3TZKA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92a) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAAITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tzkA00
3HG7A 4DPMA 4B3HA 3MTJA 4MVJG 4FW8A 2NVBA 4K1LA 3W6ZA 3JQ7A 4H3VA 4OQYA 3G0OA 3UKOA 3NTOA 4ND2A 4F6CA 1DSSG 5KVCA 3KYDA 1ENZA 3FNGA 1MXFA 3H9UA 3I9NA 4IY1A 3H5NA 4B7CA 3F1LA 4XGNA 1QYVA 5KOIA 3RD5A 1BRMA 4OOFA 3PQEA 1DFHA 5AXDA 3RI3A 4NJMB 4BO3A 1FF9A 4J9VA 4GI2A 1YVEI 4K9DA 1I24A 2JL1A 2VWPA 3SC4A 2F00A 4A26A 8ADHA 4J3FA 1GYQA 2DLDA 4GH5A 2WYUA 4BV8A 1H94A 3FCOA 3R0IA 1OOEA 4PLPA 4PFJA 4KOAA 1DIGA 1WNTA 2J8ZA 2X58A 1DO8A 4TKMA 1ZNQO 3JQ8A 2FSVA 1UXHA 4OOEA 3QJ5A 1ZEMA 3ROKA 4BNKA 2WSBA 2Y05A 4BNHA 1UXIA 4KUEA 4INAA 1KIFA 4UUNA 4RPLA 3ZWCA 4DPLA 4DIBA 2VT2A 2OFPA 5EPOA 1GQQA 1AN9A 1H5QA 4F45A 5KJ1A 1UUFA 2WD7B 3QIVA 1XU7A 1YO6A 4DXHA 3FTNA 3MZ0A 1PZHA 3K5PA 5KVSA 5ILGA 4CV3A 1PSDA 4ILKA 2FN7A 4PLZA 2VUSA 2GN8A 1XQ6A 4FN4A 3VDQA 3CMCO 1NFQA 4Y8VA 5K0ZA 3RROA 1DC3A 4PZCA 2A35A 4XR4A 1ZIDA 3BMQB 2ZATA 4RVHA 1DXYA 2IZ1A 3PYMA 3DAFA 1WZIA 4MPDA 1D3AA 2ZCVA 5A03A 1FK8A 4BO5A 4MVJD 1TI7A 2VUUA 1HSOA 2YV3A 4CM9D 5AXAA 4RJTA 4B3IA 1HETA 1NWCA 2Q1TA 3GC6A 3NDIA 3O38A 5JBIA 1BW9A 2VWHA 2HMWA 4D45A 1DIRA 2FRDA 1IHYA 4URFA 5TS3A 4KUHA 1IZ9A 1SOWA 2F1KA 3O9ZA 1MUUA 4HADA 3BMOB 1SB9A 2P4QA 3DBVO 5I7EA 3AY6A 3JD1A 1E6EA 5CPFA 1HE2A 3RC7A 2E82A 5IXYA 3RUDA 4BKRA 1AHIA 3DR3A 2VQ3A 4C7KA 4YJFA 4PN3A 1BGVA 1R4MA 2D4AA 1Q2XA 2UV8A 4QQRA 4XCVA 2B35A 2RH8A 4DREA 4JNKA 4XQGA 4NZ9A 5JYDA 3T4XA 1GEEA 1R12A 2O3SA 2DAPA 3LLSA 4N54A 3QWAA 3W8DA 1D8AA 2G82A 3AY7A 1LU9A 3BMCB 1I10A 2VCYA 1V0JA 3HB5X 1HLPA 4WNCA 3ONDA 4Z9FA 3TZQA 4KTVE 2JCYA 2X0RA 4WLOA 5KVVA 3RBXA 4JGBA 1V8BA 2Q2VA 3RUHA 2X5OA 1PL7A 3FI9A 1D1TA 4QSMA 2YV2A 1ADBA 3WSVA 2Q46A 3N7UA 2ILTA 3AUSA 1O5IA 4MVJI 3MJTA 5IZ4A 4B79A 1ONPA 1WXDA 4BS9A 4MIOA 1GV0A 3DEYX 1GEGA 4J0FA 4U8GA 4MO2A 4ND1A 2Q50A 5DULA 4A7PA 2C29D 4I9NA 1XCBA 3B20A 4W9NA 2EG9A 3LC7O 3GPDG 3KHUA 4UUPA 3X2EA 1H6CA 1X14A 1YBMA 2JHGA 4Z0PA 1K3TA 2P4HX 1AUPA 2O3QA 1DEHA 2GCGA 3NJ4A 1E6UA 4FOSA 4CQLB 4IIUA 1BSVA 5T8KC 4XYBA 2IXBA 3BZUA 4JCOA 4BNWA 1A72A 1E6WA 4GSKA 2EKQA 3L6OO 1ZSVA 4YB8A 5ENVA 3WYCA 3HNPA 2HJSA 4ZQFA 2NU9A 3KYCB 4NFSA 2LDXA 2V6MA 3EMKA 3GG9A 4XJTA 3CEAA 3WGOA 4R1NA 4DL9A 2D59A 1SBYA 1Y9EA 2CDBA 3AI1A 4CUZA 1YWGO 1W73A 4WCFB 1MGOA 4E5KA 4YXFA 5CEJA 3ZWXA 3INGA 1N8KA 1CIVA 3OIFA 4UEJA 2LDBA 2TMDA 3HJAA 1ONOA 5A9TA 1JTVA 1DPGA 1SMKA 2NVWA 3C8MA 3KLPX 4II2A 2ZTLA 4LCEA 1Y1PA 3SJUA 2HLPA 1V6AA 3GEDA 4LVCA 4OKIA 3DC2A 3WJAA 1FDTA 4YAJA 3KEQA 4Z9XA 1U4SA 3Q11A 1OC2A 3U09A 1PJCA 1UXGA 4RZHA 3GUYA 3BTUA 4ZQEA 1R6DA 1PZFA 1VJ1A 2Y0CA 5DDIP 3TFQA 4XJSA 4PLVA 1NFFA 4WLVA 3K2BA 4E32A 1DFIA 1HDCA 1PJTA 1U8XX 3GNTA 4OH1A 5A9RA 2CF6A 2X0JA 4CMEC 4D43A 2Q2WA 2IE0A 4S3MA 3K73O 2YDXA 2OGUA 1V9LA 1B15A 1O94A 4B8WA 1NPDA 3L07A 1C0LA 1JVBA 1E3SA 1BVUA 5JLAA 2HCTA 3M1LA 4BO9A 4IDBA 4J90A 3AK4A 3RUEA 3E82A 4CLOB 1Z73A 1JVSA 2PWZA 3LLVA 3SEFA 3UICA 1DIBA 4BUCA 4Q3CA 1UH5A 3ETDA 4BO0A 3C24A 3ENKA 4PRKA 3ADOA 3V2GA 5IF3A 3UCXA 1DB3A 3JD2A 1H6AA 4OAQA 2NU8A 1BHSA 3VTFA 3I6QA 1K6XA 4J91A 1YDWA 2Y99A 4L76A 3B6ZA 4Y6PA 2QW8A 3LSYA 5G0TA 4OJNA 4GWGA 2B69A 1KVRA 1P1FA 4I5DA 4FDAA 3EW7A 1W0CA 1OBFO 2QRLA 4XGIA 3ICCA 2JFFA 3OQ6A 2BHLA 4XYEA 5F5LA 3RC9A 3DAGA 1LBEA 2AW5A 5I9NA 2DTDA 2FPPA 1GZ3A 4WEOA 3V8BA 1T4DA 2UDPA 4CMHA 4P22A 5COQA 2HSDA 1NVGA 5JFOA 1ZH8A 3JYLA 4L74A 2I5PO 4DYDA 3GGGA 2NU6A 3S1LA 4HY3A 1HDZA 2VTEA 3OQ1A 9LDTA 4L0QA 3TN7A 4J6FA 4PLTA 3G1UA 1HDXA 3ZV6A 4J1NA 3EZYA 4ZVVA 1B16A 4QO7A 2DFVA 3DOOA 2VWQA 4R51A 1R4NA 3DONA 4NJOA 1U8FO 2QIOA 4RF5A 4NK5A 1EQUA 1PTJA 3IUSA 1EVJA 1PJ4A 3LQFA 3K2EA 3L4SO 2DTEA 4RQTA 1KY5A 4BMSA 3JYPA 4EJMA 2NM0A 4NBRA 3ENNA 4OXYA 1YOVB 2OOSA 3UOGA 5CAEA 4MVJM 3HDQA 1PWXA 4G2NA 4CLOA 2BGKA 1ISIA 4WLUA 4A27A 1TLTA 3O26A 2G0TA 2B5VA 4J7CA 5JCXA 4PG4A 5ER6A 1N1EA 4DRYA 2AXQA 2OZPA 4JQCA 3OJLA 2GZ1A 4HUJA 1MXHA 3PHHA 1M67A 4R1UA 1I2BA 3LC2O 5G4KB 4QO8A 3NX4A 3VOSA 4LN1A 1NNUA 3FTPA 5C7IO 4JK3A 4AJ1A 2YDYA 1PQPA 4NFYA 2P9GA 2PV7A 2YHIB 3CIFA 3FRJA 3FNFA 5IAAA 2O7SA 1HLDA 4M54A 2I76A 4WJZA 1YE3A 4JBHA 1LSUA 4OGWA 3CE6A 3U5TA 3LT0A 3O4RA 3GUCA 1JDJA 1BDMA 3OP4A 1ISHA 2OP0A 3LT4A 2FR0A 5C37A 3AM4A 4TWRA 4N7RA 4L9RA 1E7MA 1ENOA 4HP8A 4IXWA 3U4CA 4RVFA 3HUDA 5DOVA 4CLRB 4RZIA 4J49A 2A92A 4TRNA 3DMTC 3LDHA 5ES3A 2A94A 4W99A 4W4TA 1VPDA 3WGHA 3UUWA 1N9GB 5BNIA 1LDBA 2C20A 2ZK7A 4HFRA 4BMNA 3BTVA 2RHCA 5JXWA 4RLSA 5AVOA 5U4QA 4PVDA 3DZHA 2WE8A 3NUGA 4KP7A 4R01A 4ALKA 3ZH2A 4ZU3A 1P0FA 4UEOA 4BL5A 3GOHA 3OJEA 4XX0A 2GF2A 4EW6A 2C54A 1E7YA 5LC1A 3BHMA 2I65A 2FR1A 1J6UA 5EL0A 3W8FA 3H5RA 3QV1A 4XEHA 2OP1A 3PJDA 4JLWA 4LW8A 4DTIA 5JC1A 3L77A 9LDBA 4A5OA 1WPQA 2YV1A 2EP7A 3H2ZA 4QXMA 4R3WA 1ADFA 1EE2A 4YQYA 4ID9A 2YW9A 3JQBC 4Y6SA 2OUIA 1JWBB 2NTVA 2W4QA 2EGGA 5DZSA 1N7HA 3E9MA 4XYGA 3OA2A 1Q7BA 4UVHA 3WLFA 1B8VA 1KYQA 1VSUA 4CV2A 1QRRA 3RUIA 5A9SB 2I67A 3DQPA 4P8RA 4DQUA 1H0KA 3PFWO 3ZWYA 2CF5A 1U7HA 5BSFA 1ZJYA 3ITKA 1LQUA 1K6IA 1P1JA 4QFDA 2BFOA 3H2SA 4CMBA 4PLGA 2V6BA 5ITVA 3PDUA 1GZ4A 2VHXA 2XOXA 3GPIA 1K0UA 3WYBA 4AJJA 2Q4EA 3S2EA 1XIVA 3T7CA 5BSGA 4JIGA 3FWNA 3LVFO 4DUPA 1KEPA 3HDHA 4DWVA 4H16A 1MLDA 5AOVA 4Z9YA 4RF3A 1A7AA 2GDZA 4AJOA 3A9WA 2J6IA 1Y8QA 3OMLA 4FC7A 4P4LA 3RJ5A 4PLHA 1T2CA 2VZ8A 1LUAA 4AJLA 4DLAA 2AQ8A 4WNIA 2OO5A 4EUFA 1DLIA 2Y1OA 3CTMA 2VYVA 3HFGA 2BGMA 3BIOA 2ZQZA 4NHEA 1RM4A 4YT5A 3U4DA 4M55A 3NGLA 1BMDA 1E3LA 4FGWA 3DHEA 1YKFA 1O95A 4KTTE 3UF0A 4BGEA 2G5CA 1EFLA 2NTNA 3NTRA 3I4CA 2JAPA 2Y1GA 2D5CA 3QY9A 4FFNA 4ZGWA 3B1FA 4BGIA 2PD6A 1IPFA 4E4YA 3H9GA 1CDOA 4R41A 4DLBA 5H82A 1E1KA 2Y1FA 3HHPA 4DIFA 2DM6A 2ZTUA 2Y68A 3AY3A 3K8ZA 3FBTA 1M6HA 2CZCA 3M2TA 4FJ1A 4NBVA 4TZTA 5KJFA 1T26A 1QP8A 5G0UA 2B36A 2Q99A 1KVTA 3WGTA 4CR8A 2I6TA 4FFMA 3ANNA 4LMRA 3GGPA 1T25A 3OJOA 2VOEA 1UP7A 1L1FA 4CL8A 2QRKA 4Z6KA 4XDYA 2Z1MA 1ZK0A 4IDFA 5BSEA 4IS2A 1AE1A 2ZTVA 5I9MA 5L7YA 4CM1A 1PQWA 3FNHA 3PHGA 3LT2A 3EC7A 1MC5A 5CG2A 5G0SA 2HMVA 1XA0A 3ABIA 4BO1A 4AJ2A 3WGIA 3IAHA 3PQFA 3W4IA 3VZSA 4BKPA 2Q2QA 3AM3A 1X0VA 5EESA 2PZMA 2ZTMA 3I9KA 4RF2A 4YEDA 3RIHA 5TGDA 4WUVA 5HBRA 4PLFA 1P3DA 2J5RA 1YQXA 2ZKLA 3PHLA 4AJNA 2O4UX 3CUKA 1IUKA 1O8CA 2P9EA 4G5HA 3P5SA 4RF4A 2GUGA 4BNYA 3ZNPA 1YDEA 4IDEA 4CMKA 1GPDG 4IBOA 3VH1A 2PLAA 3IDSA 4ONEA 4BVAA 4YACA 1C3VA 4B8ZA 2E4AA 2Y1CA 4EJ0A 5DF1A 3I1JA 2O23A 3JQ7B 1Z7BA 1XSEA 3U4HA 1OI7A 1NPTO 4QX6A 2OORA 3TJRA 3UAGA 5HRUA 1EZ4A 5JAQA 1KBZA 4QECA 1G0OA 1J49A 2JHFA 2NU7A 4PLYA 1U9JA 4GL4A 5ICMA 5ICSA 1Z82A 4XIYA 1EDOA 4OMUA 1DBVO 4D79A 2EW2A 1EVYA 3WFIA 1T24A 2EGHA 4XB1A 2BH9A 1YL6A 1LRLA 2E48A 3AUTA 4YDRA 4BKOA 4A73A 3V1TC 1XGKA 3LU1A 3UW3A 4D44A 2FPIA 4OKNA 1EDZA 4GWKA 3OIDA 2QRJA 3TF5A 1HSZA 3V1YA 3S2GA 3WTCA 3A28A 5TJHA 1YB1A 1WDKA 4GQAA 2DKNA 5TF4A 4AJHA 2GSDA 2O4CA 3JSAA 3KSUA 5DT9A 4LISA 3WR5A 3RFTA 4YJHA 3W4JA 1BTOA 4J4HA 4OXNA 4PVCA 3RVDA 2BFMA 4CM7A 3DZGA 1DAOA 5IXSA 1HZZA 3AU9A 4IIVA 2NVUB 5AXBA 2HAEA 4FBGA 4LCJA 5EJ2A 3BXXA 4B4WA 2DBRA 1NAIA 4GPD1 1ZMTA 5JO9A 2EERA 5BSHA 3GVHA 3PEFA 3F1KA 3VHRA 4N5NA 1QYCA 2AG8A 3LK7A 5DP2A 3VH3A 4DLLA 2O7QA 4HFMA 3QVWA 2HKIA 1E3WA 3WGZA 3ZI0A 1ULUA 3BYZA 4O5OA 3W4KA 5TJ9A 1LA2A 1ZO8A 1V3UA 2H63A 2Q45A 4NH4A 4UAGA 2CD9A 2ZB4A 4ROSA 1IL0A 2HK8A 3Q0EA 1R4MB 2AE2A 1VL0A 4IJVA 3G3EA 2W98A 4E2WA 5IN4A 3T4EA 1W6UA 3WGGA 2DQ4A 2I99A 1M76A 1UAYA 3H6KA 4HNGA 4NI5A 3ZNQA 1BDBA 4AL4A 5TLSA 2WWRA 1QYXA 4CUJA 5EMHA 4DQVA 2W2LD 4ZHSA 2DTXA 5KKAA 1HE4A 1F12A 1GUFA 5EN4A 2J3HA 2PZKA 1HYEA 1B3BA 4I9HA 1ML3A 5FI3A 3D1LA 3E1KA 3GDFA 3H4VA 4GLOA 3FSRA 4D3FA 3JQEA 2GGSA 1N7GA 1I2ZA 4PZDA 1V3TA 4WCDA 1HT0A 4IUYA 3MOGA 3VPHA 5BNTA 5IFLA 3IKTA 1XEAA 4A2CA 5HWSA 3GZ4A 2Q49A 1ZXLA 3BHJA 3DZIA 4CQMB 4RORA 3P7MA 3KTDA 4YPOA 4YRBA 5TIIA 4DPKA 3DBLA 2WM3A 4E6PA 1XLTA 1HE3A 4IM7A 1A5ZA 3OFSA 5TX7A 4MKRA 4U0KA 2YYYA 3SC6A 1T4BA 2NUAA 4WLNA 4C7JA 1PJQA 3QRWA 4QEDA 3RBVA 2AEMA 4X54A 4XIJA 2ZYGA 3PWSA 6ADHA 4FFRA 3ETEA 2P9CA 2VZ0A 3JYNA 3C1AA 3KM0A 5T67A 4I9UA 4EUEA 1CF2O 1WDLA 2WD7A 1EK6A 1DOHA 1RYDA 3C85A 1P31A 4NBUA 3PK0A 3JQFC 1C0KA 3JQAA 4BO2A 4UVIA 4U5QA 2VN8A 3RFVA 4L73A 1U3WA 4W7IA 1ISJA 4BOYA 4EEZA 2B4QA 1WDMA 3PLRA 4GMGA 2OHXA 2NWQA 1KEVA 3KUXA 1I36A 3RAJA 4A10A 4J9UE 4EDFA 5G0WA 3PJEA 5I7FA 3H65A 2WD8A 5TSDA 1I3NA 1ZSYA 2H6EA 3OJFA 4Y6RA 1G6KA 1E5LA 2BELA 1JLLA 3WWZA 1JAYA 3IJPA 2RCYA 3WDSA 4O63O 2NNLD 2VNSA 2ZJ1A 3RBZA 1PJLA 4O1MA 1LI4A 4Q9NA 1DIAA 1KS9A 4HFJA 1DLJA 4DMLA 2HMSA 3GNSA 3TOZA 3Q1LA 2UVDA 3JYOA 3JQDA 2ZIZA 2DC1A 1GL3A 4TRRA 4BGVA 4J43A 5K6AC 1U3TA 1ULSA 3NV9A 4PGFA 4WCFA 5B4VA 2ZCUA 2I9PA 4JROA 4RLHA 4K26A 4J7XA 4WE3A 3WNVA 2Y67A 1F17A 3F47A 3ROQA 3U0BA 3KYCA 1E3JA 3UHAA 4JJFA 3PWZA 3JCZA 1K89A 4BNUA 3ROMA 3ZHBA 1DRWA 2X8LA 3WGQA 5CDSA 3PHJA 1TVEA 5TQVA 3KRTA 3DMYA 1V35A 2AEFA 5JC8A 4IQ0A 1NQ5A 3VKUA 4M49A 1VRWA 2PZJA 3QWHA 2TMGA 2AQHA 1X15A 3C7CB 4M1QA 2GO1A 3ZWVA 1LLDA 1YL7A 4CM8A 3GGOA 4PCVA 4AVYA 1Y81A 2GYYA 2VHWA 2VZ9A 1QLHA 3DZFA 2D3TA 1PR9A 2R00A 3EYWA 5T64A 3VVBA 4W9NC 3PZBA 4CMJA 3G1TA 3VTZA 4D41A 4YRDA 4NNJA 2JFHA 4GKVA 3GAFA 4TQGA 2R00C 1K5HA 4PRLA 2JD0A 1DRVA 5HS6A 4OYRA 3ZV5A 3QWBA 3D0OA 3ORFA 2J5KA 4KQXA 3E9QA 4CM8B 4G81A 1PGPA 5F21A 3FBGA 5GY7A 1I32A 2JAHA 1E7QA 4D7AA 3GVPA 2QX7A 1C1XB 3K31A 3PIIA 4GBJA 3GDGA 1CETA 1PS9A 4BQPA 4XB2A 1MV8A 3GZNA 5HTOA 2I66A 3OA0A 4FS3A 1FDVA 1T2AA 2E6UX 1D7OA 2GN6A 2ET6A 4R5MA 3ICPA 3I9OA 4M87A 1P45A 2O2YA 4XR9A 2V7PA 3EGOA 4MVJE 4CV1A 2DPHA 5DBGA 4Z0HO 3DFUA 5I7VA 3ZWBA 4LVUA 1E5QA 3ZN2A 2FSSA 1PU2A 2HK7A 2IZZA 3U4IA 3Q2KA 3U9LA 3DBHA 4R1SA 5CEEA 3N58A 3FD8A 4NPCA 1TA4A 1W4ZA 2CY0A 3TOXA 1VLLA 2EEZA 2W2LA 1EE9A 3C7DB 3KBOA 4FFLA 1UDCA 4UUOA 4E31A 1VKOA 4I08A 1JKJA 3PIDA 4CLHA 1YBAA 4W7HA 1Q0QA 5J23A 4Y98A 5A1TA 1PR3A 3I4FA 3B1JA 7ADHA 4RPGA 5MDHA 1GTMA 2VYVD 5T8KA 1AGNA 1N2SA 3ST7A 4CL3A 2GN4A 3ZWMA 3QWFA 1UDBA 4BNJA 1LSJA 1WWKA 1IYZA 5AXCA 4BV9A 4EITA 1AXEA 5TNXA 1UZNA 5JY6A 3DZJA 3NGXA 5FF9A 2JJYA 2NQ8A 1NXQA 5CPBA 5U9CA 3F46A 4XA8A 1GQYA 4PLCA 3WNQA 1Z7EA 2EHDA 1ARZA 2Y1EA 3VVCA 4TVBA 3WWYA 2WYVA 1P1RA 5A3VA 3AUUA 4CMCA 4EYEA 4IZHA 1OZAA 1QMGA 4TRMA 3WB9A 1M66A 5JAIA 2CVZA 4CLXA 2GERA 3DBLB 3R3JA 1VI2A 4J4BA 4R16A 3W1VA 4DBVO 1NWHA 1TT7A 4BNMA 2FMUA 2YHUA 3RUFA 1LRJA 4IINA 3SX2A 5A5EA 2X0NA 2Q4BA 1B0AA 4HNHA 1XDWA 1ISMA 2HDHA 2NVUA 4BNLA 2JFGA 1GV1A 4WLFA 3INTA 4BNZA 2VRCD 4D0RA 2YUTA 1B3RA 2EJVA 4CR7A 2HO5A 2EV9A 2XXBA 3BHIA 2OL4A 4U6QA 1A71A 1R66A 5MGBA 3WTBA 1KETA 1F06A 3E8XA 4FPXA 3M6IA 4B7XA 1A9ZA 2X5JO 3KB6A 2OXIA 3HDJA 1FDSA 3QVXA 2PH3A 3GN1A 3E18A 1E1NA 1Q1NA 5ER9A 2B37A 2ZYAA 2VWGA 2QG4A 3LT1A 4YTEA 3GG2A 1U5CA 2XF8A 3NKLA 3PYLA 5L7TA 4JBGA 1H9AA 2Z1NA 1BXZA 5I7SA 2DUUA 2Q3EA 4UULA 2DBVO 3C1TA 5ITWA 1YB4A 4FD3A 1ZEJA 2B5WA 4IJWA 5JDCA 4UVGA 3PJGA 1E7RA 3D4OA 3GEGA 4F6LA 1YS4A 5C7OO 1H93A 8LDHA 3GHHA 1F8GA 5KCZA 5KVQA 5JS6A 3QVSA 4BO8A 3GZNB 2RAFA 1NFRA 1P9LA 2EW8A 3LYLA 4GSLA 2B4TO 1ZK3A 4YQZA 3WJ7A 4MIYA 4BIIA 3AOEA 1XHLA 3JTMA 1X7DA 1YGYA 1TT5A 1R15A 3P2YA 3CZMA 2HJRA 1U3VA 3TRIA 5A06A 4RVGA 1DIHA 4E21A 4P4GA 4IGFA 5JMPA 3E6AA 3KO8A 2DU8A 3ITDA 2C2YA 2XXJA 3OF2A 2AQIA 1XG5A 4DYVA 4Z3DA 1J0XO 1FDWA 3MTGA 3OEYA 1TXGA 2FPGA 4YR9A 2YY7A 4RPKA 2EXXA 5EIOA 4OSPA 3IS3A 3WIEA 4ZICA 3GDOA 1DC6A 3D5TA 4K6FA 1TT5B 5KNLA 1NVTA 2VHZA 2YHIA 3OHSX 4HFNA 3EZLA 5IZCC 1PZEA 3GNQA 1BXKA 3TQHA 1LDGA 1LX6A 5HM8A 3WBFA 5B4UA 4BNFA 3F6YA 1CQIA 2IZ0A 3K9QO 3ZGYA 2X6TA 3QLJA 1H2HA 3H8VA 1I01A 3L9WA 4ITUA 3MWDB 4BMVA 5CP8A 3BA1A 1ISGA 4K6CA 4ZJUA 2X23A 2W90A 5A05A 1P0CA 4CQMA 1UXKA 4IMRA 1ONNA 4WKGA 3UCFA 3KSZO 1PJ3A 1A4IA 1ZZEA 4RPJA 4I5GA 4J2OA 4PLWA 3M1AA 3O8QB 4NR0A 4DMMA 1FXSA 4RVUA 4W6ZA 1UP6A 4E0BA 2UUPA 4KWHA 4E3ZA 1MFPA 1OFGA 5CHEA 5DOZA 1B14A 4OM8A 1WP4A 3DDNA 5TT1A 3ZWAA 5COBA 3EY4A 2YQ5A 4FQ8A 3EVTA 1E1LA 5JDCC 1HL3A 5KIAA 3GY0A 4H15A 3IKVA 3JQAB 3DZKA 1NAHA 1YBVA 3DBHB 4AICA 2D8AA 4BB6A 2JD2A 2R2GA 1DC5A 2A4KA 2PD3A 3MJVA 5DNAA 4KUGA 5CEFA 1HF3A 3PI7A 4KDFA 5GZ1A 1E92A 3KOUA 4BKUA 2AA3A 3DO5A 3TFOA 3PHIA 3WLEA 1HEUA 4QUKA 4BO4A 5FI5A 1XWFA 1C1DB 3AW9A 2GASA 2RIRA 4ALLA 5C3MA 2PKQP 4PIVA 1HYHA 1EMDA 4OL9A 4FGSA 4U7WA 2CVOA 1IULA 1ISFA 2C2XA 1PJBA 4CLDA 4M86A 4PG5A 1ZK2A 1N1GA 5A02A 4AJIA 3NT5A 2ZB8A 5KKCA 2D0IA 3DTTA 5A9SA 1Y8RA 3OEWA 4D0SA 5EERA 1VKNA 2NSDA 3F5SA 1UZLA 3FR7A 1O89A 4RDHA 3ANLA 4PZEA 3WBBA 4IJUA 4ZRMA 3T7EA 4YAGA 2W2KB 1FDUA 4CM9A 2C7GA 3D4PA 3I9MA 3KZVA 3L6DA 1P1IA 4MVJA 1CEQA 2O3TA 2HK9A 2Y1DA 3L6EA 4L4RA 4XKJA 5T5QA 1PGNA 1B8PA 4TSKA 1LSOA 1DHTA 3RU9A 3WICA 5L4SA 3RJ9A 2VUTA 3L4BC 3PGXA 4E13A 2C0CA 1I8TA 4QTZA 3WQRA 3LF1A 4ND4A 5JYEA 4OXKA 3UVEA 3OBBA 1X1TA 4A0SA 4C4OA 3HDYA 4NIMA 2P91A 1VE9A 2O2SA 4YT4A 4W82A 1X7HA 4AG3A 1J5PA 2ZB7A 1IZ0A 3G17A 3FHLA 1GQ2A 2P68A 3H3FA 4Q3DA 5I8WA 1NHWA 1PQUA 2IRWA 1L7DA 4BNIA 1C0IA 1LTHR 1PZGA 4O6VA 3GMSA 1B8UA 1VL8A 2X9GA 4CLRA 1ID1A 2IDZA 2D1YA 2V6GA 3NEPX 3Q2IA 3DHNA 4BO7A 4NU6A 3DOCA 1PJSA 4EUHA 2YZ7A 1K6JA 3EDMA 3PJFA 5L4NA 1HKUA 3JQBA 3DZBA 5JW6A 4NJMA 1ZKMA 2GN9A 4TVOA 4MKXA 5JNLA 2Y0EA 3NT2A 4FIZA 4YA6A 1TB4A 1IHXA 1IB6A 4R68A 5EQFA 1U5AA 3U49A 3K6JA 3GRKA 1ZCJA 3RSHA 2EF1A 3B1KA 4GAEA 2ZQYA 3P2OA 3ETGA 2WDZA 4IS3A 3EK2A 3QW2A 2Z5LA 2D5AA 2JD1A 2O3UA 4FFOA 1SB8A 3H9EO 5ILOA 2I3GA 1NR7A 1ZMOA 2X4GA 2BI8A 1HZJA 5FYDA 2G1UA 3SVTA 4JBIA 1PS8A 1QV7A 1A4UA 2X86A 3QVOA 2OBYA 2VNAA 3PRJA 3OICA 1SCUA 4ZA2A 1LC0A 1N9GA 3RASA 3AOGA 2PR2A 4N5LA 4FC6A 4U6SA 3GMDA 1NBOA 5IDYA 3GA0A 5BNFA 1XQ1A 1HXHA 3ON5A 3WG9A 2NTJA 2GD1O 2J3JA 4UVEA 4LMPA 4L75A 2Y0DA 3DXFA 3PWKA 4ALNA 3V1UA 5A4DA 1Y5MA 3JQCA 4RGBA 4E5MA 3U3XA 1JN0A 1ENPA 2RHRA 2Q1SA 3LZ6A 3ZWWA 5CFZA 2H1SA 2BF7A 3ZZNA 3CXRA 3KEOA 2RH4A 2BRUA 1AXGA 4I1IA 2PFGA 4E5PA 2IYPA 4NQZA 3WQQA 1BVRA 4LSMA 1A7KA 3SLGA 5JAMA 4R9RA 1B2LA 3NYWA 4EGFA 2J3KA 4EEXA 5K6AA 3DBRB 4XQ9A 4L4XA 3C7AA 1IY8A 4IPTA 1DHRA 3UN1A 3FWZA 5GMOA 3TZ6A 2P2SA 3G49A 3TZHA 1PS0A 1BWSA 2EP5A 1KVSA 4CM3A 1RYEA 3K92A 3I3OA 3VZPA 4BKQA 2AG5A 2X1HA 3FPLA 1I30A 5JSFA 1C0PA 4NFHA 2R6JA 4NDNE 4IGEA 2YJZA 3ZU2A 2QYTA 4B7UA 1ORRA 4Z3KA 1MC4A 4RDIA 1PWZA 1PGQA 1R37A 4MJLA 3O8QA 4FCCA 1UZMA 4TZKA 4NG5A 1ZK1A 3EAGA 5EINA 1M2WA 1CQJA 3PPIA 3QVTA 2SCUA 3PTZA 4GVXA 4J1TA 1IE3A 3JQFA 1LRKA 1I3LA 3KVOA 1NM5A 3AU8A 1GFSA 1O6ZA 1MFZA 2PKQO 4JP2A 4BO6A 5CDUA 3JQGB 3D64A 4LK3A 3PXXA 1Z6ZA 4ZQGA 4PG7A 1Q0LA 3WGYA 1A9YA 5H83A 2BFPA 1NQTA 4ZN6A 4J2HA 1P77A 3NRCA 4J16A 2FWMX 3WOHA 1KC1A 1SO8A 2XAAA 4WASA 4KWIA 1E7WA 5G2OA 5B37A 1DJQA 3KXDA 3VZQA 1T1RA 3WSWA 1YJ8A 1KVUA 1P1HA 2CUKA 2IYOA 5LCXA 5B12A 1PEDA 4XQEA 1EVIA 3AWDA 1FJHA 2BMAA 5DP1A 4XD2A 3JQ8B 4YAKA 5L40A 3D5QA 4II3A 4Q3BA 1Z74A 3BMNB 1A27A 4EBFA 3ZU4A 4YYZA 2DT5A 3NAQA 1BXGA 4CR6A 1S6YA 3D3EA 3I6IA 4JP3A 4DIOA 2GZ3A 2VYNA 3VH2A 2G17A 1C1XA 4MVJP 5CG1A 1QYDA 1WW8A 4GX2A 3HADA 2FZWA 3L4BA 3ZU3A 3QWIA 1T2FA 4GKBA 4NBWA 1LDNA 3R3SA 1U28A 2X7HA 3FPCA 1LLQA 1GCUA 1PJ2A 2Z95A 2E49A 3RU7A 3IQDB 4ESOA 1DDOA 2HRBA 2PGJA 1MG0A 3O03A 1Q0HA 4IQGA 4B4VA 1UJMA 2GR9A 3QQPA 5BQFA 5L53A 4ND3A 3HQ4O 5FFFA 1U2GA 3L9XA 4FJ0A 3BMNA 5B1YA 2PK3A 2GPTA 2DBZA 3MOIA 5JDIA 2VTDA 4Q3EA 3NT4A 3BTSA 3D3WA 2Y93A 4I5FA 2QQ5A 3IOYA 3WFJA 1EQ2A 2Q1UA 1VM6A 3QSGA 1O9BA 1ZBQA 4BNTA 4GMFA 5IJZA 3Q3CA 4Q39A 1ZVMA 4R1TA 4E2XA 3ASVA 2C82A 1R0LA 1ADGA 1KVQA 3BTOA 1H9BA 1XR3A 5F3RA 3STHA 5L51A 1MP0A 4NBTA 2PA3A 3QP9A 4TROA 4E5NA 5A3JA 2BLLA 2AMFA 1EUDA 1DFGA 1JKIA 2J5QA 1IOLA 1U4OA 5B4TA 1Z45A 2P5YA 4MDHA 1GYRA 1WMBA 4YCAA 3GEMA 4N18A 1NASA 5H81A 1GUZA 1YQDA 4BHTA 5THKA 3VH4A 5L9AA 4YAEA 2DBQA 3C1OA 3ZNOA 3INRA 5I8ZA 3V2HA 1N5DA 4CM4B 3BMCA 2A9FA 2CSUA 3QA9A 1VSVA 1E7SA 4DQXA 1OMOA 1EUZA 1RJWA 1GPJA 4U0JA 3ONEA 3CMMA 1GYPA 3SLKA 4XRGA 1LLCA 5BR7A 1U2DA 3ZWOA 2FZEA 1C1DA 4UVDA 2O3RA 4HX5A 1CRWG 3SBOA 5JE8A 5DCYA 2HQ1A 3GT0A 1RPNA 1E3EA 2CVQA 3HN7A 4MOWA 3EVNA 4CQLA 1MA0A 5IDWA 3CSDA 5DCUA 1YL5A 1NX6A 1UXJA 2V6FA 5IN5A 3Q9NA 5KJEA 5TRTA 2PH5A 4RCVA 3UXYA 3VPGA 3TNLA 4YJDA 3AI3A 3TSCA 2BGLA 3NJ8A 1XELA 3OIGA 4ALIA 1YONA 3VAZA 3DBRA 3RC1A 4B3JA 1HDRA 4CMGA 4Z0TA 1UAGA 3VZRA 3HSKA 3RKUA 1GZ6A 4YJGB 1YB5A 2V65A 1XYGA 1F8FA 2X9NA 4I8XA 4OHUA 5U1PA 4GLLA 2DVMA 1DJNA 4MKZA 5G0VA 3HE3A 1PX0A 4FR5A 1HDYA 3ZU5A 3JD3A 3IUPA 3DAPA 1E3IA 2OBNA 4CJXA 4IQ8A 4RQUA 1R0SA 4PG6A 5JPIA 4CV0A 4D42A 4XWYA 3KLMX 2C5EA 2HRZA 3P19A 3JV7A 5JO0A 2UYYA 1C14A 3GRPA 2AQKA 1U3UA 3WMWA 4YRAA 1LJ8A 5EQDA 4UEKA 2VT3A 4OO3A 2FP4A 3OJ0A 2VYND 5COAA 1LEHA 1GU7A 1SEPA 4DVJA 4L4SA 1NYTA 1QKIA 1I2CA 3WS7A 3W6UA 2PZLA 2PNFA 4D3SA 4ZRNA 4TRJA 3ZHZA 1KY4A 2AEJA 2B83A 2B4RO 1JKFA 4CMAA 4CLEA 4IXTA 5JDIC 3CH6A 5JY1A 1MG5A 3EUWA 1EBUA 1Q7CA 2C59A 3IC5A 1BW9B 3MJCA 3TDKA 3VC7A 4JN6B 5AYVA 1ZFNA 3ASUA 1GADO 2BKAA 1TEHA 4EZBA 5K9ZA 1YXMA 1PGOA 2GLXA 2GRAA 2NADA 4NK4A 3ZHYA 5L7WA 3PVZA 1ZK4A 4CM4A 1IPEA 2RBEA 3DTYA 1EK5A 2X9VA 2E37A 3KETA 1YRLA 4RVDA 3BMQA 3Q6IA 3K96A 1WZEA 4FJ2A 1QG6A 3DMTA 4TKLA 4AJPA 5TT0A 1NVMB 1P1KA 3MWEB 3AFMA 3RCBA 1Z75A 3B70A 1E0DA 1VJTA 3ONFA 2QYSA 4IDCA 1SAYA 3HN2A 5GZ3A 2G76A 1MB4A 5CDGA 2H5LA 2P5UA 2AE1A 3ANMA 4P4NA 5CDYA 1Y9AA 5DN9A 3WMXA 4DGSA 4R9SA 1WAMA 4MP8A 1ZJZA 1NPYA 1JA9A 1QR6A 2YFQA 3JYQA 3E03A 5IG2A 1DC4A 3A06A 1NP3A 4R54A 1Q7GA 3IP1A 1HYGA 3G79A 3F4LA 5DCWA 3IIEA 4EJ6A 4XDZA 3ZNNA 1NQAO 2NQTA 4E2YA 5C5IA 1SPXA 5BT9A 4E33A 4HXYA 2JKVA 2VRBA 1VJ0A 1B7GO 4RVSA 1O0SA 1T1SA 1WMAA 2YFHA 1QORA 5A5FA 3GHYA 2GNAA 1G0NA 3RQSA 4MINA 1ZUD1 1EFKA 1KERA 4CUKA 1LLUA 1I0ZA 1LDMA 1GY8A 3DFZA 1LXCA 3V5NA 3OQBA 1QSGA 1GD1O 3BAZA 2C07A 1RM3A 1HRDA 3IL2A 5THQA 3AI2A 4E2ZA 1B26A 5JCJA 3VPFA 1YH3A 2UUOA 4WEQA 3PGJA 3F4BA 1NQOA 1JAXA 3H7AA 3ZDFA 1EVZA 3NDRA 1Y8RB 4FOOA 2H9IA 3R6DA 4FB5A 1R4NB 3AUAA 2BI7A 1LSSA 3ZWNA 4MP3A 4YT2A 1PIWA 1N92A 1HTBA 4KZPA 1BXGB 2NACA 4CQMD 3ZHXA 5IDXA 1ZSNA 1KEUA 1M6WA 2BFAA 2WEKA 2PKRA 4LRTB 4BQRA 4WK6A 5JMWA 3GLQA 4R3NA 3RFXA 2AHRA 3OSUA 3ADPA 4KQWA 3PLNA 5JAZA 3MJSA 5IDQA 5L4LA 4YJFB 5DBFA 1ZXBA 3E48A 1F14A 3GFGA 1DRUA 5G4KA 2YQ4A 3RC2A 1XKQA 3ZCXA 3C3XA 3AM5A 4R69A 4YVFA 3ZV4A 5KJCA 1ADCA 2FY8A 2W2KA 4R5HA 3PZRA 3E9NA 3U62A 2PTGA 1E77A 4IDDA 2X5KO 1NTOA 1K2WA 4WPGA 3JQGA 3H5AA 1T2EA 1H6DA 3GAZA 1CJCA 2PY6A 1EUCA 1YOVA 1VL6A 3PP8A 3OETA 1PL6A 3IMFA 4JXKA 1L7EA 4WOJA 4NU5A 1I3MA 3ZW9A 4IZIA 3EHEA 3KSDO 3JD4A 1SEVA 4OSOA 1DAPA 1PGJA 3E5RA 5LDHA 2QHXA 3MEQA 3RWBA 3H9QA 3RUAA 5F1OA 1NHGA 3QHAA 4O59O 4IJKA 2I3AA 4DA9A 4OIMA 3PQDA 1HE5A 1RWBA 2IEBA 3Q9UA 4FSHA 5T6BA 4AJKA 4DC1A 1OC4A 4RV9A 3IP3A 1J4AA 1U7TA 3CKYA 1VC2A 3JQ6A 3CPSA 2DFDA 4K28A 5AQ1A 1E3WB 3GVIA 3M2PA 2X0IA 4NMHA 1PL8A 2GZ2A 4XYLA 1GR0A 5DBIA 4CMEA 3A14A 2EIHA 4YBZA 3R1IA 3WQSB 1Y8QB 2UAGA 3MCVA 1RKXA 1X13A 2CDCA 2JCXA 3HZZA 4WGGA 6LDHA 2D2IA 3S2FA 1CWUA 2FHSA 3UCEA 1X1EA 1ZW1A 4IDAA 4BNGA 4AJEA 1LDYA 1UP4A 4GX0A 1Y6JA 2HU2A 4PG8A 3GF4A 5TC4A 3VPSA 4BNNA 5A04A 4BNXA 3LC1O 4WLEA 3FN4A 3GK3A 2WTBA 4KDEA 3COSA 5L95A 3GFBA 4J4TA 1HDOA 2WMDA 3OM9A 2C5AA 4E30A 3H3JA 4WCFC 1BG6A 3ZWPA 3DHYA 4MIEA 5LDGA 3GN2A 1YQGA 4UREA 4ZD6A 4CMIA 3I52A 3ZW8A 4BGUA 2HMTA 5JCJD 2EKLA 1CERA 4H7PA 1P44A 3GVCA 5FEUA 4LRSB 3VKVA 1GCOA 3KYDB 1M75A 4WECA 5F1KA 2NV6A 2HUNA 3AFNA 4CODB 1EEHA 1KEWA 1JWAB 2QZ9A 1T2DA 5C7LO 1MX3A 4DBZA 1H6BA 3JQAD 1SNYA 3D3WB 2VHVA 2IEDA 1WVGA 2WE7A 1JQBA 4YAIA 3MJ4A 4GX5A 4EI2A 4N5MA 3FNEA 3N74A 3SXPA 4F46A 2WYWA 3JQ9C 3I5MA 4CMIB 4J1SA 3JD0A 1X0XA 2O48X 4S1VA 2HMUA 2EWMA 3PDJA 4HWKA 3KV3O 4CM5A 3FR8A 2DUWA 2EJWA 4XQCA 3HWRA 1P74A 4GGOA 1LQTA 3DB2A 5G4LA 4Y67A 2POQX 3F3SA 1I33A 2O3JA 3A4VA 5ADHA 3F9IA 3S2IA 1F0YA 3VDRA 3AJRA 3GQVA 1WLYA 1LC3A 3CZRA 2PD4A 3HB4X 3NTQA 3E5MA 3VPXA 4CM6A 3JQ9A 1G1AA 1HDGO 4D3DA 1AHHA 4JX8A 3I9JA 2B0JA 4RO0A 3CINA 3ROPA 2W8ZA 3UFXA 4UUMA 2IODA 3DWFA 1GAEO 2CFCA 4GGPA 1GUYA 4MVJF 4O0LA 2DPGA 2FOIA 1I5RA 1RM5A 4M8SA 4M89A 4JJGA 5L3ZA 2CMDA 3KYBA 1S7CA 4B4OA 4E12A 3D7LA 4B4UA 4KMSA 1R16A 1U1IA 4L8VA 4DC0A 1KOLA 3MJEA 3W8EA 4XRRA 3I9LA 2X22A 2CDAA 1E1MA 4Y9DA 1D1SA 4LSWA 4HBGA 4J7UA 5ENDA 4RL6A 3PFFA 1GDHA 4MVJH 4ZQBA 4XZ3A 3I23A 3ULKA 4XYMA 4CPDA 4E5YA 3S55A 1SZJG 4Q3AA 3GH3A 3TZCA 3BMOA 2EKPA 2FR8A 4OQZA 2C7VA 4ZQHA 3WYEA 3I83A 2CNBA 2QZZA 3UH1A 4LGVA 4YJGA 1V3VA 3S8MA 7MDHA 1LNQA 4YWJA 2O50A 3RUCA 3RKRA 1YJQA 1HWYA 2OMEA 4JJIA 3A1NA 1NR1A 4ALMA 1QXSA 4HKTA 3TL3A 1UR5A 4YT8A 4BNVA 3OECA 4I5EA 3H9JA 5F1PA 2ZJ0A 3DOJA 4G65A 2ZYDA 3D4NA 1EBFA 3WIDA 2J3IA 4MP6A 5L45A 3GR6A 4IMPA 1JU9A 5F5NA 1D4FA 2PGDA 2PGLA 3TZKA 4IDGA 2IXAA 1W8DA 4GVLA 1RM0A 3L0DA 2JCVA 5I9LA 3TWOA 3WXBA 4P38A 3OH8A 3LF2A 3FF4A 4BB5A 4D46A 1R0KA 4J1QA 1CYDA 1SC6A 4RPHA 3V2UA 5IZCA 2Q1WA 4XGKA 3PYXA 4R4JA 4WOKA 3TPCA 3K30A 3WX0A 1FMCA 4HV4A 3DL2A 1QYWA 3ZV3A 1UDAA 2BD0A 4YJHB 4A03A 1Y5RA 3F5QA 3HFSA 4QFCA 1P33A 1QV6A 4ND5A 4AFNA 5KTKA 5GZ6A 3NDJA 4QT0A 3TL2A 3IJRA 4F3YA 4AJ4A 1OAAA 2NLOA 5T57A 3X2FA 1LDEA 4ALJA 1SOVA 5FWNA 5KWEA 1I3KA 2VHYA 3QE3A 1X7GA 4Q3NA 5HA5A 3GVXA 2XPCA 1KC3A 1ENYA 2VRCA 3UGKA 1XU9A 3SJ7A 2ZB3A 4GX1A 1H2BA 2Y66A 3AOEC 1JW9B 4FFPA 4J0EA 2VOJA 1QLJA 5HS4A 2WJPA 5KJ6A 4TMFA 1Y7TA 5CDTA
chains in the Genus database with same CATH superfamily
3BL5A 3G5LA 2QUIA 1HC7A 3UJBA 5HQ3B 2YWHA 4B3HA 4MVJG 2RAVA 3GLFA 4FW8A 3T9AA 3W6ZA 3JQ7A 3PGKA 4PZLA 4ZVKA 4L2IB 3V9AA 3N76A 4DQLA 3G0OA 4EF6A 4P4SA 1TJ3A 1UKCA 3L43A 1SU7A 1DSSG 3KYDA 1ENZA 1XD2B 1MXFA 1ZS9A 2XD4A 3H9UA 1H4SA 4XGNA 3RD5A 1R0RE 4M9CA 4OOFA 3Q3EA 4YUWA 2HLDD 1U2QA 5DWVA 1FF9A 1R0BA 1G3UA 2CL6X 4GI2A 4GXNA 4L51A 2HIAA 1T0UA 4NOMA 4PSVA 1KRXA 2QKYA 4UD6A 4YK7A 5G40A 4LYHA 1IOVA 2GHQA 2XB2A 4J3FA 4Q4AA 4MMXB 4X7RA 5JWHA 2DLDA 4UMDA 1AGRA 1TUBB 2D1FA 4OI4A 5AKLA 3SXUA 2YBDA 2EC5A 3UT5B 3KDSE 4BV8A 5ABPA 3TLYA 5M5BA 4TWIA 1EHYA 2QU8A 3Q7TA 4B5LA 1J2RA 3PDWA 4BYMA 4RM3A 3VHQA 1DIGA 4A92A 1ZMBA 4JELA 3PFIA 5EJAA 3JQ8A 4HR7A 4LBYA 5K01A 1JJAA 3LBIA 1UXHA 2GCPA 5K20A 1XKLA 1GSOA 3MTIA 4Y0AA 1E6MA 2YUIA 4V0ME 1WBDA 1CUXA 4BNHA 1SPBS 1UXIA 4INAA 3EX7C 5DK4A 5IJ9A 4RPLA 3BE5A 3C3WA 4DIBA 2HDWA 2IXTA 2VBCA 1FQWA 1VDMA 2A9PA 4F45A 1EDBA 2VHCA 2BISA 3FHJA 4WZAB 5DLQC 5I51A 2W2VA 1ZQ9A 2ZXFA 1YO6A 2ADFA 4J94A 4WVFA 4AG6A 3FNBA 1YVRA 5T41A 1VDZA 1IXRC 3K5PA 1RRPA 3WLMA 3KXPA 1TECE 1P19A 4AKIA 4HDCA 5CYGA 5KTRA 4I8DA 4QVKA 4ZGBA 3KZMA 3KS9A 2IBMA 5TQ2B 1ISPA 4FN4A 5JVDB 4CRWB 1ICIA 3CMCO 2IV3A 4C9BA 5K0ZA 1QTQA 1DIOB 1LF5A 4WDQA 5HEKA 3BMQB 3NEAA 2FKNA 2ZATA 2E9SA 2QRUA 2ZYIA 3P1JA 3PYMA 4YRCA 1E8MA 1M2VA 2N47A 1D3AA 3K5IA 4YXWA 4GOKA 1LVUA 4D57A 1CU1A 1HFEL 1LWOA 3Q8WA 2E5FA 2WM9B 5DWQA 3EZ9A 3NVAA 4D97A 4ZYXA 1G4AE 1HSOA 2HB6A 3RVQA 4CM9D 1SXJC 5AXAA 2OQRA 2I6GA 4BGDA 4B47A 1NWCA 3A9UA 1C9DB 3GC6A 4HX2A 5FKJA 3G8CA 4BX3A 5JBIA 1V11B 2Q3JA 3KUKA 2MINB 2Y2VA 4BVGA 4D96A 3W90A 2Z3ZA 4IV5A 3HABA 2HA3A 4EO9A 1CR1A 3WGUA 4H1WA 4KITB 3GEEA 3PQ8A 3O9ZA 3BMOB 4P0TA 4BWYA 4RD3A 1ZD5A 3E9EA 4X8HA 3K8QA 3IFSA 3BILA 2YCBA 3AR2A 1YCDA 1HE2A 2O1WA 1DU4A 1L1EA 1TMYA 3C3EA 3MLBA 3QBTA 3EWNA 3KZNA 1HK7A 3RUDA 4BKRA 5IKPA 1AHIA 3A2LA 4KBGA 2ZWPA 4TXJA 3Q85A 2PRSA 1TYZA 1WF3A 3UQZA 2J9XB 4F72A 1WCXA 3A32A 3HUFA 5ALEA 4B48A 4C7KA 3O74A 5K3DA 4PN3A 4QJ3A 1MC1A 2D4AA 5C1DA 3C8ZA 1WSDA 3C8HA 3AEXA 4QQRA 4DS3A 5IMSA 2I7TA 1BD3A 2GWHA 3GWZA 4XCVA 4XQGA 4Y6OA 4QYIB 5F51A 2O3SA 4WWHA 2DAPA 3AESA 4G4SP 5AJYA 4HI0E 2F59A 1CY0A 3GMIA 2ACWA 2DY0A 2JBAB 4GP6A 3UWKA 5C52B 1I10A 1FLDA 1V0JA 2CNKA 4R9NA 5I7WA 3ONDA 3JU3A 3C39A 3QOYA 3HYRA 4Z9FA 5F77A 1Q22A 3CJTA 3RBXA 4AKEA 1GLNA 1DJOA 3A10A 5EP3A 4FYVA 3CNQS 1LNZA 4R0NA 5FD8A 2BGRA 1V1MA 1UFKA 2NGRA 2X41A 3RUHA 3KOMA 3DLHA 2GB4A 2YV2A 4WI1A 3WSVA 3RVSA 821PA 2Q46A 5IU6A 3N7UA 2ILTA 3AUSA 5JQGA 5IM4A 1LFAA 1NJFA 3MJTA 3O8OB 1OKKD 3BDVA 4XLTA 4LDZA 3TZBA 4JI6B 1WXDA 2G28A 1GV0A 4CNBA 3DEYX 4LG1A 5TPZD 5KOHA 4U8GA 3I5UA 1KQ3A 1QUFA 2WHQA 4ND1A 5CX1B 1SUDA 1BE0A 3OWXA 3TTUA 2O1EA 3E4CA 4IRXA 4GPTA 1XZ8A 2ZRMA 4BUZA 2BMWA 3GPDG 3KHUA 2I6FA 5H1YA 1I9CA 1NVVR 1PUJA 2UUBB 3Q7RA 4YCBA 2WAOA 4Q47A 9MHTA 3JS5A 1H0SA 1AUPA 3BB1A 1DEHA 1E6UA 1MB2A 1IZYA 4FNGA 3IURA 3D7NA 2JLRA 4JCOA 3AWIA 2AYZA 3BZUA 1KJQA 3MINA 2EKQA 4CT0A 2D4HA 3TRKA 3WYCA 1U2DC 3HNPA 3W5UA 4MDFA 3UAYA 2ZBVA 4MS1A 2LDXA 2FLWA 3CJRA 3R0ZA 3GG9A 5IJ9B 1KL7A 3GLHE 3FNQA 4R1NA 3Q8XB 4MQEB 4V03A 5CT6A 2E4XA 2D59A 2BONA 3AI1A 1H8HA 3EIUA 1IAVA 3ZOKA 3KQYA 5JSYA 5KOYA 3FOWA 5MN5A 4L07A 3OLXA 2REQA 1J0EA 5BVGA 3GGSA 4I55B 3PDIA 4YXFA 2AOWA 2AGVA 1HMPA 3INGA 3KCQA 3O83A 5DXJA 2A5GA 4G3XA 5A9TA 1JTVA 1TM1E 1U0SY 1FW6A 1Z0UA 3R3UA 1AV7A 4FHGA 3IIKA 3QBEA 1SMKA 3EVDA 3C8MA 4PY2A 1LVHA 1Z4QA 5LP1A 3K09A 4II2A 2VPPA 4LCEA 1P7PA 5BV1A 1C81A 2HLPA 1YZNA 3JASA 1A9SA 1XNGA 3K6RA 1V6AA 3GEDA 5SZJA 4CQNA 4OKIA 3V4ZA 3DDWA 1I5OA 1ZUWA 3FPKA 4ZOLF 2GXUA 4YAJA 2XQFA 1OAOC 3KEQA 2AH5A 1QP4A 1OC2A 1PJCA 1BWPA 1FFCA 4QXQA 2PGXA 1HYQA 1D2RA 2G36A 3K0HA 2OGSA 3QKRB 4ZQEA 1PG0A 1VJ1A 4C88A 4EB8A 1QVZA 2A1IA 2ECPA 3EGDB 4Z7OB 1Y5LA 5HUJA 3SYLA 1J9ZA 2O0HA 3B52X 3G1WA 3DM9B 5EHIA 5FPPA 3ZQJA 4NZZA 2P2GA 5P8WA 3GNTA 2HTEA 4FOTA 5IULC 2PAFA 3OCCA 1OU4A 2WSMA 4CMEC 3DVLA 3QPWA 4BZXA 1GP2A 3P0HA 2RHJA 3K73O 1Q1ZA 4RPIA 2V59A 5DSZA 1SKQA 4O2AB 2DYKA 1TCCA 3DKKA 4ESEA 1FFHA 4JC4A 3L07A 5K0CA 4IEIA 3W79A 4I3HA 1M72A 1T5LA 2HA0A 3CZQA 4PAQA 4CLOB 3FGNA 1J8VA 1Z73A 1XX6A 4UUQA 5EG5A 4N40A 4MV9A 4RZ2A 3AMVA 3LLVA 4JKIA 4G84A 3KWLA 2BTOA 2FWIA 1UH5A 4MKHA 3C5WP 2JAQA 3ETDA 3PXEA 3QUCA 3GFSA 2HF7A 5BQXA 6Q21A 3N2YA 3C24A 5FAKA 2OV2A 2VF8A 4FDMA 2A4MA 4WN3A 4GKJB 1DCKA 2QAGA 2WWIA 2AZ4A 2NU8A 1BHSA 3FAKA 1R6XA 3CW2A 1OWLA 4LE0A 1JLMA 4JEHA 1QGOA 5D84A 2PGAA 4K03A 4MQUA 4ZJZA 6GPBA 1BQ4A 1Q0ZA 1ZU5A 4UBLA 4AWBA 4AS3A 3SYNA 3LSYA 2P9JA 3AEYA 2VXYA 4GWGA 3SM9A 2XY4A 1P1FA 2Z58A 3PEVA 1T2VA 3Q3IA 2AYXA 4I5DA 4NBNA 1Z6QA 2Q5IA 2QRLA 4XGIA 4Y2UA 3RC9A 2VP6A 3DAGA 1LBEA 2AW5A 3L7YA 3ND6A 5I9NA 4B6SA 4ZU6X 5JZMA 1T4DA 2UDPA 3NKVA 4OYYA 4X97A 1H2EA 4ZO8A 1E2DA 1VQ1A 4BBZA 4F9TA 2R751 1C9EA 2QPTA 4J16C 1J33A 5JFOA 3D0KA 4I4TB 1G3MA 4Z1MD 1UKBA 2I5PO 3C48A 4DYDA 4DSZA 1BEZA 4RDXA 2FXIA 3A4TA 4LPSA 2IS4A 2VTEA 1G3RA 1RIFA 3OQ1A 3LLCA 1UFOA 4L0QA 2G9QA 4MX8A 4Q9KA 3SYKA 5GINE 3OTGA 2ZCJA 1VG8A 2QLLA 5K2MA 4F38A 3LM8A 3ZTTA 4B2IA 2VSXA 1Z4JA 3P2EA 2QRVA 2OLJA 1A96A 4GR9A 4EBBA 4HC4A 1CXZA 2C5FA 1J21A 2F9MA 2JH8A 3DOOA 2VWQA 3LBAA 4G0YA 1NZDA 4IUBS 4KK4A 4R51A 5JZSA 3C3CA 1U8FO 2QIOA 1W2GA 2QM8A 4BQIA 1EVJA 3EDQA 1SXJB 2AOVA 1QBGA 3K2EA 3MTDA 4PYKA 4JUDX 3JYPA 4UCFA 4OXYA 1UFVA 4ZKDA 3UOGA 4YRLA 3AF2A 4URHA 4G2NA 1RNLA 1ISIA 5ALDA 4WLUA 2FWNA 3ESAA 4A27A 1ONBA 3GRFA 4P31A 1B6RA 1CR4A 1U63A 2G0TA 2WKWA 3WRYC 2B5VA 4BE7B 1D4OA 4PG4A 5GGYA 3RREA 3ABOB 1F5SA 1N1EA 1AKMA 5ER6A 1IQPA 4GOOD 4JQCA 3BT7A 3OJLA 3B8EA 1FNNA 3A1EA 4KIGA 4PWYA 1UOOA 5MF6A 3TI9A 4R1UA 1CIJA 1C3EA 1SIOA 2I71A 2J6CA 3EMBA 3VZCA 4F5DA 5G4KB 3B38A 5JRJA 2B1GA 4IJQA 4LN1A 4OB6A 3FTPA 1BN7A 2A0UA 2XYHA 3OTOB 2E0IA 4Q00A 2OG2A 3SGLA 2CCJA 3QFHA 1D0SA 4NFYA 3CIFA 4XTRA 3EUAA 1DGQA 3FNFA 4KBFA 5ITSA 1ECFA 2OCYC 3KCNA 2BDEA 4LJ4A 1AKWA 1KRHA 4PPFA 1HLDA 2KM1A 2I76A 4M54A 3LXRA 3WIOA 4KQFA 1LSUA 2H9AA 5JO0A 3EEFA 2H7CA 4EYOA 2YXLA 4D80A 1RZ3A 3RHZA 2GAIA 2ORYA 2UZ4A 1L7BA 2FR0A 4DCOA 2G8NA 8ATCA 3KOOA 5SYAA 1KH2A 4HP8A 2HN9A 2QYOA 1L5VA 2WUWE 4IXWA 1YS7A 3DKVA 4TL8A 3C3AA 3PR2B 4QXPA 1EG7A 4GPZA 1AGPA 3S5JA 1QDLB 3WVNA 4B85A 5BRJA 1YRHA 2DOKA 2IEAA 2QIPA 1QQ7A 5BNIA 1X19A 2PX3A 2ZK7A 3MCUA 3CUEF 3Q5GA 2JLSA 1BH6A 5I7OA 2UXCB 4C14A 1PJAA 3BTVA 1PR6A 1WD5A 3DEKA 4A6DA 1Y63A 4BEBA 3JVIA 4RLSA 1W4BA 3LAWA 5AVOA 5GONF 4FYKA 2IV2X 3U3DA 1A88A 4EA9A 1H65A 1H3NA 3NUGA 2WE8A 4ALKA 3FDXA 1AB5A 3V4PB 3AVYA 3Q0IA 4ZU3A 2Z4RA 2J4DA 1S2OA 2FU5C 1Y0BA 3W2IA 4FM9A 4ZT7A 2OXFA 5FL3A 4EGAA 2QTFA 2Y0PA 2IPNA 2PJDA 2R79A 4ICIA 4OXRA 3GLIB 5LC1A 1CNFA 2FR1A 4BJ1A 3KQMA 1U3FA 2R8BA 2PX8A 3H0CA 3C6QA 3MILA 4FDTA 4JUAA 2FYTA 1GFWA 2JLBA 5DTMA 3I92A 3Q7PA 5KQMA 1GGKA 4YI5A 1WPQA 2OM2A 1G59A 2EP7A 4NU8X 3R5XA 2H16A 3H5TA 4R3WA 4JZKA 3U4QB 4HD8A 4NKRA 1F60A 3W5HA 3OFKA 5KOHB 2NTVA 2W4QA 5DK6A 5DZSA 3SYTA 2YCLA 2OEPA 4XJXA 3SZUA 4C22A 2D6FA 3O8OA 6CHYA 2II6A 2Z8YA 1Q7BA 1N2HA 4RS4A 4UVHA 4M0PA 4L8FA 4R8KA 5A4MS 2YN0A 4BFWA 4P81A 5LR6A 4PHTA 3K0BA 2ORWA 5A9SB 1B00A 1SIUA 4P8RA 1I51A 1MT0A 3ZGLA 3GGJA 4NXMB 3BBLA 3VO9A 4D3YA 2BGGA 4N03A 3VOAA 5BSFA 1KI8A 2V0GA 2WUFA 4I50A 3CNHA 4Y1RB 3SQXA 1P1JA 2HWXA 4UPDA 1U7UA 5AQEA 1YK1A 5E9QA 3RFUA 3AJEA 4CMBA 2R7KA 2V6BA 3P20A 3SPXA 1GZ4A 4IHJA 4XVQA 4C01A 5ITVA 2XJ4A 5DBHX 4DRXB 4K9SA 1K0UA 3NQ41 4G0UA 3WYBA 2A9RA 2Q4EA 4QOSA 3LY8A 2BM8A 1Z0ZA 3HWWA 1HDIA 4MS1B 2RK4A 3HVUA 1BKDR 4M0MA 4REMA 5EZ5A 1J90A 5DE3A 1KEPA 4MB2A 4DWVA 1XJ5A 1MLDA 5FV4A 1SOUA 3PNVA 2ZYRA 4Q5IA 2D8MA 3IEXA 4B43A 3Q0TA 5KDLA 1Y8QA 3R9KA 1ZUIA 1JRLA 7REQB 2Y77A 5THXA 5BN4A 4OJTA 1P3Y1 4V0SA 3H1GA 3UWSA 4E1BA 3OJXA 1UQUA 2GHRA 3F5MA 3MSXA 1ESCA 4WNIA 2OO5A 3WL3A 1QHSA 5BYJA 2C0QA 2BGMA 4PW0A 4NHEA 2H52A 1RM4A 1UAAA 5BW4A 2XBMA 3OHPA 1R5OA 3U4DA 4AP6A 4D99A 2B7CA 1BMDA 1XZGA 2J4CA 4K9KA 2IQIA 3DHEA 1YKFA 1LV7A 2KE5A 3K94A 3MK31 2P0YA 1O95A 4KTTE 1DBRA 1UJBA 4BGEA 3NTRA 1OLUB 3ESCA 5KPDA 3LH5A 2WTMA 2Y1GA 3QKWA 1N2ZA 1YT5A 4FFNA 2JIPA 4YGXB 1OYWA 4TQ9A 4ZGWA 1H2YA 3B1FA 1IZ8A 5IM5A 2PD6A 2Z57A 1IPFA 1CJBA 3H9GA 1CDOA 2R8ZA 1UBSB 1OJLA 4OAOA 4W6QA 4K6HA 1JR3A 1T3HA 1TD9A 3K8ZA 2R6AA 4GI1A 3WV5A 3FBTA 2CZCA 1OW3B 2QE7A 1WZNA 3B1VA 1WUYA 3WJ2A 4QXOA 5E6UB 1CNEA 2PS9A 3SSMA 4FFMA 4CYMA 3ROZA 2QTRA 3EZ2A 3E8SA 1NLUA 1GG9A 1W93A 1T25A 1Y1TA 2VOEA 3KJIA 5TV2A 3TBHA 3GT7A 3UT6A 3WLLA 3S4YA 2ZVJA 3O0TA 4JGGA 3FLAA 4IDFA 2IYFA 2R5NA 4TSRA 3OOWA 3AETA 1QQTA 3M6LA 1N33B 5I9MA 2I1QA 3SC2B 3PHGA 2CKMA 3MELA 2HU7A 4HAVA 2Z09A 2WAMA 3IH5A 3VMFA 3ZKAA 2VPQA 1AX9A 4BO1A 2IHBA 3IAHA 2PUDA 5CA1A 3W4IA 2HQRA 1P7ZA 2Q2QA 4DYHA 4O0MA 3FCEA 4L5AA 3IO5A 3PNSA 4X1KA 3SIXA 2ZTMA 3FOZA 1VLQA 5HBRA 5E6SA 3FCUB 4E5SA 1GTG1 5J2TA 3CYFA 5ALQA 2YJGA 3KVVA 3BDAA 4R81A 2ASVA 2Q6TA 1ZGCA 4N6NA 4UNPA 2IS6A 3BF7A 2I78A 3ND9A 4G26A 3OM1A 1Q6YA 2QTVA 4TS1A 1O95C 1JFTA 2PVSA 4BVEA 1SVOA 1RTTA 4KZKA 1K5DA 1NVFA 1E2UA 1O8CA 2P9EA 5C5EA 1LFDB 2CVHA 4FR2A 4QTUB 1PFQA 5E1MA 4BNYA 1RR6A 1ZJJA 2H4ZA 1YDEA 4G1UC 4IDEA 4O4HB 4BC0A 1FFXB 1GPDG 3KQUA 3VH1A 4DCCA 5TPZA 1DAKA 1FP6A 1EFTA 3EA5A 4WD3A 4BVAA 2QD5A 1ZICA 2X8JB 3QNMA 4L4UA 4B8ZA 1CJTC 4AULA 3WAJA 4NEGA 2Y1CA 2WU4A 1ZHOA 4ZEOA 1VL2A 1C3OB 1X80B 3CLVA 4EEKA 1JBKA 1B42A 2BHRA 1NPTO 4LWZA 5EHNA 3TJRA 4EELA 5HRUA 2ZYUX 2QXYA 1OJ7A 1RAFA 4MQEA 3UK7A 2A9QA 1ACMA 1W49A 3KFXA 1U9JA 2GLUA 4MR7B 1Y1RA 2DR3A 3WLHA 4D9KA 1OB5A 1A0OA 1YRBA 2RG7A 3EBLA 2EBUA 3Q5EA 4BFXA 1EDOA 1S3SA 2FNAA 4BLOA 1DBVO 1GKUB 2CD7A 2X7JA 3L6BA 4HLDA 2JA2A 1W47A 4K6MA 3OX4A 2Z2ZA 2QX6A 4MULA 4B84A 5BN5A 2O8EB 2HH9A 1MW9X 1YL6A 2C8VA 4N39A 1ZCZA 3QMMA 2QENA 1SGWA 3P32A 2EKZA 4WGFA 2K5UA 2FP3A 4J0HA 3LU1A 4KAJA 3QELB 4LQ4A 5K0TA 1J2EA 1I7PA 1TAGA 1V7QA 1XQWA 3IAFA 4YNBA 2FPIA 2PA0A 3N28A 1EDZA 1A1SA 1PUIA 3ANSA 4NMMA 4OKNA 2FEMA 1ETUA 4GUDA 4HT3B 3OSZA 2SHKA 1G17A 1QVAA 3CISA 4HS4A 5TJHA 4F3TA 1YB1A 2WJ4A 2QMYA 3ILHA 5TF4A 2C7QA 3WB1A 2GSDA 1E62A 1FXWA 2ZUTA 1WDTA 1K3UB 3LRTA 3MWGA 2XRMA 3W4JA 3UGJA 2BEVA 2X8AA 4BDTA 4PVCA 2CLLB 3F6PA 2BFMA 3FDJA 4JDPA 1WQ3A 4RD4A 4RIHA 4NCAA 4B6FA 1I80A 2KSQA 4IIVA 2DHEA 1JZQA 1XNJA 2A30A 4MUFA 4G8CA 4EI2A 3BXXA 4JBYA 4V0NA 3CX4A 4DWJA 4QM6A 2DT8A 4DWWA 4EATA 2WYOA 4GPD1 3MRXA 3OUUA 4G36A 2QTVB 1T4CA 2EERA 1QAMA 3ZGVA 5JSKA 3VHRA 1BAPA 1QVRA 4R8VA 2O8BB 2H5JA 1B73A 1I7SB 2P2YA 4M4SA 3IAXA 3QVWA 1BD4A 4HFMA 1NBME 2HKIA 4RWZA 3WL8A 3G2KA 3ZI0A 2EGUA 3CVUA 5BOVA 3TLZA 5E2AA 4ZVNA 4O5OA 5LYJA 3RS4A 1GKIA 3ACDA 1Z6AA 3T1QA 2HNKA 4WTOA 4NH4A 1MPTA 1V3UA 4RIIA 4MWBA 1IL0A 1QRAA 3UOWA 4KSBA 3WGLA 2HK8A 4WJLA 3DVSX 1R4MB 4HWPA 3DFIA 1L5LA 4IG4A 1CUEA 3NUZA 1TF2A 4E2WA 5IN4A 1QX3A 1TDJA 3WGGA 5J2UF 2I99A 1UAYA 2P3LA 4JS0A 4LXHA 4GKAA 3H87A 4ZREA 2EX4A 1UEXC 3EIOA 2G5TA 3UYLA 1D2GA 2IVFA 4DQVA 5FJJA 1L1QA 4C0WA 4ZHSA 5KKAA 4ENRA 1F12A 1THTA 5EN4A 1ZXXA 4LZJA 4DKJA 2PZKA 4LF9B 4H7FA 5CB4A 1WZ2A 1ML3A 1QGAA 1U04A 1V1MB 1YULA 2C1EA 1VIMA 3LPNA 5FI3A 3PITA 4B7AA 4LF8B 1AHNA 5DM4A 2ZIGA 4D3FA 2CLFB 2GXQA 1FFYA 4F04A 1I2ZA 3KB1A 1V3TA 3NNNA 3UTDA 1EP2B 3V97A 4IUYA 3UPTA 3MOGA 5IFLA 4LFAB 3W04A 1XEAA 3BIJA 4A2CA 5HWSA 1HEYA 1GPUA 3ZX4A 4CQMB 3DZIA 5CW1A 3BH0A 4YRBA 3KTDA 3HXOA 1XFAA 4HRYA 1A9XA 4L4ZA 2AJBA 4E5DA 3QKUA 2N75A 1FEZA 2QM7A 2Q5QA 1BZYA 2G0AA 3OFSA 3LQ2A 4AZTA 3W34A 4POOA 2VPIA 3AUJB 3EIEA 1RQ7A 3K1AB 2AEMA 1FFWA 1M5UA 1Z08A 3DEAA 2ZYGA 3OFVA 1DTWA 1W25A 4YUYA 1IOZA 4FFRA 4LMBA 2P9CA 2XT6A 1FSPA 2VZ0A 2X42A 1KK0A 4WX2B 5EKUA 3O1HB 5HQJA 4I9UA 4C87A 5DM60 2B8WA 3I32A 3IHTA 3ITNA 3CRZA 1O5TA 5FFMA 4FZ5A 1P31A 4NBUA 5HDQA 2V7UA 1BROA 2V96A 3JQAA 5TPWA 5HOEA 3N8HA 1T4CB 4H4EA 3TJMA 3LYAA 3ZY6A 3MS2A 4W5OA 4W7IA 5IEJA 1I4TD 3QMPA 1RZVA 1H2AS 1JPNA 2EATA 2Q07A 3B89A 4OAPA 1AK1A 4OPMA 4LGYA 1S2MA 2I8LA 3JPYA 4PHGA 5ALKA 3ZVKA 4UCQA 4LNHA 5CT5A 4X7PA 5BMVF 3FTFA 4PGMA 4HNUA 2I8AA 3RAJA 3GEIA 3GQBA 3IALA 4YECA 3IEKA 4ZZ1A 3ZS9A 2JLVA 2B3DA 5A71A 3MRTA 3H65A 3WK5A 5I7FA 1YUNA 1I3NA 1SA0B 2H6EA 5TSDA 2VG8A 1T8UA 2WA2A 3QLVA 4UMEA 4V0OA 3FNRA 4HCJA 5EGNA 5HVNA 1LPOA 1MQ8B 2RCYA 1TZCA 1UK8A 3OFNA 1EWKA 4MI1A 3WDSA 3ZG6A 1P75A 2VNSA 3CZPA 5KWSA 4O1MA 5MFPA 1F6BA 5AP9A 4HFJA 5IH3A 1DLJA 4EG0A 2QAJA 4IJMA 3TOZA 3CX6A 3Q1LA 1QOPB 3JYOA 4QHYA 3YASA 1FVXA 1NTRA 4BGVA 1ZA1A 3MB8A 1U3TA 4PGFA 4WCFA 3FLBA 2ARKA 2ZCUA 2I9PA 3AJAA 2IVZA 4RLHA 2WM2A 3WL6A 4B81A 1Z0DA 2QLNA 3AXSA 3L6RA 4LVOA 3CZCA 5B1SA 4L2IA 2IV7A 3U4QA 3MWYW 4HYYA 4QDJA 1AXRA 3F67A 4BFUA 3BAFA 2QUAA 1E3JA 2E2WA 2Z3WA 2NU9B 3NVMB 1GITA 3PWZA 4LZZA 1HEIA 3W2FA 1K89A 1KI6A 1Z2AA 3ME5A 2BLNA 3WGQA 1VBKA 2OY0A 5CDSA 5J3JA 5K8UA 3E2IA 2WAXA 2AZXA 3I2KA 4P92A 4R3UC 4LNUB 3IIMA 3RKSA 3EQ7A 3Q3HA 1QVWA 5TMPA 2PZJA 3F6BX 1YK0A 2TMGA 3HXLA 1Z62A 1G2IA 3KQQA 3IT0A 3LD9A 3BFKA 4UCXA 5E8JA 1LLDA 1VYUA 4A8JB 4BEWA 4AVYA 2GYYA 3QK7A 2D3TA 2XBLA 1F38A 5T64A 1PYGA 3K1YA 3LWDA 4ZOBA 3G1TA 3DO8A 2IU3A 5JS7A 3GAFA 4ZYYA 2YV5A 2V5VA 1DRVA 4OYRA 4X6LA 4FDLA 2MSEB 3SWWA 2EZ9A 1HI9A 2XZPA 3FLMA 4NC9A 5BQOA 3ZDYB 4CQJA 2PJRA 5F3WB 3JVUA 5GY7A 2F8SA 3D7MA 4UOEA 5D5HA 4D7AA 1C1XB 2CEKA 3L18A 4GBJA 4JSRA 2AT1A 4JCCA 4LBVA 3GDGA 1PS9A 3PXDA 1I7NA 4UJ5A 1JT2A 5EJEA 2JH9A 3LIIA 1JDTA 2I66A 3T7IA 4FS3A 1G7CA 3T7RA 4ESHA 1VE7A 2PCLA 2AFHE 3WWPA 3DHVA 1FDVA 2CB0A 4FDVA 2V7VA 3VSEA 1E9FA 2IPOA 2ET6A 2FWPA 4R5MA 3TQQA 3ZDBA 4ZMRA 2HPHA 2V7PA 3T3GA 1F2UB 2I7XA 3NAMA 3GLSA 1B0UA 3EXG2 3JZIA 2DPHA 2W0MA 4DLUA 1E9EA 1K4YA 2WJJA 3FMVA 4OMFG 3V6MA 3V7FA 5I7VA 1T0IA 1L8XA 2DFLA 3IUEA 1NSYA 2DFNA 5DXAA 5EIWA 3DE4X 4EM6A 1F9AA 1MEOA 1U3DA 2IZZA 2XIJA 3REQA 2G5PA 3U9LA 4KYIB 1PAUA 5E6UA 3DBHA 4DMCA 4ZGGA 4JJAA 5M3BA 4XJVA 2XYVA 5CEEA 3QLVC 4MLPA 1FFBA 4NCBA 1AKYA 1O4WA 2R6HA 4MRAA 5B6PA 2ZP1A 4B3GA 4BB9A 1EE9A 1P0MA 1VHQA 4E31A 2YJTD 2XUHA 3Q15C 4KU4A 1Q0QA 4X6UA 3ZS8A 2HU8A 3I2JA 3B1JA 4G1VA 1C7EA 4PRZA 1HRKA 3EOBI 2DWOA 1U8EA 2RHMA 1GTMA 3H75A 4O8CA 4AZSA 3ST7A 1VI6A 2MU1A 3UJPA 4ZZIA 3QWFA 2MSNA 3P0FA 3QEMA 4H6XA 3TNFA 3WHKA 1UDBA 4YCSA 3CX3A 1PZMA 3EGCA 5JAHA 1WWKA 1IYZA 1WUHS 2FK7A 4MV0A 2Q5HA 1HOTA 3K0CC 3O7MA 1UZNA 3A6ZA 3H5VA 4NULA 1I4OA 5K4HA 1W5EA 4M0LA 1XVAA 1ADJA 3NGXA 3L7AA 5FF9A 2JJYA 2NQ8A 3IBTA 3U56A 3QYFA 5DVZA 5CPBA 2Q3BA 4XDGA 7REQA 5U9CA 1Z25A 2MDTA 1H9CA 2MYNA 2WWFA 1CZNA 3Q4GA 4L5YA 2R0QC 1Z7EA 1MDFA 2Y1EA 2OQIA 1M6NA 2PZGA 1S2GA 2XCUA 3AUUA 4CMCA 1L5KA 1U0JA 1NZFA 4JYMA 2PHZA 5TGTA 1WA5A 4UE6A 3G8AA 3KSMA 4PSKA 4KJZA 3R3JA 2Q7XA 3F98A 1JDBC 3MGAA 4QNRA 1VE1A 4TWAA 3IEIA 3T3PB 3W1VA 1NWHA 1VP3A 4YDSA 1ODSA 3RJTA 3V7YA 2YHUA 3RUFA 3SMVA 1NDHA 4RMGA 4YMVA 1UWVA 1XZLA 4GMDA 5AW8A 4QBHA 1ISMA 4BNLA 2E55A 4WLFA 5B1IA 2DWUA 4BNZA 3WK4A 1W581 3GLIE 1FFSA 4AX4A 5LWHA 2WWHA 2Q0HA 2HO5A 1AH2A 2XXBA 3U3ZA 5DI3A 1R66A 3PSAA 5MGBA 3L0YA 3HSYA 4RANA 4FYHA 2C94A 4B7XA 1A9ZA 2PE5A 4P0QB 2RG1A 3E53A 2CDRA 2IXGA 1SN7A 4DA7A 3QVXA 2FK8A 1U80A 2OZEA 4EVSA 1Q1NA 4MQLA 5ER9A 4AD8A 5JBQA 2B37A 4UM9D 2ZYAA 1L4BA 2C98A 3KB2A 5J1TB 5NLLA 1FP4B 2O7RA 3OPNA 4FEYA 1U5CA 4QDZA 3EPKA 1RPAA 1GNQA 1I2MA 1WY5A 2H0QA 2Z1NA 2Q3EA 4RK0A 2PJUA 4CTKA 4QNMA 3QNWA 2H1LA 4GLJA 4FD3A 1I0IA 1ZEJA 4DILA 3W1WA 2B5WA 2CJWA 4G1FA 1Z0KA 4X63A 5FPSA 3O75A 4NPHA 3IBSA 3A31A 5IVKA 1QE5A 4UVGA 2O2DA 1NGSA 1GARA 1YR3A 1I7LA 1RFGE 2AR9A 2R8PA 1CUWA 4KQJA 2QVGA 1YS4A 4KXYA 1QKJA 4KBYA 3GA5A 3GHHA 3EULA 3OCXA 1FX0B 3HYNA 5JS6A 4NECA 5LZ2A 2C8KA 3H11B 1FUEA 2RAFA 2FN3A 3THYA 2B4TO 4YQZA 3WJ7A 1RHJA 3HY4A 1ND5A 3ASZA 3IP6A 3BFXA 1OH8A 5ED0A 3V7WA 3QUQA 3TSAA 3X1JA 1F6WA 1GGHA 4LDAA 5I6DA 1HNXB 2C88A 1K88A 5ELLA 1E94E 4IF4A 4IEFB 4D0GA 3S7TA 3M1IA 4I1RA 4YMGA 5KMGB 1P91A 1U3VA 2C0PA 2R7AA 1G7SA 1GNSA 4PC6A 2P3QA 2UZIR 3P9IA 4IAOA 3VO8A 4YBRA 5JMPA 2XRYA 5KYUA 4AK9A 1X70A 4WOBA 2DU8A 3DC7A 2G71A 2PN1A 3VOBA 1TEVA 3KT6A 3V4FA 1IFXA 2X4DA 3V33A 1Z9BA 2W48A 3NJRA 4IIJB 4A3SA 4X65B 1JYSA 4BTEA 2EXXA 3E2PA 3N2ZB 4Q1DA 1M1YB 5FWXB 1Z5PA 1OCEA 3WIEA 4X1YA 4ZICA 4PQEA 3GDOA 1M1ZA 5AM2A 4BLSA 2D0OB 4K6FA 4X6XA 2XCRB 2YHIA 3PEWA 3BEDA 4Q1FA 4B6RA 4HFNA 2RHTA 5IZCC 1QWOA 4GM4A 4UDNA 3FUTA 3LGXA 3L7OA 2JFQA 5B4UA 1GGNA 4OHVA 5FTWA 3K71B 2PKXA 3KOYA 5K09A 2KW5A 2WF6A 4MCAA 1X7YB 2XJ9A 4TKUA 3ZGYA 1XHEA 3N2GB 4HAYA 4OJKA 3H8VA 3GFFA 5E1OA 4IUDS 3OTHA 1Y89A 3KU4A 3MVEA 4HAIA 1VSTA 5CP8A 4W1PA 5DT2A 3SHOA 1UJ4A 5DM70 3RT9A 1I6MA 2YC4C 3GD7A 4X8LA 5TQJA 2PXHA 2X23A 5K4GA 3T1HB 2PWPA 1Z35A 3O8LA 5CT9A 4LJRA 4HN2A 2G08A 5G41A 1NDQA 1XTKA 2ON6A 4XVRA 3HO8A 4MGEA 3ZI7A 2A78A 1T2NA 2IWHA 4IDQA 1QH8B 2NO4A 1OB2A 4IFTA 4PLWA 3HJBA 2Q3MA 5L7YA 3PC2A 4EGSA 4AY6A 5BQPA 3IDAA 3OZXA 4DMMA 3GL9A 3I45A 2DQZA 4PC2A 1EUCB 1IBKB 4UHEA 1B74A 1Y6FA 1OFGA 1SOMA 3CR7A 4UTVA 2FXVA 3B5IA 4BN5A 2ZPTX 4R0MA 5GVSA 2ADOA 5JDCC 1HG0A 1Q19A 3EVTA 3EQ6A 4FQ8A 3B6EA 4MYTA 3T5TA 2DKFA 4TS9A 1VZ2A 3V42A 1OH6A 4UQPA 1GAQA 5HKOA 5DSTA 3JQAB 5TPWB 3DZKA 3HKCA 5C8YF 3CLKA 4S2EA 5SY4A 3RGGA 1TZMA 4N3GA 3USCS 2JD2A 1DC5A 1JHDA 2A4KA 2WFLA 4HQ0A 2BT4A 3MJVA 5LOVF 1IXKA 1PJZA 5JCOA 2J6BA 2VDNB 2AA3A 1QFYA 1XF1A 3DO5A 4GPEA 4TS4A 3WLEA 3CWCA 1HEUA 2EX0A 2CYBA 4QUKA 4RELA 5FI5A 1JXQA 2NUTB 1DAIA 1OI2A 5B7PA 5K3FB 1V41E 3IJEB 3B9BA 3ZK9A 3BWDD 2RIRA 4BFTA 4ER5A 4M3NA 2VP9A 4G5QA 1L4KA 3ZK7A 4J07A 2WF8A 5C3MA 4JIMA 1YQUA 2IH2A 2P2LA 3BE6A 3FCSB 3DTVB 4OL9A 5T3YA 3MJDA 3AVUA 2CVOA 1QH0A 3QVVA 4AW9A 5I4IA 4BASA 4Q02A 3U48A 1PJBA 4M86A 4PG5A 4RV4A 1N1GA 2J3MA 3C3JA 3N0WA 4H1HA 1KDZA 2ZSUA 3I37X 3M9LA 4L95C 5KKCA 3QPUA 2D0IA 4QGBA 5HK9A 2QRPA 3OEWA 1V7CA 3L7IA 4D0SA 3L7JA 2VDJA 4FXPA 1REQB 1SURA 1VGRA 1KZ6A 3TOVA 2F7SA 3ZQ6A 1N4DA 2HGSA 2FSGA 2ZBQA 3BJRA 4Q4CA 4HB2A 4U8HA 1J23A 3F74A 3PF8A 2W2KB 1UBCA 2X7XA 2A0KA 4AZWA 3OC6A 4RV5A 5ESWA 3D4PA 4WN9B 4ERXA 5CA0B 1KPHA 2GAAA 2Q21A 2OSVA 3ZY2A 4TVSA 5CM9C 4M7RA 2J48A 1PGNA 4KB5A 4KLNA 1XNRB 3ABRB 4LTMA 3VYUB 4M1OA 3QU7A 1M83A 4DJDC 3TZEA 3RU9A 3WICA 3DUWA 4K0RA 2VUTA 5JXHA 1I7QB 3PGXA 1JHUA 2PIAA 4EVQA 1YR7A 3NBZC 2O5CA 2R4QA 2PWYA 3WWOA 4B3SB 1V16A 1NXSA 1T29A 4GF5A 2O8EA 1H5UA 2IOFK 1PSWA 4TTTS 4LGMA 2AXPA 3RS7A 1QJ4A 3V6LA 1X1TA 3WLIA 1ZN8A 4A0SA 4C4OA 5DGHA 3RW9A 1LBHA 4YT4A 3N75A 4JLSA 3WYFA 2PH7A 1K1EA 4AG3A 1V7ZA 3G17A 4L27A 4R2HA 2P68A 3H3XA 2KWIA 2WSYB 2H1IA 4JHLA 2ZT6A 5G1PA 5K8TA 1RRCA 2C4UA 4RD0A 5I4KA 1BDJA 2WMOB 4QC2A 2VYQA 3PE4A 1L7DA 3QLEA 4PZYA 4X1YB 3TI7A 4YRSA 5K7SA 5KDOA 1T9DA 2PWAA 4PHCA 1IJKA 2ZSDA 4BVBA 3AX6A 1B8UA 4AT1A 1DDIA 5K0FA 2QRHA 2IDZA 5EFZA 2D1YA 1AF4A 1ZM3A 4JNCA 1YZTA 4QJIA 1QAQA 1XZCA 2CFOA 3IVGA 4I55A 4EUHA 4NBSA 1QV9A 4MAMA 2HQBA 2GT1A 1PFGA 2ORVA 1JIKA 3IAM6 4IUCS 2PPVA 1IN5A 5FTJA 3L2OB 2EFJA 5JW6A 3LVBA 1ZKMA 5JNLA 4TVOA 3W9SA 4UTPA 1TM2A 4ZDWA 4LUCA 1IB6A 3SQDA 2OFOA 5EQFA 3K6JA 3GRKA 1SFRA 1ZCJA 5CUQA 4F06A 2GJ4A 1N3LA 3DJYA 2EF1A 3CSSA 2YXPX 3B1KA 2IL1A 4GAEA 3TTYA 3VC1A 4OA8A 1Y3FE 1ZH0A 3ETGA 4IIFA 5GPBA 2Z6VA 1OGYA 2QJFA 2WDZA 1ZOOA 4L8LA 2YYSA 3A1FA 6REQA 3QW2A 2R65A 4DMHA 1BCRB 4Q1CA 2JD1A 3TKAA 3A2KA 1SB8A 1RTKA 3H9EO 4Z54A 3R0XA 4GHWA 4PX5A 2JCSA 4BQQA 4CEJA 4M38A 3WNZA 2BI8A 1GQOA 1LPSA 2G1UA 3TD6A 2GCEA 1KI4A 1ONSA 1MRSA 1PS8A 1A4UA 1QV7A 2QRZA 3H83A 4MGHA 2J9GA 3R5FA 5PGMA 2X86A 4B44A 2OBYA 3U19A 3VNVA 3ROFA 3PRJA 3SBDA 1SCUA 3AR4A 4ZC8A 1M3SA 4NS1A 3AOGA 3LUHA 1XEXA 5ARCA 3M1YA 4DUGA 1HFWA 1U5BB 4H7DA 1TU3A 1HXHA 4ZT4A 2J3JA 4KN9S 5GGXA 3VX3A 3GCDA 4TYNA 3ERCA 3PGVA 1UQTA 3MMXA 3JQCA 1WUTA 2ZI4A 1A4RA 2AI3A 3CKKA 3KKOA 4RGBA 4E5MA 3ML1A 5D8DA 3KQKA 4KQHA