;  2YH1 A;  2FJX A;  2B5J A;  2MKI A;  2HWI A;  2ASL A;  3ZZU A;  3FSX A;  4KQZ A;  2XHC A;  1ACM B;  1XWL A;  3NBP A;  1HBO B;  2RQM A;  3NG8 A;  4KBI A;  3OL8 A;  2MLY A;  2ZUA A;  2LQB A;  3O6Q A;  1KLM B;  3EZU A;  1REG X;  3C19 A;  3UNG C;  3GSD A;  1B99 A;  2MQQ A;  1RAA B;  4PUO A;  2F7V A;  1ED8 A;  3KJN B;  3GSI A;  1V3R A;  1EW8 A;  2XGQ A;  1L3K A;  1O8B A;  3L7P A;  5DQI A;  3UE2 A;  1RT4 B;  2DH9 A;  3I82 A;  1KH7 A;  3MCO A;  5DQG A;  1CJU B;  3NCR A;  5CYQ B;  4ZIW A;  4DR2 J;  3IAS 9;  3CME S;  2BE9 B;  1P6T A;  2WW4 A;  1X9W A;  1TMM A;  1KWM A;  3MEE B;  1KVK A;  1XC9 A;  2KFN A;  4X4N A;  4OJH A;  1YKW A;  4S0M A;  1LWE A;  2V50 A;  2HHU A;  5J2P A;  3W8P A;  2ZH8 A;  1YQH A;  2ERR A;  1O6X A;  4DL3 A;  2KM8 B;  3N0V A;  4O3P A;  4DN9 A;  5IT9 U;  2V2V A;  5F0U A;  3RR7 A;  4TLR A;  1AJB A;  2FUG 9;  2JNJ A;  3PJX A;  4IG3 B;  4OZ2 A;  4F8R A;  1XR7 A;  2HAI A;  2DGX A;  3V2U C;  5KFT A;  2XMT A;  1S1V A;  4ZK7 M;  2W7O A;  3NKR A;  3JSY A;  2GAH C;  4N8O A;  2VFU A;  1KP6 A;  3TZZ A;  3FBF A;  3BDG B;  2E5G A;  5DGB A;  1Q82 T;  1DJ0 A;  2DNK A;  2VBW A;  3PRV A;  4NLV A;  2Y1J A;  3V5R A;  4JI0 J;  1S9E A;  1MRO B;  1SXL A;  2AYG A;  1VIO A;  1HYS A;  1K0V A;  3BM7 A;  3KMS A;  2CAD A;  5HRO A;  1EW9 A;  2H48 B;  2P8I A;  5LQQ A;  3ETM A;  2N3L A;  1NO8 A;  2VL1 A;  4FNH A;  4B3T J;  3KLE A;  2KYX A;  2MST A;  3V6K A;  1IM6 A;  3IWL A;  1ZA1 B;  3WDO A;  3J7A N;  3R2C J;  2BKO A;  4RJV A;  4DPY A;  3ZZR A;  1IBM J;  2RU3 A;  2BJ7 A;  5IM0 A;  3UD4 P;  3WAW A;  4NLP A;  3D2W A;  2IAJ B;  4KH1 B;  7FDR A;  1RTJ B;  4RW6 A;  2BJD A;  1WOP A;  3K8V A;  3QT8 A;  2V4J B;  4I7F A;  2R7X A;  5D15 A;  1S57 A;  3M8Q A;  3SEO A;  2CAJ A;  2GSN A;  2QX0 A;  1M1H A;  1RAF B;  1YGY A;  1FFW B;  2KO1 A;  2YQ3 A;  2E5L F;  1QAI A;  2HFV A;  3CJT A;  4PWW A;  3HHL B;  3QFW A;  3VAI A;  2HGN A;  1XMO J;  1PYT A;  1UVI A;  1YRU A;  2VDH A;  4DR4 F;  1KFD A;  3OR2 A;  1WOO A;  5KFJ A;  3T01 A;  2YNH A;  2JC0 A;  2V4R A;  2NUH A;  2AJ0 A;  3MEC A;  4IFY B;  2CPJ A;  5EHH A;  1IVZ A;  4DZ6 A;  1FJ7 A;  4WJB A;  1HBU B;  1R3N A;  2GGP B;  4IFV A;  1N56 A;  3KKF A;  1YSJ A;  3NS5 A;  4AQY J;  4RWX A;  4LJM A;  3IGN A;  2GZO A;  4DV3 J;  1OMS A;  4ZPT R;  4OI1 A;  2JWN A;  2AKW B;  3EPG A;  4LF8 F;  3BGL A;  2PDA A;  2W9C B;  1B4S A;  1HW9 A;  1RKI A;  4ECS A;  4RNH A;  2DNN A;  4RNN A;  1VGY A;  2NZC A;  4BHQ A;  4K4W A;  2YX4 A;  2KDO A;  5ITH A;  4DR1 F;  3KLG A;  3PCO B;  3HDS A;  5F8M A;  1I5O B;  2E44 A;  2YQ1 A;  5A2Q U;  4DSF A;  4J9P A;  3GIL A;  3FSY A;  4Y6I A;  2H4W B;  1OWX A;  3BH7 B;  1S4E A;  4J37 A;  1GNK A;  3G8Q A;  1TP7 A;  1QJH A;  2DNH A;  5AXL A;  4C3M A;  1WSV A;  4UOG A;  5B09 A;  1PCA A;  3VAJ A;  2Z2Y B;  5B0F A;  5IXU A;  3ZZZ A;  1WD6 A;  4IFV B;  1IKV B;  3OSN A;  2Q79 A;  2EK1 A;  2C2Z B;  3DRP A;  5LSO A;  3OSP A;  2BQU A;  3SQG A;  2V8P A;  1RWW B;  2Z4P A;  4RR5 A;  1FJG F;  1SV5 B;  1OQ6 A;  1DQA A;  1TAU A;  2WSC C;  4M63 A;  2HHT A;  2YY3 A;  3BDP A;  3C66 A;  3KOA A;  1ELZ A;  4DPU A;  1ITP A;  3DGV A;  1A9N B;  1JLC A;  1NBE B;  3POT B;  2CYY A;  2NCK L;  5DGA A;  9RUB A;  1UVL A;  4QQB A;  2IBO A;  2DGS A;  1VBK A;  4ID8 A;  2ZD1 A;  1TUV A;  2HFO A;  2QYC A;  2YNI A;  3EX7 B;  4LMZ A;  4NLY A;  3TAN A;  2FJE B;  1FKA F;  3BKU A;  1IKX A;  4PG6 A;  1K8A T;  2NXN A;  4LSN A;  1RT1 A;  4PWU A;  1S10 A;  1JMT A;  3T41 A;  3M6X A;  4OJG A;  1U1P A;  4ED2 A;  1PYS B;  2HRY A;  4KIA A;  3UQS A;  4USJ C;  4CO2 A;  4LQY A;  2CPF A;  1DUR A;  3U7J A;  4IH5 A;  1Y5L B;  4JI2 J;  2GIR A;  2BVZ A;  2UU9 J;  3KK3 A;  3G8S A;  1VRQ C;  2V4J A;  5DG9 A;  3CC2 S;  2XZT B;  4Y28 C;  3CC7 S;  1FKO A;  5DDP C;  2B0G A;  4LF5 J;  2ZBR A;  2RE1 A;  4OZ3 A;  1IR0 A;  4YDD B;  4I6A A;  3W60 A;  2B43 A;  3EXY A;  2MKY A;  4X65 F;  2YNG B;  3CCE S;  4C8Z A;  3B8H A;  4LRF A;  1LW0 A;  4NLQ A;  3UCU P;  3D5M A;  1RCX B;  2WVE A;  2CQG A;  1IBL J;  3CD6 S;  1G2E A;  2D1C A;  1NDP A;  3G8T A;  3TQ1 A;  2CWK A;  1KHL A;  2E1C A;  4KHP F;  4LF7 F;  1UFW A;  2PSZ A;  1CC8 A;  1JQG A;  3ICL A;  2YKN A;  3D66 A;  2XQC A;  3FUY A;  2RSQ A;  1KQK A;  1F6T A;  5D6G A;  3NKM A;  1VR6 A;  2LFV A;  4CI0 B;  2NS1 B;  5BYS A;  1LFP A;  4NYZ A;  2OH2 A;  2D3O 1;  1IBK F;  2EXU A;  2AU0 A;  3BDF A;  1X0P A;  4NA2 A;  2UXD J;  5GRR A;  3GP9 A;  4AL6 A;  3SSQ A;  2V34 A;  2NLW A;  4Y2K A;  2FTR A;  4AE5 A;  2RS2 A;  4UUW A;  3AA9 A;  3ZTP A;  2FLO A;  5FDL A;  5HI7 A;  3SDE A;  1WTB A;  2H4Y B;  2DHA A;  4G1Q A;  4EGL A;  4RU9 A;  2ZH6 A;  3M32 A;  3J81 Y;  2QFJ A;  2V9K A;  1ULR A;  2M7S A;  1C0U A;  2OUG A;  4NOH A;  4U8Y A;  1WDD A;  5DQH A;  2VIH A;  1YDL A;  2APO A;  1RWU A;  3PYE A;  5K5M A;  4WPA A;  3R7S B;  2B7B B;  1JKH A;  3DMJ B;  4QBU A;  1EJ7 L;  3H42 A;  3M6W A;  4ZG9 A;  3VVU A;  2Q6B A;  3R5J B;  2AJ1 A;  5L0E A;  2HHV A;  2NRE A;  3TEG A;  1U25 A;  2IIH A;  4JI1 J;  1AT1 B;  3DRY A;  3TX0 A;  3MM5 A;  1WKJ A;  2A10 A;  3HFV A;  4OHW A;  4X66 J;  6FD1 A;  2KXF A;  3DXS X;  1N5S A;  4C0B A;  2MKS A;  4WYL A;  5BYR A;  1VK3 A;  4DQR A;  1QAY A;  2GV1 A;  3DRP B;  3GFY A;  3KWM A;  2CZ9 A;  3EE3 A;  2QFI A;  1W2B R;  1U49 A;  2HMI B;  3RB4 A;  1KQF B;  2IY5 B;  3J7Z T;  3BBB A;  4Q2M A;  4MJK A;  3OJS A;  5E2Q A;  4MAK A;  3EZ5 A;  2UV8 G;  1S97 A;  2KZZ A;  1Z2Z A;  3QO9 A;  2R7Q A;  3BDE A;  3ET6 A;  1U1O A;  4PXC A;  1N32 F;  4V1A k;  5EUH A;  2ZBP A;  1VFJ A;  1U1L A;  1P49 A;  4B9T A;  2HIY A;  4CH1 A;  2C2M B;  4F25 A;  2VOO A;  1CBK A;  1YZ6 A;  1HBM A;  3NKP A;  1SJ1 A;  4DF4 A;  4IOB A;  5HVH A;  2NPI A;  3KHH A;  3V4I A;  2V9W A;  4DSL A;  1C4A A;  2D74 B;  4ZHR A;  3CJ5 A;  4W92 B;  2YKQ A;  4A8S A;  4OYP A;  1YJR A;  1XNR J;  5GAD U;  5HL7 Q;  1VRT B;  1U26 A;  1N88 A;  1FJC A;  3RZA A;  4IQM A;  2ALZ A;  1YIT S;  4J9L A;  2O1P A;  4ELT A;  1NPP A;  2N7Y A;  2ZC3 A;  3HVT B;  3LOU A;  3NKY A;  1GXL A;  3QGP A;  1QTN B;  1RWN B;  3ILI A;  1VC5 A;  1FK9 B;  5KG0 A;  2QA4 S;  4EYI B;  2V69 A;  1Y3K A;  4EUV A;  5H9F K;  4EZ9 A;  2FHJ D;  2FLP A;  1RWV B;  4P73 A;  3BYR A;  1RIS A;  2MKJ A;  4F04 B;  2YPZ A;  5E3A A;  5LSR A;  3ILJ A;  1I51 B;  2MZ1 A;  2JLE A;  5GVQ A;  2UUA J;  2LEA A;  2KTQ A;  3NXZ A;  1E2S P;  1Y7P A;  2K1R A;  2OGU A;  4QPT A;  5I42 B;  1RA6 A;  1E33 P;  3QAU A;  1T9W A;  2DR8 A;  5KFO A;  1LWF A;  1HQE B;  3IC1 A;  3FSI A;  1FD8 A;  1MNE A;  1P1L A;  2OD6 A;  5E33 A;  5L1J A;  4JI4 J;  3HHN B;  3QJJ A;  4PWD A;  2K2P A;  4F67 A;  2W5W A;  3HHK A;  3DRR B;  1RTI A;  2ZFH A;  4UZC A;  1SH0 A;  1QVF R;  3OLA A;  3K59 A;  1TK0 A;  2IRY A;  4FYV B;  4IKA A;  1C0U B;  1WOR A;  5HQL A;  4DV7 F;  1EIY B;  2AJF E;  2GJ2 A;  2Q3P A;  2RQ4 A;  2RT3 A;  3HUL A;  2PA3 A;  2LXU A;  2RJZ A;  2N7C A;  2CJK A;  4O4G B;  4DSE A;  2VIC A;  4K4U A;  2B9Y A;  2XYH B;  1MG7 A;  3I0S B;  2HS3 A;  1LXJ A;  2ILZ A;  1TVR A;  3B4M A;  3CED A;  4ICL A;  4HDH A;  4K2X A;  4RX6 A;  3WBZ A;  5GAG I;  2X7I A;  3MF5 A;  2HNZ B;  3H20 A;  3RBZ A;  5KFZ A;  4FDI A;  2P6S A;  3FMB A;  2NZ4 A;  2OPR B;  4DOZ A;  4M95 A;  4ED6 A;  1TV6 A;  3JQK A;  3E01 B;  4ZLP A;  4ZLN A;  5RUB A;  2PD1 A;  3GLJ A;  3L7U A;  3P96 A;  5LT5 A;  2CIM A;  4CTA A;  3VR1 A;  4ZP6 A;  1TUG B;  4I2Q A;  3OTD A;  1S1V B;  1XR6 A;  3QT5 A;  3KNG A;  1CUL B;  2Q1L A;  4UST A;  4ETX A;  2H5I B;  2BE2 B;  4CLW A;  3ISN C;  3EVM A;  3IBC B;  4DL0 C;  2NUU G;  4DV4 F;  3AJD A;  4KHP J;  1F3F A;  2XBP A;  1M1K T;  2BQ3 A;  2M5Y A;  4PG7 A;  1X9S A;  1KHK A;  4E8U A;  2HMI A;  2XI3 A;  3EUN A;  2HKE A;  2JRS A;  1GQE A;  2ZOF A;  3NY0 A;  1RP5 A;  4QIE A;  4DPO A;  3MR2 A;  2OIH A;  1R7I A;  1CVJ A;  1U8S A;  3Q2T C;  1Q8I A;  4ZCM A;  5IOL A;  4A48 A;  2E9R X;  1RK8 A;  5A8W B;  1PJ6 A;  4NCA A;  4PG5 A;  2YWW A;  4KY3 A;  4LFC F;  2AD9 A;  3MDF A;  3H5X A;  3CMR A;  2AJ2 A;  3BO4 A;  2WSF C;  1JLG B;  1SJQ A;  4DR5 J;  1X4D A;  2NR0 A;  1AYE A;  5SZT A;  2B4P A;  1KDN A;  2H5J B;  2DCU B;  1U1M A;  2RNE A;  4B9L A;  3MMB B;  1NHK L;  2YNF A;  2HNY A;  3DOM B;  2XY7 A;  1H72 C;  4I7F B;  1AZS B;  1U7L A;  2OEK A;  3H8Y A;  2D7S A;  4ZHR B;  1H38 A;  3EGZ A;  1WSR A;  2W8D A;  1E3C P;  2IMW P;  4Q0B B;  4WU3 A;  2Z0G A;  1RT7 A;  2DGU A;  4HTI A;  4C2M A;  2W2Q P;  4UT4 A;  3MI7 X;  4CH0 S;  2JEJ A;  1P9Q C;  4ZIT A;  3A3N B;  2WVF A;  4MKV A;  5IM0 B;  1KLM A;  2MZR A;  2UP1 A;  4E2F B;  3UFC X;  3EGW B;  1RT2 B;  4KHR A;  1EKR A;  3WAX A;  1PBU A;  2KHC A;  3L95 X;  4ILR A;  3HSJ A;  3WIU A;  3PYG A;  4JI5 F;  2XSJ B;  2B8Q A;  2B5J B;  2W2O P;  4DR5 F;  1QVG R;  2Y9H A;  5C5J A;  1VQ4 S;  2F9J A;  2XLI A;  4O3S A;  2HVI A;  4ELV A;  1XR5 A;  3LXQ A;  2DNY A;  5KFS A;  3N5B A;  2VV5 A;  3SZZ A;  1UEV A;  3E51 A;  1Y9O A;  2W5Q A;  3J7Y I;  5INH A;  1UPM B;  5J1E A;  2NSC A;  4OX8 A;  2VKR A;  3D4J A;  4LUB A;  3S1T A;  5B0D A;  1Q1K A;  1UA1 A;  2DPJ A;  2Q66 A;  1HBN A;  3GIR A;  2E1M C;  3O3L A;  1U1N A;  2VQE J;  2Y3Y A;  1NB7 A;  1HHT P;  2VG6 A;  4RUC A;  4FXD A;  3IP0 A;  3CDU A;  5L8R C;  1FRL A;  3FMW A;  1URA A;  4PEO A;  4TY8 B;  1OO0 B;  2FHK A;  2ZZM A;  3NMA A;  3AJ2 A;  2D9O A;  2PC6 A;  2YX1 A;  3R7N B;  2B6A A;  1S77 D;  2WBR A;  1HHQ A;  1UWB B;  3W2W A;  4EU0 A;  3T1H F;  3EIC A;  2AF6 A;  4ATN A;  4Y00 A;  1PC4 A;  1WAC A;  1NK9 A;  3SZY A;  1WF2 A;  2CZ4 A;  3OV7 A;  1SQF A;  3UNY A;  4U96 A;  3FBE A;  4C8O A;  3HHL C;  2DNM A;  4RZR A;  4GVL A;  3MGJ A;  1M5K C;  3T1Y F;  3RB6 A;  3BGR A;  4JYA J;  2EVZ A;  5CAA A;  3ILO A;  1KTV A;  2KKH A;  4X4Q A;  2R9L A;  2I5J A;  2CPI A;  2KXH A;  2DCL A;  3C6U B;  1BQX A;  4ZPC A;  1BHN A;  1CJK A;  1BWE A;  1IWG A;  2KI2 A;  3DYA A;  1FFG B;  4Z7C A;  2CQ1 A;  1R0B G;  1Z4U A;  1X5T A;  4MK9 A;  1KH5 A;  3MEG A;  1RI7 A;  1YI2 S;  2QSW A;  2VA3 A;  1LXN A;  2EKN A;  2Y8W A;  5KG4 A;  1IKY A;  3QGH A;  2BE2 A;  1Q16 B;  3I5C A;  4WP8 A;  2LDI A;  3PYD A;  1RYR A;  3J81 j;  1L3T A;  2J6T A;  3IWX A;  2IVF B;  1T94 A;  4Y65 A;  5E0O A;  4F3M A;  1CJT A;  3CF5 Q;  3HX9 A;  2J0Q D;  4B3M J;  1C0T A;  3M9M B;  4ZGA A;  1IR2 A;  1NXI A;  4RW9 A;  3CSK A;  1RTJ A;  4RW6 B;  2KRB A;  3K5L A;  5HJX A;  1MWZ A;  5E3C A;  4USK A;  2CPY A;  4TU9 A;  2BUN A;  4ECU A;  2V8D A;  5C2G A;  3JTP A;  4JV1 A;  3L7O A;  3MR5 A;  4KKO B;  1U8W A;  2IRX A;  2A6M A;  2VKZ G;  1OY9 A;  1T0T V;  5HMZ A;  3DLB A;  5D3G A;  3HF5 A;  4X84 A;  3B54 A;  4K4V A;  1RUS A;  3HSZ A;  3EGV A;  2HWT A;  3JSM A;  4DFM A;  3ZZP A;  1U6F A;  1QDU B;  1SL0 A;  4WBF A;  1XN9 A;  4QAX A;  3KHR A;  5D0E A;  3FZ2 A;  4WP9 A;  2V67 A;  5EWG A;  3CCR S;  4OI6 A;  1J5E J;  4DPX A;  1SKS A;  4UOH A;  4IRD A;  1HNW F;  1XIQ A;  2FYX A;  2V8G A;  2J0X A;  3W2V B;  2ADB A;  1S48 A;  2C3Y A;  1LW0 B;  2MDA A;  3O44 A;  4U8V A;  4FF1 A;  2E9Z A;  3PYF A;  3LPY A;  5HP1 A;  1UW4 A;  2VQF J;  4LBP A;  2HHX A;  4L72 B;  4MY4 A;  1S1T A;  1Y0H A;  4PR6 A;  2PII A;  5H9E J;  2OJ3 A;  1LK5 A;  3M8P A;  4KAV A;  1KVJ A;  5GOV A;  2LA6 A;  5IC4 B;  1SPB P;  1FKP A;  4R8U B;  2IVM A;  3DOK B;  3M4X A;  5HAN A;  5MAO A;  1YVF A;  3PW4 A;  2E5H A;  2OSR A;  4P2S A;  5KG7 A;  2ZZN A;  1MML A;  3GII A;  1HPZ A;  3OR1 A;  1NM2 A;  2E5J A;  1JLF A;  1OY6 A;  1NZA A;  1S49 A;  3HFZ B;  5I4M A;  2R42 A;  3SBM A;  2BA9 A;  1S76 D;  3CCU S;  1G6B A;  4O44 A;  1C4C A;  1CUL A;  2IA0 A;  1I1G A;  3ONQ A;  2L3M A;  4M5M A;  2ZDO A;  2MKC A;  3S8S A;  2JHE A;  3DDK A;  4P72 A;  3W2W B;  4DL2 A;  3T02 A;  3OXG A;  2CDR B;  2RS8 A;  3R6G B;  3HD2 A;  4BC9 A;  1RU2 A;  4GMK A;  5CAB A;  1X5O A;  1JJH A;  1FI4 A;  1JLQ A;  5L1K A;  3TAQ A;  2HEK A;  3KJQ B;  3UD3 P;  1Y3J A;  2X98 A;  3HM9 A;  3CIM A;  5L1I A;  3N6N A;  1OYE A;  3W3S A;  2HGL A;  3GG1 A;  4CLL A;  4DZD A;  4YR2 A;  1FE0 A;  2HBY B;  1LWX A;  1RJJ A;  4NEZ A;  2DIT A;  2VZ9 A;  4ANC A;  2ZH4 A;  1NJX A;  4Q43 A;  2KN4 A;  4NRT A;  4ZVP B;  4ZIV A;  5C2C A;  6AT1 B;  1VHF A;  1JLB B;  3GYN A;  3U02 A;  4CYU A;  1RHQ B;  2HQF A;  2CQB A;  4W98 A;  4QWD A;  3R8Y A;  1WHY A;  3VGV A;  4ERD A;  1IKY B;  1Y5I B;  2CG4 A;  3Q8P B;  4RU2 A;  2MY8 A;  4YQW A;  3BSC A;  1KC8 T;  3DKD A;  3TP2 A;  1D09 B;  4FXV A;  5E3R A;  1GTE A;  2UXC F;  4OJ1 A;  1T9T A;  5L39 A;  3EJM A;  2NXJ A;  2EFN A;  4OZJ A;  3BS9 A;  4QIG A;  4YME A;  2ATC B;  3PRD A;  4HHJ A;  4B3R J;  5CH7 B;  4WF9 Q;  4CO5 A;  5HQ8 A;  3CUN A;  4LRE A;  4OX6 A;  1EAY C;  1ZH5 A;  2FJB B;  3BRE A;  3O1L A;  2GA7 A;  4H4M B;  5AXK A;  2OML A;  3BBC A;  1XNR F;  3O5T B;  3M8Y A;  1L5U A;  5M2P A;  2MPU A;  1AXQ A;  2V8V A;  2VFT A;  2ZWP A;  5K20 B;  3IR5 B;  3OXL A;  4AD6 A;  2UVU A;  4EBD A;  2QL9 B;  2R7W A;  3KLE B;  1R8P A;  4JI2 F;  1Q5V A;  4X64 F;  4GC6 A;  2UVW A;  5A76 A;  1XNQ J;  3QRQ A;  1VRT A;  3A8I A;  4A4J A;  2UVV A;  4FXW A;  5CQG A;  4WE1 A;  2Y1R I;  4I6Y A;  5EGH A;  1FHT A;  3LO3 A;  4FBU A;  3Q83 A;  4NCG B;  1X7V A;  4RBV A;  2QN6 B;  3R5C A;  2VG5 A;  4C8M A;  3SQO P;  3T19 A;  5L1L A;  4PUO B;  2PFD A;  1S6U A;  4OLP A;  4EYH B;  3VGT A;  4IUF A;  2G4B A;  2DEI A;  2HRU A;  4JI4 F;  3PDN A;  4ES2 A;  4NE9 C;  3NAH A;  4G6V B;  3DYC A;  2BJ9 A;  2GQ2 A;  4CRJ A;  2WON A;  1H2U X;  3WQP A;  1CLF A;  3ETO A;  1ZEF A;  2JLG A;  3FRZ A;  1LWF B;  1XNQ F;  1SJ4 P;  3N5F A;  3IRX A;  2B9E A;  1VQO S;  4K4Y A;  3BGO P;  1JXL A;  3BV8 A;  2X1A A;  2F9D A;  5KTQ A;  2ZH2 A;  1HNW J;  1X8D A;  3EVO A;  1VMB A;  1RTI B;  1Q95 G;  3JQM A;  2DNG A;  5KFM A;  5GAD I;  4Q44 A;  5F9N A;  2GHP A;  4K4T A;  4DSI A;  1F2H A;  1KVI A;  2W5X A;  2H51 B;  4X62 J;  4I0W A;  3MM5 B;  3CCT A;  1QLN A;  5SUH A;  4IYQ A;  1ZTW A;  4KYZ A;  3W64 A;  4Q2L A;  3ZTO A;  4A8O A;  3W5Y A;  1YJW S;  4P7T A;  1GMW A;  3OFE A;  4K4S A;  3A8K A;  1V3Z A;  2FLL A;  1EP4 A;  4MKY A;  2ROG A;  4HDG A;  1E6V B;  4NML A;  1NSK L;  4ZLL A;  5B08 A;  1NJZ A;  4DSJ A;  2EC0 A;  4B56 A;  3UDV A;  3C15 A;  1IBK J;  1X0F A;  4CZC A;  2LU1 A;  1OY8 A;  1WKK A;  3AH6 A;  3ENQ A;  4L3N A;  2M70 A;  4ZG6 A;  3MM6 B;  3RAM A;  3GYG A;  5JVH Q;  2BAC A;  2Z58 B;  2EK6 A;  1UA0 A;  4ECY A;  1KD1 T;  4M5G A;  1K7H A;  1ZAW A;  5EGE A;  4RL1 A;  2C3O A;  2GX8 A;  5KFR A;  4CTA B;  4DPW A;  4P52 A;  5CD4 A;  4KFB A;  3I55 S;  3KK1 A;  3KYL A;  1NKC A;  2DIV A;  3Q89 A;  1S6O A;  3VQT A;  3HZE A;  3RBE A;  1VJW A;  3HO1 A;  1HWK A;  2EFG A;  1IKV A;  3MM8 A;  4NLX A;  3BO2 A;  2Y1I A;  5KFH A;  4K0K J;  3GMG A;  2H3E B;  1PGZ A;  1AFJ A;  4BWM A;  1BY9 A;  3G6X A;  4UPI A;  2YPY A;  2ZKU A;  1UVN A;  4OHX A;  3AJ1 A;  1FEE A;  3FDS A;  4L73 A;  3SCL E;  2HFZ A;  3CJ0 A;  1XMO F;  2I6W A;  2VFV A;  3BN4 A;  5HAO A;  1CJV A;  4DR4 J;  3Q22 A;  3A52 A;  3LWL A;  4QW8 A;  1TKX A;  5F8H A;  3P6Y C;  2W5R A;  2FGO A;  4FN5 A;  4J9U E;  2HFU A;  4HT7 A;  1WDT A;  1U1Q A;  3DLL Q;  4FVC A;  3PO4 A;  3MOJ B;  3ISZ A;  3NOC A;  4R8U A;  4J9O A;  1GTH A;  1JNR B;  4DI6 A;  2HFS A;  2DKO B;  3W9I A;  1U1R A;  3TO8 A;  5A0Y A;  2YKA A;  3K5N A;  3VAG A;  1BQM B;  2K06 A;  4OYB A;  5JVG Q;  1MWQ A;  1W26 A;  1W2I A;  2GHW A;  3MPY A;  2G2O A;  3W66 A;  4C0H A;  4F0M A;  5T14 A;  1RHU B;  2B51 A;  4OYO A;  1XER A;  3WX4 A;  1HLW A;  2KT2 A;  4KJI A;  4Q45 A;  2BDP A;  2O3D A;  4YN3 B;  4WE1 B;  2FD2 A;  4ECV A;  1ZTT A;  1RAJ A;  4NA3 A;  2XZW A;  2EBE A;  3IBF B;  4PXE A;  2MQP A;  3J80 Y;  3HT3 A;  3K57 A;  3BKF A;  2YNI B;  3AB4 B;  3PKY A;  1TL4 A;  2NPF A;  2YWK A;  1U48 A;  1SJF A;  1JJ4 A;  4B3O A;  2E29 A;  3DGP A;  3WZ0 A;  2OD4 A;  2QV6 A;  2LDY A;  2G0C A;  2WVC A;  4Q8E A;  3KD8 A;  3M1V A;  2UXC J;  1P27 B;  4ZPD A;  5IWA J;  4HAC B;  1WUU A;  2AHO B;  5L46 A;  2UU9 F;  2DR6 A;  4NXN J;  2GVD B;  1ARO P;  4M5J A;  1QE1 A;  2R7O A;  3P45 B;  3OL7 A;  1XK8 A;  3G86 A;  4DG1 A;  1FKO B;  4EZ6 A;  3MK1 A;  3MCN A;  4ZVH A;  4FF3 A;  2YKM B;  1BMQ B;  1NU4 A;  2VB6 A;  3W2V A;  3IGZ B;  2AEM A;  3CJ4 A;  4DFP A;  4B3S J;  2B4U A;  3NNC A;  2M8H A;  4WIQ A;  3CCL S;  1GMU A;  4TY9 A;  3HD1 A;  2EFV A;  2C3P A;  2OFH X;  3NGU A;  4QZV B;  3QGG A;  2J7W A;  4CYR A;  1HQU A;  4UF4 A;  3QJP A;  1DY3 A;  3RYL A;  4YS2 A;  1NZ8 A;  4HEA 9;  3MPU B;  1R0A A;  1JLF B;  4OHV A;  4KV8 A;  1ZS6 A;  4UPK A;  2B7C B;  1P9Y A;  2KFY A;  2WB4 A;  4Z7Y A;  3SZ2 A;  3RBX A;  5ETO A;  4ZPB A;  1X4H A;  2PO4 A;  3TUZ C;  2ZOM A;  1N34 F;  1P1T A;  4P10 A;  4MKB A;  2MEW A;  1EB0 A;  4HLB A;  5DM7 Q;  3Q8U A;  2N82 B;  4F0H A;  5F8L A;  3D1Q A;  4P74 A;  4DUZ J;  1HAR A;  1N5Y A;  1DZ5 A;  1F5B A;  3CDW A;  2L9N A;  5AJ3 J;  5L0B A;  4QIW D;  2DB1 A;  4ZPA A;  2W2M P;  4QU7 A;  3T6B A;  2GSO A;  4UPH A;  1R8B A;  5L0K A;  1FA0 A;  1YRT A;  3UVJ A;  2KG0 A;  1LFW A;  3R27 A;  1FER A;  1HQU B;  3EVW A;  2UUC J;  1S1U B;  2R7S A;  2MMY A;  3Q8S B;  3GPA A;  2R3V A;  1VIS A;  1NH7 A;  3CPW R;  4NWJ A;  3AOA A;  4TNO A;  1YK9 A;  1J2V A;  4QWC A;  1D9F A;  1VRU B;  1B0T A;  2KVQ E;  2XMA A;  2DIU A;  2C3M A;  2OSQ A;  3NCQ A;  4K5R A;  1PAU B;  4P75 A;  3OBI A;  3TRG A;  5BJR A;  2XLJ A;  4DV3 F;  2R8G A;  2ROE A;  2VG6 B;  3D9B A;  5IT9 Y;  4DLG A;  3DM2 A;  3N01 A;  4UQT A;  1SIZ A;  4HHH A;  1OS5 A;  2JSX A;  3AXM A;  5CHC B;  3W65 A;  4C3K A;  4JI5 J;  1A0O B;  3NVL A;  5J1E B;  1FJE B;  4BBY A;  1FEH A;  2BQR A;  1REV B;  2A2C A;  3CDE A;  3SMZ A;  4OYM A;  3TZW A;  1HYS B;  1QE1 B;  4F2S A;  1HHS A;  2A0F B;  4P6Q A;  1YJV A;  1DHM A;  2ZVS A;  5D78 A;  4I68 A;  3KK2 B;  1L3U A;  1D0E A;  5B0G A;  1Q79 A;  4OHZ A;  2P6T A;  4DQP A;  4HKQ A;  5DLV A;  2QA4 G;  1RT5 A;  2L41 A;  1AUS L;  2Z2L A;  2HAF A;  4MT1 A;  2B4O A;  2DHS A;  3IG1 B;  4OX9 F;  4EMD A;  1UET A;  3HHL A;  3PNI A;  3BO3 A;  2GIF A;  3ISN D;  1N2K A;  5EWE A;  2Z2M A;  1WC6 A;  4G1I A;  1Q8L A;  4NAS A;  3L3C A;  4JYA F;  3DC2 A;  3JTN A;  3I4P A;  4WCE Q;  5DLF A;  4CWB A;  4OZ1 A;  1YHQ S;  1S0M A;  1UFK A;  4YR1 A;  2B4V A;  4NZ7 A;  2WVD A;  2J76 E;  1AJA A;  1B7Y B;  2VU5 A;  4X4T A;  4O3O A;  2EFP A;  4J9N A;  2HBZ B;  1FRM A;  1H74 A;  1Y11 A;  4JI6 F;  1YJ9 S;  4LF4 F;  1NB2 A;  1K9M T;  2XR9 A;  2H54 B;  2IYI A;  3BSA A;  3KUG A;  2CJ9 A;  3EWG A;  2WCX A;  3R5A A;  3R7B B;  3MEE A;  1NH8 A;  4KHM A;  4XK8 C;  2XMK A;  1KNZ A;  3TAP A;  4J90 A;  1UJ6 A;  3P8B B;  4WKR A;  1MMD A;  5FLX Y;  4XDC A;  2QA1 A;  1JX4 A;  1KRP A;  2WTF A;  3C46 A;  1RTH B;  2MY7 A;  5ETQ A;  2JC1 A;  3MEK A;  3ELH A;  1X31 C;  4A8M P;  3AD9 C;  4ECT A;  3SCJ E;  4YB1 P;  2G9Y A;  4JV2 A;  1OPZ A;  3CD5 A;  1FCA A;  3LAM A;  4RW8 A;  4IOC Q;  5HRT A;  1FF2 A;  2LEP A;  3OUY A;  1U2C A;  5KFU A;  4I2Q B;  3OJU A;  5EN1 A;  3M8Q B;  3VAF A;  2J8S A;  3IM9 A;  5D0H A;  3IDD A;  1VHI A;  1X60 A;  4LIR A;  1SI9 A;  1N5Q A;  3GON A;  5D3G B;  2LMI A;  4C4W A;  4RW7 B;  1IQZ A;  3W61 A;  1SL2 A;  1R43 A;  2LQ9 A;  1Q5Y A;  1VQS A;  4ILL A;  4ZP9 A;  1SUQ B;  3A3O B;  4WXW A;  1B3T A;  2VA2 A;  4XO0 A;  1VQ6 S;  3MCS A;  5KG5 A;  3Q23 A;  2LQJ A;  2IHR 1;  5H9F J;  1R89 A;  3CO0 P;  2D69 A;  4AUK A;  3T5H A;  1Q8K A;  2LQ5 A;  4NLS A;  3SI8 A;  2GVD A;  4NLW A;  3MM7 A;  3J81 U;  3UW1 A;  4X4O A;  3TVY A;  3HHE A;  1C1B A;  1SB6 A;  2W24 A;  3CD0 A;  3L4B C;  4PAB A;  4U6P A;  5HVG A;  3KK1 B;  4L3K A;  3FVY A;  2Q43 A;  1NPK A;  4PYD A;  4F4X A;  2ZJR Q;  1B0P A;  3QLH A;  4LRA A;  4C7Q A;  5DM6 Q;  3F0N A;  4OQJ A;  3DRS A;  4K50 A;  4DX5 A;  4RUA A;  1DAR A;  3I9Z A;  3TVK A;  3UWT A;  3M6V A;  3PM9 A;  1RAH B;  1HQE A;  5IFM A;  2C28 A;  2BRK A;  4FF2 A;  2BEF A;  1MSW D;  1KSP A;  1I94 F;  4NLD A;  1VQP S;  3QAT A;  2YNH B;  4I2P B;  4DU8 A;  3G2X A;  3D54 A;  4UUX A;  4F4Y A;  2Y8Y A;  2CQ0 A;  5ETP A;  3HPO A;  2GIQ A;  4WWS A;  3D6F B;  4E98 A;  4QYZ K;  1TKD A;  3W5Z A;  1HNZ F;  3GTY X;  1PKU A;  3T5K A;  1GFW B;  1GXU A;  1WEZ A;  1NHU A;  3M8Z A;  3IG1 A;  4LFA J;  2FDN A;  2HRT A;  3DU6 A;  5KFA A;  5J2N A;  1HNV A;  3OQ2 A;  4F4K A;  1UWB A;  4OIX A;  3CCM S;  1EW2 A;  1V6H A;  2VG5 B;  2DNL A;  2CKW A;  3DLE A;  4ZLJ A;  2C2O B;  4CO3 A;  4IG0 B;  5J2Q A;  1GX6 A;  4J9S A;  4DL4 A;  5T7L A;  3LPE A;  3GV7 B;  3MMC A;  2JEI A;  1PBA A;  4NCB A;  2NYI A;  4M8L A;  1UEK A;  4U95 A;  3A3P B;  1F2G A;  4FNI A;  2AGO A;  4X2B A;  4GKK J;  2DEJ A;  2X3D A;  3CE8 A;  2JH3 A;  1RA7 A;  3NRB A;  5KFI A;  1IKW B;  5GAE I;  4OX9 J;  1M0S A;  4NXM J;  3IA0 A;  3M6U A;  4RBU A;  3PHE A;  3OTE A;  5K8O A;  1LW2 A;  2VBX A;  3QIP A;  4USV A;  4L74 A;  2Y1L B;  3IS9 B;  5DDO C;  1VC0 A;  1F9H A;  2DIS A;  4NXM F;  3NKN A;  4CLT A;  3VTI A;  1Y00 A;  2YKO A;  3TJ8 A;  5KT7 A;  1F1B B;  2P2C B;  1JK9 B;  4LF2 A;  1JXE A;  4J7C A;  1KN6 A;  4RW8 B;  4HHU A;  2DGO A;  4K0K F;  1AW0 A;  4EBC A;  2DPI A;  5KFB A;  4DQI A;  4PG4 A;  3GIM A;  1ALK A;  3PTW A;  2MHN A;  2GS8 A;  4LF6 F;  4KAY A;  1LQ9 A;  2OPQ A;  2GLQ A;  4WK1 A;  3MTJ A;  1N6Q A;  4GKJ F;  2KT5 A;  1TZ0 A;  3KFW X;  1H2T Z;  1RTD A;  1SHN A;  3IO1 A;  1DTQ A;  2MQ8 A;  1JLG A;  2E1R A;  3H0P A;  3GIK A;  3W8G A;  1VQ9 S;  4DR7 J;  2AYE A;  3CC4 S;  3CDA A;  3OVB A;  4IQX A;  3T3F A;  2ZVI A;  3I87 A;  4QR0 A;  4URQ U;  2RF2 A;  3FC9 A;  1D9A A;  5A2Q Y;  2Z8Q A;  2BXJ A;  1WNE A;  3NBP B;  1YX2 A;  3ULH A;  1YBT A;  1L3S A;  3SV3 A;  1T8E A;  4GKJ J;  2HQD A;  2CQ4 A;  2Z30 B;  4N5S A;  3R1L A;  4OYX A;  3TA0 A;  2F4F A;  4DX8 H;  5HQM A;  2KM8 C;  2R7T A;  3GJQ B;  3TOQ A;  3IN5 A;  4CT9 A;  3R97 A;  2J8A A;  4MIB A;  3BH6 B;  3QO9 B;  1V5I B;  2WW8 A;  2P9C A;  3NS7 B;  3FNN A;  4KKO A;  3GB0 A;  4EK2 A;  2HLT A;  2QLF B;  4FPI A;  2ABY A;  3MM7 B;  2J9D E;  5EDW A;  4LVN P;  3ZO7 A;  3C16 A;  3KHG A;  3MZI A;  1T9V A;  4UTG A;  3CO9 A;  3M30 B;  2ZM6 F;  4ECZ A;  3HKZ D;  4IG0 A;  4OMF G;  5J2Q B;  2XHW A;  1J5E F;  3NLC A;  4KFB B;  2OTL S;  3NKQ A;  2FZK B;  4LRB A;  2KZM A;  2FC8 A;  2MYF A;  4YY3 F;  4ED5 A;  5EWF A;  4AYB D;  1ZM2 A;  4IR9 A;  4J9Q A;  2N4D A;  2YWH A;  2I8E A;  5JUM A;  2KYZ A;  4KTQ A;  4OL8 A;  5B7W A;  1B64 A;  1TUW A;  2VJV A;  4GTZ A;  3KJV B;  3RW6 A;  3QPI A;  5KXA A;  4OV6 A;  2VH7 A;  5A6W A;  1BD6 A;  1ZPV A;  5AE3 A;  4UQG A;  4B3O B;  2HHQ A;  4PYA A;  5JMN A;  3B78 A;  2XNQ A;  1SKW A;  1ALI A;  1ZET A;  2I38 A;  3HSG A;  4OLO A;  1HMV A;  2BKN A;  5J2P B;  3L09 A;  3N4W A;  3D28 A;  4GVB A;  1LWC B;  5LL6 d;  2JZ5 A;  2MSS A;  2WHO A;  3R5G A;  4ZA1 A;  2HHH F;  4P71 A;  2AT1 B;  3NCP A;  5K14 B;  3M9O B;  2ZH3 A;  3ILL A;  2HBQ B;  2HG4 A;  4LBH A;  1X4F A;  3R5D A;  4NX9 A;  5KFD A;  2CJA A;  4A8Y A;  1S0N A;  2DRA A;  3VV2 B;  3M2U B;  5L9N A;  3D6M B;  1F9E B;  3J80 U;  4DV4 J;  3AOC A;  1HQA A;  3DFE A;  3IS9 A;  3LGM A;  4CO1 A;  3K5P A;  5KT6 A;  3PO5 A;  2AYM A;  1Y7A A;  5DLT A;  4JP8 A;  4C0O C;  1H73 A;  1PIL A;  2EW9 A;  2CQC A;  2DNP A;  1C0T B;  2A1B A;  1N54 B;  5HP1 B;  1MLA A;  1UTA A;  4A47 A;  1NHV A;  1UAW A;  2UXD F;  2PMW A;  2ZBI A;  3DI6 B;  1U6Z A;  1GX5 A;  1R0C B;  5C7P A;  1KFS A;  2J0S D;  2HHW A;  4WK3 A;  3HJF A;  3TAM A;  3I56 S;  1X4A A;  3MWB A;  3H5S A;  2XMV A;  3BPS P;  4FYX B;  4RNO A;  5F3Z A;  3G6Y A;  1HR0 F;  5IJQ A;  4PXD A;  1GMW D;  3CJ2 A;  4DV2 J;  1EX8 A;  3IXQ A;  3PRB A;  1C1C B;  3M2V B;  2R2S A;  1DLO A;  4DSK A;  1BGX T;  4LF4 J;  1TL7 B;  2DT9 A;  2J9C A;  3CDB A;  1T02 A;  3CJS A;  4K5S A;  2ZWO A;  2Z57 B;  4LR9 A;  2G13 A;  2DNZ A;  1Y4Z B;  3P5T L;  4RLE A;  1RTH A;  2DVI A;  3IR7 B;  2W1B A;  4USU A;  3KMQ A;  5K4P A;  1JNZ B;  3Q8Q B;  3FEZ A;  1X4B A;  2PEB A;  2D3U A;  3DMJ A;  4RUB A;  4J5O A;  5DJB A;  2GVZ A;  3B6B A;  4M5D A;  3ENV A;  4M5H A;  2CZV C;  2HNY B;  4ZCL A;  2E9T A;  5ETM A;  4WTO B;  1HKA A;  2ZH9 A;  1ICE B;  1FNM A;  2XCP A;  4IRK A;  3MR6 A;  4KM4 A;  4DUY J;  3SXL A;  2EG1 A;  3K2Y A;  3A8J A;  3TYT A;  1N48 A;  4CCH A;  1H2V Z;  5ETN A;  2CPE A;  1ZZF A;  2Z56 B;  4CDI A;  2XM3 A;  1CEZ A;  2FJA B;  2R4F A;  1Z2L A;  2MZQ A;  2QYG A;  3DOL A;  5HMX A;  1HPZ B;  1UEU A;  1KHN A;  1DLO B;  3IR6 B;  3K17 A;  1JLB A;  3M7V A;  4CYU B;  3AB2 B;  2VBY A;  4WU2 A;  5GMK a;  1B70 B;  4MHX A;  3ENW A;  3NGT A;  1DAX A;  3NGD A;  4C8L A;  1Q7L B;  3OFH A;  4Y34 A;  1DQ9 A;  1S4F A;  1FX2 A;  2A3J A;  3D6H B;  3W63 A;  1DRZ A;  1RT2 A;  3ZZ0 A;  1HNX J;  4ILM A;  1AJD A;  1MW7 A;  1RYS A;  1T03 A;  4KPC A;  2VC0 A;  2KB2 A;  2PFF B;  1NDC A;  3PY8 A;  2W5T A;  3UO0 A;  4ID5 A;  5CA5 A;  3HT0 A;  2HVH A;  1CG2 A;  3MXH P;  3OL9 A;  2VQR A;  1NSQ A;  3DLG B;  3H7H B;  2DK2 A;  2XG8 A;  2AEJ A;  1NRK A;  4MFB B;  1F5A A;  1HL6 A;  1S59 A;  4LR7 A;  5ETR A;  2W8L A;  4ED1 A;  1X4C A;  2G2Z A;  2X1G A;  2HGM A;  4M5I A;  3LAL A;  1Q53 A;  5HMW A;  1JJC B;  3GQC A;  4GTY A;  3MD1 A;  2BW7 A;  2E7W A;  4CLP A;  1Q8B A;  3BGR B;  2QLJ B;  4H54 A;  1K47 A;  2RF2 B;  1ZPW X;  4KSE B;  5K9F A;  4DCJ B;  2O67 A;  5F8I A;  3PKM A;  3RW7 A;  1TU0 B;  5B0B A;  1RT7 B;  1IN0 A;  1CJU A;  3BPD A;  2CFX A;  2MLZ A;  3LUY A;  5HJY A;  5K8P A;  2UVR A;  4PPD A;  3T6J A;  5I3Q A;  2RAQ A;  2F4V F;  4XPC A;  3OR2 B;  1BE4 A;  1UW9 A;  1KBR A;  2VAS A;  4Z2X A;  4DQS A;  3MAQ A;  1LWE B;  2R8J A;  4CLS A;  4LSN B;  1KR4 A;  5BXI A;  2ASY A;  5LOQ A;  2QC3 A;  2ZKT A;  4Q0B A;  1G3O A;  3C6T B;  5G4D A;  2UXB F;  4R0J A;  5C42 A;  4KR0 B;  5LMU F;  1SJ3 P;  1BC6 A;  3QWP A;  3DYA B;  3LA0 A;  2CJX B;  4NRU A;  2N4C A;  5DS7 A;  4HL9 A;  4DV0 J;  4KGX B;  4QW9 A;  2RB7 A;  2M8D B;  2HK3 A;  4ED8 A;  3KTQ A;  2B9X A;  3QIP B;  4RO0 A;  5JXS A;  2KJV A;  7FD1 A;  3PX4 A;  3TAM B;  2CVE A;  2BOP A;  1VYA A;  2HND B;  1LK7 A;  2POK A;  2Q6C A;  5CZV A;  2FVQ A;  4EO6 A;  3AD8 C;  3KLH A;  1SH3 A;  2MB0 B;  3A12 A;  1BQM A;  1PYO B;  1N33 F;  4KE5 A;  1U02 A;  1QSL A;  3N28 A;  1HNI A;  3V4I B;  3I4H X;  4C11 A;  4NI2 A;  1GT8 A;  4I69 A;  1HWJ A;  4NZ0 A;  1FNX H;  1TKX B;  2AP6 A;  2VG7 A;  1LOU A;  4TYA A;  4USI A;  4YR0 A;  4G1P A;  1N8R T;  1QUV A;  3CW2 C;  4TN2 A;  4HAC A;  2OEJ A;  2BE7 D;  2EG2 A;  3LP0 A;  5A0Y B;  4KJG A;  3A1Y G;  5CD4 H;  2COL A;  4B9U A;  4LSL A;  1FFS B;  1DTT B;  2LYV A;  1O51 A;  1KS2 A;  5KT3 A;  1RKJ A;  5T7L B;  3GJS B;  4ZCI A;  4DBQ A;  5LMN J;  2W5V A;  3UCZ P;  4TQS A;  1RT4 A;  4J9M A;  2MGZ B;  3DOK A;  4L6V 3;  2G0I A;  4Y3C A;  4LF9 J;  3PZP A;  3C6U A;  5E5N A;  1NLK L;  1KEK A;  1RT6 A;  4DUY F;  1CPZ A;  2OPS B;  2W7A A;  4DEZ A;  2CQH A;  4I4B A;  5IQ6 A;  2DJW A;  3HVW A;  2QLX A;  2ZNZ A;  1S1T B;  1OPI A;  5KFL A;  3HCX A;  3BQ0 A;  2FJW A;  2OAU A;  3HHD A;  4NXN F;  2DHH A;  3ADA C;  3ITH A;  1BQN B;  3CJK A;  4UY8 5;  2C42 A;  2OPP A;  2HQG A;  4U7C A;  2IFY A;  2DXD A;  3UR0 A;  2R8I A;  1HDH A;  2A6O A;  1PJ5 A;  3D3B J;  3F73 A;  1FTC A;  2PN6 A;  4ITS A;  5KFN A;  3RRK A;  2CJQ A;  4F0K A;  1OSC A;  1I3O B;  4KV8 B;  3D67 A;  2UUB J;  1LKZ A;  4FPR A;  3OXF A;  3IGV A;  4RPF A;  2P9G A;  2GML A;  4CO4 A;  8ATC B;  2ZHA A;  4ELU A;  2DHG A;  1FXR A;  4ES3 A;  1HNX F;  3MK2 A;  2NYH A;  4P2M A;  1RZM A;  4N77 A;  1OJ4 A;  5KG6 A;  1FDA A;  4OZL A;  1U0S A;  2YNG A;  3DLG A;  4HYK A;  1G1X A;  4B9V A;  4GC7 A;  2VDI A;  1ZBT A;  1MRO A;  2A18 A;  2RH3 A;  4B3R F;  4RNM A;  1IUJ A;  2AEF A;  3UN3 A;  1ANI A;  2LP4 A;  4PPZ A;  3F41 A;  3FQK A;  4J9V A;  2BAB A;  2XC9 A;  3ZFV A;  2BJ8 A;  4M5K A;  1N4L A;  1WI6 A;  2MZT A;  2JDJ A;  2EKY A;  2W9B A;  1KH4 A;  4UOR A;  2QRR A;  3VAL A;  3Q3Q A;  3PEH A;  3TR5 A;  2VJU A;  2IJF A;  1PO6 A;  1IBL F;  1B7F A;  1HBO A;  3MUT P;  2E66 A;  4JOU A;  4LF1 A;  3LTO A;  2WK4 A;  2KL8 A;  4R5P A;  2XGP A;  4H4M A;  1S9E B;  3E2D A;  5LRM A;  4QWE A;  4CXU A;  9ATC B;  2YWE A;  3W9J A;  5KFW A;  2ACY A;  3EDQ B;  3V6D A;  3BEG B;  3W9H A;  2YQ0 A;  2HHH J;  1K1S A;  3MED B;  2V8H A;  2AYB A;  1H7X A;  1WG1 A;  3PEJ A;  5A8K B;  2C2D A;  4O44 B;  3MM9 A;  1MN9 A;  3WC2 A;  2OKQ A;  4NPO A;  3I9V 9;  4PKD B;  4OI2 A;  4CNZ A;  1X5S A;  2KFZ A;  4V19 J;  1CS4 B;  2PGC A;  3VF0 B;  2W4P A;  3RAX A;  2PI4 A;  3I5A A;  2MHE A;  1RHJ B;  1YRX A;  3OR1 B;  1RTD B;  3RR8 A;  4NYP A;  2QGF B;  3FGV A;  3JS9 A;  2BOA A;  3LF0 A;  2IBK A;  4B3S F;  5CZX A;  3UDL A;  3H5Y A;  2XEX A;  1F60 B;  3FKB A;  5AJ9 A;  2U2F A;  3HI9 A;  2KJW A;  5D8H B;  4ZDN A;  2HQI A;  2HSE B;  4DCO B;  4DV5 F;  5E3P A;  3THT A;  2XI2 A;  4ENO A;  2E5L J;  4B3T F;  1UKU A;  2J7U A;  4ZVS B;  3CTR A;  5AT1 B;  4D3G A;  1UVJ A;  3DLK A;  1IWA A;  2YH0 A;  1SQG A;  2CPD A;  3H2L A;  3US5 A;  2VPW B;  4ED7 A;  1PAE X;  2BX6 A;  2L9D A;  4RWW A;  1JLQ B;  2BM0 A;  1H0H B;  1RT5 B;  3PFO A;  2VG7 B;  4USM A;  2RQC A;  3V6J A;  1Q78 A;  1NK8 A;  3H4D A;  1IBM F;  3NNH A;  3F56 A;  1F9F A;  4DR6 F;  2MLX A;  3OPK A;  1SC1 B;  4KAI A;  4R0E A;  3SFU A;  5BYQ A;  3HZG A;  2OPR A;  1N0U A;  1GK8 A;  1NSA A;  3MHY A;  4FBT A;  1KQG B;  1CC7 A;  1IKW A;  1N2L A;  2LEC A;  3HVA A;  3MMJ A;  1X9M A;  3H2V E;  4KB7 A;  4B9S A;  4H4O A;  4DX7 A;  4IH7 A;  3M9N B;  4DL6 A;  2QLW A;  3CUL A;  4CQ1 A;  3TW0 A;  3DHW C;  2D9P A;  3MPV A;  5BR8 J;  4X4R A;  2ZH7 A;  5HLF A;  5LRN A;  3AY0 A;  1YZ7 A;  1RHR B;  5B0C A;  2GMH A;  3BR9 A;  1RAD B;  2ZE2 A;  2U1A A;  4RNF A;  3BQ1 A;  1FVS A;  3R2D J;  4CM2 A;  4Y2M A;  2E1P A;  1RXO B;  4WKY A;  3UPF A;  3KHL A;  1WC4 A;  2ZD1 B;  3D1H A;  4JUZ A;  2XUL A;  1VDH A;  1T3O A;  3MMB A;  1U0H B;  3AQP A;  2WB1 D;  3OUY B;  4DV6 J;  3M32 B;  3UVJ B;  3RTV A;  4UZB A;  3CCZ A;  4QU6 A;  4C9D A;  4NLG A;  5F9L A;  1H3D A;  4R25 A;  3BN7 A;  4HVZ A;  4GRS A;  4I1T A;  2FVS A;  4O3Q A;  4X66 F;  3KXD A;  2RH6 A;  1VQ5 S;  1IBC B;  2GO8 A;  3RRH A;  4U67 Q;  3KUH A;  1FSU A;  4M5L A;  2JLF A;  2BJ1 A;  1SQE A;  4O4R A;  1ZM9 A;  3PIO Q;  3V6D B;  5CYJ A;  4DR7 F;  3DDI A;  1RWK B;  5KFG A;  4F4A A;  4DV2 F;  1VQN S;  1SBR A;  2CQP A;  3CMQ A;  5GMD A;  3BF4 A;  3CCW A;  2SXL A;  1ANJ A;  3MTK A;  2ACM A;  4YEA A;  4KO0 A;  2XO7 A;  2BM1 A;  3FK4 A;  4R5P B;  3T1Y J;  4W90 B;  1WEL A;  2CPH A;  3NGK A;  3LP0 B;  3R6L B;  1T9Y A;  4MFB A;  2J7K A;  3LP2 B;  4OI4 A;  3G87 A;  3QMQ A;  1XBW A;  1ZAX A;  3BB5 A;  3P49 B;  4DHV A;  3IFE A;  3TNV A;  4CP5 A;  3MFH A;  2QSF A;  2AX1 A;  2MTL A;  4OFZ A;  4CLY A;  2R8H A;  2QZ8 A;  2QT7 A;  1HQ2 A;  1RU1 A;  3HXM A;  4ZG7 A;  1YWX A;  2C2N A;  4O23 A;  2F3J A;  1FX4 A;  4LBI A;  4KC5 A;  1FTR A;  1A7G E;  4FZV A;  1XMQ J;  1Q86 T;  4ED3 A;  3ZTR A;  2QE5 A;  3D1O A;  4CH7 A;  4O0I A;  3NNA A;  1TL3 A;  2XMM A;  1WC3 A;  5AE1 A;  2FQQ B;  3GIJ A;  1TQL A;  4DX6 A;  3GU0 A;  3QGI A;  5HVF A;  4BLG A;  3BKT A;  4URS A;  2AQ4 A;  3JAM Y;  4TVA B;  3DCA A;  1ELX A;  2RQK A;  1S12 A;  2ZIT A;  4NEY A;  2D41 A;  1VQ8 S;  5GAH I;  2C3U A;  1IR1 A;  1JLA A;  3M2R B;  1HNV B;  1KHW A;  1RAB B;  2GO9 A;  2XY6 A;  4IR1 A;  2YVS A;  1S0O A;  3C2P A;  1PC5 A;  1N0V C;  1FDD A;  2F8E X;  2V2K A;  3DLK B;  2MQN A;  3KUE A;  4ZPV R;  1NDL A;  3GYX B;  5M2U A;  2ANH A;  1RCO B;  2RHQ B;  4Y2C A;  5F8J A;  5DET A;  4F4W A;  3K89 A;  2UZA A;  1EQ0 A;  4OZ5 A;  3UN2 A;  1FKP B;  4DR6 J;  1N52 B;  2WOM B;  4FYW B;  2WSE C;  4P2F A;  5J1N A;  4YDX A;  1CJK B;  1FRX A;  3MFI A;  1S1W A;  2HZC A;  3FEX B;  2DNQ A;  1OIA A;  2GQQ A;  5FDL B;  3SDE B;  1S9F A;  3T00 A;  1TKT A;  5HLF B;  1WF1 A;  2QLB B;  1RAE B;  1RT1 B;  2V2Q A;  1HBU A;  2GGP A;  2J0W A;  1V9O A;  3C8Y A;  3T5L A;  4C8Y A;  4K59 A;  4GTW A;  2ZZT A;  2CUY A;  5CYQ A;  2ZUG A;  2X1F A;  1HD0 A;  3KNA A;  3M8S A;  3ZTS A;  1ZYQ A;  3GCX P;  1FWL A;  4Z37 A;  4G3I A;  1WG4 A;  1QM9 A;  4DG1 B;  3FCW A;  4FYD A;  1T9X A;  4QCL A;  2I0X A;  2QJ3 A;  2QMU B;  2VF3 A;  2WON B;  1SL1 A;  3E3X A;  1WG5 A;  4NLT A;  1KQS R;  1R0A B;  2RRA A;  2W8S A;  3VQS A;  5M2R A;  1YJT A;  2RRB A;  2CPX A;  2J9D A;  4RW7 A;  1BUX A;  2RKI A;  4ZVR B;  3TUJ C;  2FVP A;  3DU5 A;  1X4G A;  4ZN1 A;  4ED0 A;  1W25 A;  3D7S B;  2ILY A;  3U1L A;  4AXI A;  4NZ6 A;  2V68 A;  3PJW A;  1S72 S;  1HR0 J;  2J6S A;  3DRX A;  1HWL A;  1N5V A;  3F44 A;  1CJV B;  1UCN A;  5L38 A;  1BWV A;  5B0A A;  4BS2 A;  1YJ7 A;  2QTW A;  3LH2 S;  4N76 A;  2EC2 A;  3ZNU A;  4WYW A;  1WHV A;  5FII A;  5KT2 A;  3IAM 9;  1YJN S;  5C42 B;  1MN7 A;  3PW5 A;  5J2N B;  2F8M A;  1S1X B;  2DO0 A;  3KLF B;  1D1U A;  3FRY A;  3OHA A;  2RD5 C;  1N32 J;  1CSJ A;  2XMU A;  2RDD A;  4CIO A;  2KG1 A;  2C22 A;  2BV3 A;  1GXT A;  1PG5 B;  1C2P A;  2ZOG A;  2JVR A;  2NSB A;  4ECX A;  1LV5 A;  2XS5 A;  4WZM A;  4B17 A;  2CG8 A;  3SCK E;  4CLZ A;  2YXL A;  4EEY A;  2CJY B;  4OI0 A;  2BKP A;  2I5J B;  3NAI A;  5IC6 B;  4QYZ J;  3BZQ A;  2UUB F;  4CNY A;  3CCQ S;  4JI6 J;  5E3Q A;  1SC3 B;  3PX0 A;  2V0N A;  1UZH A;  2YKP A;  3P3D A;  3BDH A;  3DN9 A;  2N3O A;  4DR3 J;  4D3H A;  2QL5 B;  2GJF A;  3KLI B;  4QOT A;  3SFG A;  2NXE A;  5C24 B;  1M5V C;  3K5O A;  4MIA A;  5HBM A;  2W9B B;  2ZHB A;  1YG0 A;  2K1R B;  3HKW A;  4ZKA A;  4F36 A;  2MGZ A;  2ZBC A;  4ZVG A;  2DR5 A;  2R2R A;  2ZE2 B;  2UUA F;  2PEH A;  1LNQ A;  2GQC A;  1J5O A;  5DG8 A;  4K4Z A;  3C16 B;  3N6L A;  3U27 A;  4JB8 B;  4YFU A;  3BSN A;  1WEY A;  3GR0 A;  4C48 A;  4B9M A;  3I0S A;  4MTP A;  4A8F A;  5A8K A;  4DDF A;  2AX0 A;  2LA4 A;  3QRR A;  3ET6 B;  4HT5 A;  1M5S A;  2HFN A;  3P5B P;  2CQ3 A;  3E8O A;  3WC0 A;  2DBB A;  3KLG B;  3NWG A;  3IRX B;  1NCL A;  1REV A;  3M8W A;  3N9U C;  3PVX A;  3E01 A;  2IAJ A;  2YBV A;  3M30 A;  4ZMM A;  5E41 A;  4IDK B;  3RBD A;  1EQJ A;  4I64 A;  4YHH J;  3ED4 A;  1QD1 A;  2EWH A;  3M2U A;  4WFY A;  2IPO B;  3G82 B;  4RUH A;  1VC6 A;  2I9S A;  1XMQ F;  1VK8 A;  1ZM3 A;  1UWA A;  4JI7 F;  3IGY B;  1S6Q B;  5LSL A;  3C6T A;  2M2B A;  1WOS A;  1RSC A;  2OPS A;  1WI8 A;  3MUV P;  2DNR A;  4OYI A;  3X1L B;  2PMH A;  2OHD A;  3KDN A;  2CVI A;  3TWZ A;  3RB3 A;  1OYD A;  2GCF A;  3W1Y C;  4DWI A;  2GA3 A;  1AA1 B;  1Y6V A;  2RDI A;  2XYP B;  2WZ1 A;  2ZC4 A;  5KFF A;  2KHD A;  4ZVT B;  4DV5 J;  1URN A;  3IWN C;  2OPP B;  5KFC A;  3CNQ P;  3X3U A;  4ZOS A;  2C2R A;  2HUR A;  1U24 A;  3JSR A;  3LQV A;  4HI1 A;  2JL9 A;  2LXI A;  3IMQ J;  4KGZ B;  1N5Y B;  1D3W A;  2WVB A;  2MXY A;  3CJR A;  3PAC A;  2J6U A;  4HR2 A;  4BCA A;  1SV5 A;  3LAN A;  3CT9 A;  3CXC R;  1FRH A;  3OTC A;  3T9Z A;  2DR7 A;  2CQI A;  2VUG A;  4B3M F;  3ZZO A;  3AXK A;  3LGN A;  2ZM6 J;  1AB8 A;  3R3T A;  4WFZ A;  4X4U A;  3GG0 A;  1FRK A;  2DGQ A;  2VFS A;  3HMJ G;  2KXN B;  3PG9 A;  3ZC4 A;  2X51 A;  4I67 A;  3KLF A;  2IM2 A;  1FD2 A;  5ETV A;  3OVS A;  1NK0 A;  5KG3 A;  1VJQ A;  5THW A;  4CXK A;  2XS7 A;  3O2I A;  4HI2 A;  1IJF B;  2DRB A;  3ZTQ A;  5TJ3 A;  4AT1 B;  3PX6 A;  3D6T B;  1VQK S;  3MCM A;  4PG8 A;  1HWU A;  2FHO B;  1NSP A;  2IRU A;  4OV1 A;  3OTO F;  4YUD A;  4AND A;  5DDQ C;  4TKT A;  2H1Y A;  4ECQ A;  4K2J A;  3G6E S;  1URB A;  4DV6 F;  2OO4 A;  3TZY A;  2QIF A;  1TK8 A;  2EBG A;  3MK0 A;  1SUQ A;  1ELO A;  5KFY A;  3KLI A;  5C24 A;  3OFF A;  3RGI A;  3TI0 A;  1RE1 B;  3G96 A;  3THV A;  2Y0S D;  2LLZ A;  2RRN A;  3NS6 A;  2GFF A;  3H4B A;  4HTJ A;  4C8N A;  2V6A A;  1QY7 A;  5F8N A;  4X4V A;  3TG0 A;  3TEH B;  3WHI A;  2DXF A;  2WBM A;  3TUI C;  2R7V A;  4A8K A;  1RT6 B;  5LMN F;  1WTF A;  4KT0 C;  1J5O B;  2V94 A;  2CNL B;  3CD7 A;  3GWC A;  3MAH A;  3S6E A;  4CXS A;  4JI3 F;  3J7Y U;  4ES1 A;  4FS2 A;  2GMJ A;  2HPU A;  4KH0 B;  3WAY A;  4G1Q B;  2HQ3 A;  5HBM B;  5IZH A;  1DBD A;  3JYT A;  1S0V A;  2CNK B;  1ZAV A;  3C15 B;  1EI6 A;  1VQ7 S;  3HHL D;  3PR4 A;  2R7R A;  5A8W A;  1VIX A;  3KJF B;  3LP1 A;  4F2R A;  4LF8 J;  1FWK A;  3AA8 A;  3AOD A;  3R5B A;  8AT1 B;  5DLG A;  4ECW A;  3FZB A;  2JFD A;  2X1B A;  3MR7 A;  4F26 A;  2XWX A;  5KAK A;  1NKB A;  1TL1 B;  4PAA A;  3A8E A;  3C3L A;  1P8G A;  3P4U B;  3OT9 A;  5LXR A;  1UVM A;  4ED4 A;  1EET A;  1U09 A;  1IXK A;  1BLU A;  1B0V A;  1OQ3 A;  1YTY A;  3TX8 A;  4A46 A;  4DV1 F;  2DGW A;  3CMA S;  1E1Z P;  3EYZ A;  4DCP B;  1VQY A;  3QZ8 A;  2IUC B;  1GMV A;  4Y2I A;  1NPR A;  4KRW A;  3VWS A;  3HLU A;  2V5H G;  3TA2 A;  2CWX A;  4ZCK A;  1NME B;  4ZVU B;  3CVK A;  4NMX A;  1D8Y A;  1C1B B;  1C1C A;  3M2V A;  2EPI A;  1QTM A;  4OHY A;  3MMA B;  3Q24 A;  2K3K A;  1J27 A;  2EFQ A;  5LJ5 Y;  1VBX A;  1R27 B;  4ZPW R;  4ALZ A;  5F8G A;  2XY5 A;  1JLE A;  1O99 A;  2X3G A;  5HK4 A;  1EZZ B;  2IDL A;  3GV8 B;  2NQP A;  5D4N A;  2AGP A;  3AAW B;  2K7K A;  3FBB A;  2XS2 A;  4NYO A;  4Q5V A;  3LP2 A;  4CLU A;  4DQQ A;  3CCS S;  3MR3 A;  4BC7 A;  2CJB A;  3G6V A;  1S6P A;  2PI5 A;  4KGM A;  2CA9 A;  3FCV A;  1URR A;  4C98 A;  4TN0 A;  5U47 A;  4O3N A;  5K8N A;  2IC3 A;  4A8Q A;  4LFB F;  3DNC A;  1U45 A;  4YB6 A;  4QIF A;  5DDR C;  2MJU A;  3JAM U;  1D9D A;  1WC1 A;  4Q7A A;  5KOX A;  3O8W A;  2V4Q A;  1XEZ A;  4XDD A;  2YWF A;  3KLH B;  1U4B A;  2DH8 A;  5ADZ A;  1U2R A;  1WKL A;  4J9K A;  5HO4 A;  3DGP B;  2B56 A;  1HW8 A;  2BZ2 A;  2K8G A;  2O01 C;  2YTC A;  4RKU C;  4U7U K;  4DFJ A;  3MD3 A;  2XB2 D;  5J2M B;  4Y2A A;  2F1F A;  5I42 A;  1OSD A;  1Q4R A;  3SSS A;  4ZVF A;  4DFK A;  4OZN A;  2JEF A;  2YWG A;  2OLW A;  4IOA Q;  2AW0 A;  4AL7 A;  4DF8 A;  3GR1 A;  4I56 A;  2QO3 A;  4YB5 A;  4IRC A;  1FXL A;  4DV7 J;  3TVZ A;  3PR5 B;  1NK6 A;  4P2X A;  1KON A;  2DHX A;  4C97 A;  1XQI A;  4X65 J;  2ZJQ Q;  1T03 B;  2UUT A;  3I6P A;  2MZS A;  3DM2 B;  4W4M A;  5KG1 A;  2RDJ A;  4N41 A;  3DLH A;  2CDQ A;  3FBC A;  1IQT A;  2OMO A;  1ELY A;  2B8P A;  3MAA B;  1UZD A;  3CJQ A;  4ZS6 A;  3VHQ A;  2AV5 A;  1JIH A;  1JLA B;  3C14 A;  3M2R A;  3QAE A;  5EX3 A;  1S9G B;  5L9X A;  1UFL A;  4M94 A;  1HBM B;  1RB0 A;  5EGY A;  1HNI B;  4RW9 B;  5HRO B;  3VAM A;  3NL0 A;  1DFD A;  1K1Q A;  1N36 J;  4DMZ A;  4LQ3 A;  4UY8 T;  3H98 A;  4GKK F;  1TTH B;  2HNZ A;  2RIL A;  4AXJ A;  1SVD A;  3QQC D;  4TU7 A;  2FJD B;  2XZD B;  2MZJ A;  3NGR A;  3QRP A;  2IJN A;  4DN0 A;  3LP1 B;  4KO0 B;  5KFK A;  3HFK A;  3PW7 A;  3ZXW A;  1WHW A;  3AD7 C;  4PZV A;  3PHT A;  2BJE A;  1SKR A;  2LVW A;  4DXL A;  1NDK A;  3OTB A;  3MMA A;  5HMY A;  1WHX A;  5A8R B;  2HS0 A;  1SKU B;  1HMV B;  2V2Z A;  3EGN A;  3PFE A;  4DS5 A;  4KGK A;  4DS4 A;  4LR2 A;  1SHQ A;  1PJ7 A;  5GAH U;  3G4S S;  1HI8 A;  1T05 A;  3MAA A;  2F8H A;  1U2F A;  2CNN B;  1VCT A;  3CJ8 A;  4OZ0 A;  1WEX A;  2BR0 A;  2VPZ B;  1XMB A;  5HAT A;  3QZ7 A;  1VRU A;  4LFA F;  4WFN Q;  3Q8R B;  1RT3 A;  2BBE A;  3RAQ A;  3FJ2 A;  5B0E A;  1N33 J;  1JWW A;  4LF9 F;  1AZS A;  1FO1 A;  3M8P B;  4GVB B;  3CB4 A;  2IC3 B;  1S1U A;  5EX0 A;  1JLE B;  3TQE A;  2DXE A;  2R2T A;  2AZ1 A;  4FYY B;  1UPP A;  1RTZ A;  2M52 A;  1E6Y A;  4QWB A;  3THP A;  1DQ8 A;  2FJV A;  1EQM A;  2QG9 B;  2JX2 A;  1R8C A;  4LSL B;  4WFX A;  2O66 A;  1VI7 A;  5CCL A;  1R6Y A;  1ED9 A;  5CYM A;  1TL7 A;  2L9W A;  3DI6 A;  1TAQ A;  4CM0 A;  3G82 A;  3D0G E;  3MEC B;  2M88 A;  1RAO A;  1ROF A;  3MED A;  4IFY A;  3VGU A;  2YKM A;  2ASD A;  1H98 A;  1TEL A;  2PE8 A;  2JOQ A;  1RAC B;  4H4K A;  4ZJQ A;  5FLX U;  2ATL A;  3ZZT A;  3KJV A;  4CLF A;  1EKS A;  2XYG B;  4L76 A;  4U7U D;  4YP3 A;  2YNF B;  2XWY A;  3DOM A;  1KHJ A;  1U47 A;  1K73 T;  2HWH A;  2VPY B;  3V6H A;  3U1M A;  1FE4 A;  3HSD A;  4A8X A;  4DR3 F;  5H9E K;  1CS4 A;  1IJE B;  4LRD A;  1TKZ A;  3B4D A;  4O0N A;  2CQD A;  3D0H E;  3HJV A;  3C14 B;  1L3V A;  3E2E A;  3RJM B;  1XJW B;  3AOB A;  2GJI A;  4B9N A;  2FPH X;  3H90 A;  3VAH A;  3SYZ A;  3GCW P;  2XSJ A;  1NJI T;  2JVO A;  3PW2 A;  3W7B A;  1HD1 A;  3CJK B;  2XNR A;  2XO6 A;  5LXY A;  4DUT A;  5KT4 A;  1R31 A;  1NND A;  2IUC A;  3PIP Q;  1WWH A;  1S5Z A;  5K14 A;  1GAO A;  4XAK A;  1KKH A;  1U1K A;  2AWZ A;  1HWI A;  4LF7 J;  3K8W A;  3GZ7 A;  5ETL A;  3SIP B;  2DR9 A;  4PQA A;  1VBY A;  5AXM A;  3PV8 A;  1MWY A;  1E6V A;  2GAG C;  2XMJ A;  6FDR A;  4JI0 F;  4Y0F A;  1HFE L;  5T41 A;  4X4S A;  4MK8 A;  5C66 A;  1BQN A;  3A4T A;  2LEB A;  4JI3 J;  3DPC A;  5LIA A;  1RHM B;  2M3D A;  3M1V B;  3Q2S C;  3QT6 A;  5ETS A;  2W01 A;  4YHH F;  3MM6 A;  3RUB L;  3MPD A;  4UOO A;  3TAR A;  2NXC A;  1TKZ B;  2DTJ A;  2WAQ D;  3Q8Y A;  3QBC A;  4JI8 F;  1S1X A;  5KG2 A;  3I0R A;  5GAG U;  4ZVQ B;  1NK4 A;  2VD3 A;  4H4O B;  3CGI A;  2HVE A;  2K7J A;  3SSR A;  3SV4 A;  1TFW A;  3J7A 1;  5GME A;  5C25 B;  1FRJ A;  3GJR B;  2GHV C;  3MMC B;  4N56 A;  2PA8 D;  4OYW A;  3H40 A;  1QSY A;  2IYG A;  4NA1 A;  3QJL A;  2D1G A;  4JV5 J;  5DZ7 A;  4WFB Q;  2W9C A;  3PJ9 A;  2ZDP A;  4OYZ A;  4YY3 J;  4NLU A;  3EDR B;  2DRD A;  2FC9 A;  3FCH A;  2ALY B;  1T9U A;  4LFC J;  5KFQ A;  2G0J A;  1FNO A;  2FB0 A;  2F63 A;  3D0I E;  3QWU A;  5CYM B;  2ASJ A;  3ZNJ 1;  2W25 A;  4JI8 J;  4PQU A;  5LMU J;  2ZH5 A;  2L08 A;  4AL5 A;  3UN5 A;  1GH8 A;  1WF0 A;  5DO2 A;  2BW2 A;  2FZC B;  2BRL A;  4RW4 B;  3OD2 A;  5I3P A;  1CJT B;  3KG0 A;  2AMC B;  3EPI A;  4X64 J;  1M5O C;  2QA2 A;  2IFX A;  2OTJ S;  2EI5 A;  2QEX S;  1Q0N A;  1HNZ J;  3SCI E;  4BDP A;  1KOH A;  3WIV A;  4DUZ F;  1R8H A;  1FDB A;  1S7H A;  2E7X A;  2XLK A;  3QLH B;  2VQF F;  3H2U B;  2LCW A;  2IJR A;  3I96 A;  3DDN A;  3H59 A;  3ZZY A;  4B02 A;  4CLK A;  4F3Q A;  4LIW A;  1JKH B;  1ZM4 A;  1UMJ A;  5F41 A;  4I2P A;  4WII A;  1ZOT A;  5H1S V;  2GVZ B;  4QPX A;  4YOE A;  3BQ2 A;  1RQ0 A;  2RVJ A;  2EEY A;  2YKN B;  3DRR A;  5D0G A;  1RAI B;  4NI2 B;  4N8N A;  1AUK A;  1A6L A;  4AQY F;  2JEG A;  2HW3 A;  5JJB A;  2KRR A;  2Y0B B;  3CCV S;  3NMR A;  1RWX B;  5GAE U;  3B5Q A;  2FY8 A;  2CPZ A;  1T11 A;  1Y5N B;  2I1R A;  3OHB A;  4JI1 F;  2W5S A;  2M9K A;  3KDO A;  2H9Z A;  2CNO B;  3HVR A;  5HSP A;  1O98 A;  3BBF A;  2QL7 B;  1FRI A;  1TMJ A;  1I6J A;  2VC1 A;  3LAK A;  1LEO A;  4MKA A;  2K3I A;  2HVD A;  4C11 B;  1V3S A;  3V81 A;  2AJQ A;  3EMT A;  4EWT A;  3BJY A;  4F4Z A;  4UOP A;  2M4M A;  3PXG a;  5G0R A;  3UI3 A;  2E1A A;  1D8Z A;  4LVO P;  4FF4 A;  2LU2 A;  1WC0 A;  4ID5 B;  1RWM B;  4WZQ A;  3FQL A;  1VQM S;  1S6Q A;  4NLO A;  4ANE A;  4K4X A;  4KJD A;  1RHK B;  4ER8 A;  3BGU A;  3M05 A;  5IJS A;  3ENA A;  1Y10 A;  4PRF A;  4BWJ A;  1MMN A;  1HI1 A;  4K7Q A;  2PT0 A;  2OFG X;  2HHP A;  3NWR A;  1Z1Z A;  3KK2 A;  2W8K A;  3VZH A;  1H7W A;  4OI3 A;  3S7R A;  3T5J A;  2BAN A;  3AFG A;  1KLN A;  4EO8 A;  1LW2 B;  5C25 A;  1G7C B;  1O5J A;  2LKZ A;  3TA1 A;  1N5T A;  3BR8 A;  4RBT A;  1QUP A;  3GE9 A;  4HH0 A;  2UV8 A;  4FP9 A;  3R9L A;  4USH A;  1YIJ S;  4DV1 J;  2FLN A;  1M1G A;  4LR8 A;  2J9E A;  4O4G A;  3UDE A;  4K8R A;  3VCD A;  3OVA A;  4IG3 A;  2HYI B;  1TR0 A;  2HK2 A;  4WFA Q;  4GTX A;  1RLC L;  1WJ9 A;  2ZHO A;  1TKT B;  5IWA F;  2MQL A;  3LGH A;  3DHX A;  1RDR A;  2C1E B;  4MMO A;  4UW2 A;  3QFH A;  1N6Q B;  5D4O A;  4LF5 F;  4DU7 A;  2WOM A;  1MU2 B;  1S7I A;  5KT5 A;  1WC5 A;  2BMB A;  3I0R B;  1YJU A;  4C8K A;  3KLV A;  1FK9 A;  1RAG B;  2XCA A;  3I5B A;  4DR2 F;  3UCG A;  4KPY A;  4JI7 J;  1TL3 B;  3NGS A;  3K7R A;  1S6P B;  3HK2 A;  3MUM P;  5KFX A;  3RU0 A;  3G71 S;  5CCM A;  1TFY A;  1F3V A;  1YBU A;  4FVM A;  2OEM A;  2W4C A;  3AQO A;  1EHW A;  2E5I A;  2VBZ A;  3EXC X;  2W7P A;  3WX8 A;  1SH2 A;  2UUW A;  2QMX A;  4RW4 A;  4JV0 A;  2G9O A;  3OLB A;  4DV0 F;  1N34 J;  2G1H A;  3SQG B;  1N36 F;  3NP5 A;  2JJ4 D;  2DH7 A;  2G2Y A;  4LQ9 A;  4WP3 A;  1VBZ A;  2RU9 A;  4LFB J;  1EAR A;  2IVY A;  2O5D A;  4F02 A;  3RB0 A;  5IT4 A;  4LSZ B;  2RHS B;  3T9N A;  3TJ9 A;  1UL3 A;  1VQL S;  1UJ5 A;  3FFI B;  3GJT B;  1FXD A;  2P5V A;  1T05 B;  3JTO A;  2HLU A;  4EBE A;  1RWO B;  2NXU A;  1GEH A;  4F50 A;  1R6V A;  4P7V A;  2R8K A;  2XSF A;  2VOD A;  1B8J A;  1UP1 A;  2AZ3 A;  3QYY A;  1O0P A;  1TV6 B;  1UVK A;  4GO5 X;  2C2E A;  3JXO A;  3MOZ A;  3KK3 B;  4P9S A;  5D77 A;  3H5U A;  3Q0A A;  1RWP B;  1AUD A;  3CCJ S;  3V81 B;  2HZV A;  2QZU A;  1BXN A;  2W2P P;  2YX7 A;  2PMZ D;  1W7W A;  1TVR B;  2DNO A;  2F40 A;  3QSI A;  4ICL B;  5J2M A;  2FZG B;  2ZEJ A;  2IM3 A;  1G4C A;  3FEY B;  4YB7 A;  1QAX A;  1SJR A;  4QYR A;  5I3U A;  2ZJP Q;  4QIV A;  4TU8 A;  1VLY A;  4V19 X;  2Z2Z A;  1E6Y B;  2D3Z A;  4QR1 A;  1QAJ A;  2CQ2 A;  1SC6 A;  2LQ8 A;  1S1W B;  1SIW B;  4F7V A;  4M1K A;  2UUC F;  1NUE A;  1K44 A;  1FDN A;  2CXE A;  2IA6 A;  1EET B;  4URG A;  1ALJ A;  4DR1 J;  3JSB A;  1V5V A;  3ITH B;  1NJY A;  2AJ4 A;  3HP6 A;  1YLX A;  1PSD A;  3Q8V A;  4FKX A;  4CT8 A;  2H65 B;  2R2U A;  2XTJ P;  4NLR A;  2MJN A;  4AFF A;  3DOL B;  2VQE F;  5AXN A;  1RLD A;  4L75 A;  4EFA C;  5IV3 A;  1U6B A;  1ZA2 B;  3GFX A;  5KFE A;  4HH1 A;  1HBN B;  2J5A A;  2JFK A;  3D3C J;  5BR8 F;  1PIE A;  3K58 A;  3DLJ A;  5KFP A;  2ZNY A;  1HJK A;  1IKX B;  5FJ4 A;  3OL6 A;  5A8R A;  2ZH1 A;  4QWA A;  2IM1 A;  3T1H J;  2GW8 A;  3WAV A;  1RBO B;  3BGF A;  1HIY A;  1FWP A;  4N47 A;  1FJG J;  2B6A B;  4M5N A;  4USW A;  3H25 A;  2ADC A;  1JLC B;  3POT A;  4O3R A;  1SC4 B;  1S9G A;  3QT7 A;  1XTZ A;  4FS1 A;  2GSU A;  8RUC A;  2MQO A;  5DZ6 A;  2F65 A;  3JQJ A;  4WTY A;  1VOM A;  1U0H A;  1VS3 A;  2H5E A;  1F5C A;  4NWX A;  4MIW A;  2VOP A;  2OI2 A;  5D4P A;  1HA1 A;  1JB0 C;  1R8A A;  2KT3 A;  3N79 A;  3IRW P;  3KG4 A;  2F5G A;  2RKI B;  2WRM A;  3MUR P;  4ETZ A;  1S79 A;  5D4L A;  2VFR A;  4I6W A;  2AIR B;  3MPW A;  4MYU A;  4CO0 A;  4B08 A;  3JSM B;  2R7U A;  2L48 A;  1AJC A;  4TLQ A;  5MLC V;  5FD1 A;  4OYA A;  1ZED A;  3IBW A;  2XMW A;  2BYC A;  3T1A A;  4GO7 X;  4XIU A;  5E7O B;  1ZEB A;  1NK5 A;  1RBA A;  1Q81 T;  4ZN3 A;  1QSS A;  2DO4 A;  2DY1 A;  3RRG A;  1YBA A;  4QR2 A;  2W4D A;  4MYT A;  2C2K B;  3UD5 A;  3VGS A;  4DPT A;  2FHJ A;  3TJA A;  7AT1 B;  1MU2 A;  4MH8 A;  2IDE A;  4LF6 J;  4A8W A;  2MKH A;  3RG6 A;  1JJ2 R;  3V4M A;  2CRL A;  5KOW A;  2FVR A;  3GFZ A;  1ZZN A;  4M5D B;  2MQM A;  3VZI A;  1EP4 B;  5HN0 A;  4X4P A;  1IM4 A;  4UOF A;  5DG7 A;  4Q8F A;  3FFI A;  3GV5 B;  2W9A A;  3JB9 k;  1F0X A;  1EJJ A;  2OPQ B;  4MK7 A;  5A6P A;  1M90 T;  3DRS B;  3A13 A;  1X5P A;  2HHS A;  2FY1 A;  1X4E A;  1T3N A;  1M5H A;  3B82 A;  3CIZ A;  5LM7 E;  5I3U B;  2FIU A;  5KFV A;  2I2Y A;  2KU7 A;  1TK5 A;  5DLW A;  1VLO A;  2RIJ A;  1S99 A;  3UDC A;  5F3T A;  4IO1 A;  3NEK A;  4CYS A;  4C3L A;  4TXS A;  1NK7 A;  3M8R A;  4TY8 A;  3Q86 A;  4QJV A;  3BSO A;  1H6K X;  2AGQ A;  4JBC A;  5AJ3 F;  5F0W A;  4UPL A;  4DJB A;  3BDG A;  4FKY A;  2P9E A;  3HVT A;  4YR3 A;  3AT1 B;  3OFG A;  3CWJ A;  4ZJO A;  5AE2 A;  3OW2 R;  2RUS A;  3J7Z 5;  3VVT A;  2UXB J;  3NKO A;  3OTO J;  4IDK A;  4ZVO B;  4IH6 A;  3NOG A;  1KH9 A;  3VAK A;  1M5P C;  3L9Z A;  2F4V J;  2EFO A;  2ROP A;  2HVZ A;  5D0R A;  2KH9 A;  2FVC A;  3EZO A;  4J91 A;  1SCJ B;  1KOO A;  1NEE A;  5DRK A;  1FVQ A;  5ETK A;  3TZX A;  5J1P A;  1UJ4 A;  4TQR A;  2VHG A;  1FES A;  1JXV A;  2E7V A;  1KHV A;  3DLE B;  3IM8 A;  4ECR A;  4ZP7 A;  4X62 F;  2GNK A;  3PW0 A;  3QID A;  2OP5 A;  3D68 A;  4XTT A;  5ETT A;  3MEG B;  1AFI A;  4E0D A;  1RGV A;  2DD8 S;  2MKK A;  2LXF A;  5IV4 A;  4MIV A;  3MM8 B;  4KGV B;  2B9W A;  1T7P A;  4N7T A;  1CQM A;  3MM9 B;  1NJW A;  3QSY B;  2G1D A;  2BJ3 A;  4FDF A;  4ZJL A;  4DL5 A;  3BYP A;  2OEL A;  4NL5 A;  3EM1 A;  3CJ3 A;  4OJ3 A;  2DGV A;  4XPE A;  3R1H A;  4JV5 F;  3I31 A;  3WBH A;  2IMO A;  2QMW A;  2VPX B;  1HI0 P;  4IO9 Q;  2RUG A;  2DYA A;  2V63 A;  2B3T B;  1KTQ A;  1CQN A;  1NAQ A;  1RT3 B;  3DXB A;  4PXB A;  2FHM A;  3JYT B;  5G0R B; 
#chains in the Genus database with same CATH homology
 3TX0 A;  4LR2 A;  1E3C P;  1SHQ A;  3TG0 A;  1ALH A;  3NVL A;  3SZY A;  5IJQ A;  4UPI A;  3T02 A;  4FDJ A;  3WAX A;  4CXS A;  1HJK A;  3A52 A;  3WAY A;  1AUK A;  5DLV A;  4KAY A;  2X98 A;  4LR9 A;  2W5V A;  3WAV A;  1EI6 A;  2W5R A;  4LRC A;  3LXQ A;  3NKN A;  3B5Q A;  3SZZ A;  2W5S A;  2W5Q A;  5INH A;  1N2K A;  1P49 A;  5K4P A;  1O98 A;  2GSU A;  4YR1 A;  3NKP A;  1FSU A;  3OT9 A;  3BDH A;  1ED9 A;  1ALK A;  4UOP A;  4NWX A;  5LRN A;  1AJA A;  1URA A;  4KM4 A;  1E1Z P;  2GLQ A;  1ANJ A;  2IFY A;  2IUC B;  2XR9 A;  1SHN A;  1HDH A;  2RH6 A;  4KJD A;  5IJS A;  1ED8 A;  1KHN A;  1ZED A;  1AJC A;  3UNY A;  1KHJ A;  1ZEB A;  4B56 A;  3M7V A;  1EW8 A;  1E2S P;  3MK2 A;  4MHX A;  1O99 A;  1E33 P;  3KD8 A;  4LRE A;  1ELZ A;  4ZG7 A;  1KH7 A;  4LRD A;  4LR8 A;  3M8W A;  2G9Y A;  3M8Y A;  5HRT A;  3UN3 A;  1ANI A;  4GTX A;  1AJD A;  1EQJ A;  2W5W A;  1KH5 A;  3MK1 A;  3ED4 A;  4TN0 A;  1KH4 A;  2W5T A;  1EJJ A;  3UO0 A;  4UOR A;  3IDD A;  1ELX A;  3Q3Q A;  3IGY B;  5EGH A;  2IUC A;  3IGZ B;  4LQY A;  2VQR A;  3E2D A;  5LRM A;  5DLW A;  4CXU A;  1AJB A;  4LR7 A;  4ZGA A;  3TWZ A;  4CYS A;  4GTY A;  2GA3 A;  2ANH A;  3NKQ A;  1Y6V A;  5C66 A;  4LRB A;  3NKR A;  3DYC A;  4CYR A;  1ZEF A;  4UPL A;  4UOO A;  3UN2 A;  4FDI A;  4KJG A;  5AJ9 A;  3BDG A;  4LRF A;  4GTZ A;  4UPK A;  5KXA A;  1EW9 A;  1KHL A;  3NKO A;  5LQQ A;  2W5X A;  4QAX A;  3T00 A;  1ALI A;  1KH9 A;  4LRA A;  3NKM A;  2D1G A;  1ELY A;  4GTW A;  2ZKT A;  1B8J A;  5LIA A;  3WAW A;  3BDF A;  5GRR A;  1KHK A;  4CXK A;  5L0B A;  2XRG A;  2QZU A;  4MY4 A;  5TJ3 A;  2GSO A;  4UPH A;  5L0K A;  2GSN A;  1HQA A;  4MIV A;  4KAV A;  5DLT A;  4ZG6 A;  3UN5 A;  4N7T A;  2W8S A;  1Y7A A;  5GOV A;  3M8Z A;  3CMR A;  3BDG B;  1EW2 A;  1URB A;  4NWJ A;  1K7H A;  1N2L A;  3WBH A;  3T01 A;  4ZG9 A;  3DPC A;  3MK0 A;  5EGE A;  1ALJ A;  5L0E A;  2W8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...