3UATA

Guanylate kinase domains of the maguk family scaffold proteins as specific phospho-protein binding modules
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
283
structure length
276
Chain Sequence
SLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 75
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3uatA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3uatA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uatA02
3WNDA 3L0PA 3QWYA 1G291 1G2BA 1SZPA 4DB4A 3L0SA 3RAPR 3ZVRA 3U3RA 1G8YA 4M1YA 2P6RA 2YINC 4RTXA 4Q5IA 4TYYA 1NLZA 2QL6A 1ETUA 1NG1A 2QN6A 3BORA 5DN6A 3AUYA 4GNKA 5TV2A 4AIIA 4BLQA 4YC7A 1BH2A 1MO5A 4W5JA 1X6GA 4C0KA 1E0KA 1ESNA 4JKIA 1F6BA 3C15C 1W0KA 4M2LA 2W10A 1SHZA 4CT5A 5K8LA 1XJQA 1KO4A 1N3BA 4BLSA 3HWSA 3GPLA 1WX6A 2O9VA 2WV9A 2EFHB 3M0UA 2JS2A 1UJ0A 4Y0AA 2FSFA 2Q3MA 4LJAA 1E9SA 4DRZA 1JR3A 1T3HA 2ZAOA 2XEXA 1ZW6A 2BZYA 1R0YA 2QAGB 4B3CA 3MWLA 2HDNB 3B8HA 5HKKD 3B82A 4Q19A 4PZLA 4LRWA 3DM9B 2C8VA 2DMOA 1L2TA 3R20A 4D25A 2RF0A 1L4YA 2Q9BA 4DEXA 4EJSB 3IPXA 4TQUS 3QKRB 4JPBW 2GDJA 2DRKA 1Q44A 2J6KA 4P31A 1EX7A 3BAFA 2R6AA 2IXEA 2QM7A 1HSQA 1IJEA 2OFOA 3CH4B 4A0GA 5FUXA 2WWYA 4LYFA 2J0UA 1QHHA 4DLXA 2QORA 3I61A 1YHNA 1S1MA 3UK6A 1SHFA 2VQSA 4OMMA 2VA8A 4URYR 4C7OB 1NBMD 1G3UA 1G9XA 2CCJA 2EQIA 4CT4B 3UATA 1Z0JA 5JWHA 2KWIA 5GJVB 4B3FX 2XOKD 1AIPA 2C5LA 1KSJA 2PCJA 2ERYA 4B3XA 4HXJA 3DZDA 1CJUC 4LJYA 1YZLA 3KUDA 4DCVA 2H17A 1HY3A 2D7CA 4ZKEA 1GNQA 2RGDA 2G1KA 1ZBJA 2QPTA 2LMJA 2ORIA 2HCJB 2O5VA 5B2ZA 4OK6A 1F2UB 2QRNA 2VO1A 3HPRA 3OEHA 3PQCA 1H8KA 4WIAA 1E2GA 2OUKA 1OXVA 2ZXUA 2FEIA 3U7EB 2M0YA 1VHTA 3BE4A 1FW6A 3QKTA 1IY1A 1ELOA 1Q12A 2KSQA 3O8BA 1J8YF 4GOJA 2J59A 2J9RA 1QWEA 4NHOA 3GEHA 5J40A 1PJRA 4JLNA 1WDXA 1JEEA 1NN1A 1XD2B 1Z5ZA 3EZ7A 2GNCA 4EPVA 5CB8A 4JBYA 1IONA 4ZDJA 2DF6A 2ZSBA 3C8UA 2NPFA 2PJZA 4XH9B 2GEDA 4G0NA 4LV6A 3BH6A 2FN4A 4C2UA 4OQMA 1KO5A 3RC8A 2ZRAA 3EGUA 2K9GA 5K8UA 4WZBE 2XJ4A 1CJTC 2DCUA 1GKIA 2B8TA 3K9NA 2GILA 2I1QA 3BXZA 3CPJB 4TLEA 2F2VA 1K9AA 1OW3B 4JL8A 5JCZA 3TSWA 1VKJA 1GL7A 3T1VA 3G0HA 1NL3A 3GLGE 3Q5EA 1I2MA 3EXAA 2YT6A 4UNNA 4LHXA 2RNAA 4BFUA 1VG1A 4DHEA 3B9QA 2LCFA 3C4JA 3SE0A 1E99A 2BBTA 1VCMA 3GJ0A 2H5EA 3DO6A 4UXIA 3OEHD 3MWYW 2GTPA 2DE0X 2A08A 2B7CA 2XNDA 1KI6B 3EHRA 1ZSGA 3HJNA 4QM6A 2C0IA 1XRJA 3LXRA 2E87A 1N6PA 2Y8EA 1Q20A 2EYXA 1YJ5A 4HDCA 1D2NA 1I4LD 3GLHA 4N3NA 2GAOA 3SYNA 2ZM5A 1US8B 1GKYA 1J99A 2BZXA 2OBLA 2GZAA 4R0KA 3SBDA 5IHPA 4AKEA 4CF7A 2DJQA 3P1JA 2DL3A 4B73A 3SYKA 3I3SR 3X1DA 4C2TA 1Z3IX 3QXSA 2HYIC 4JBXA 1BO6A 4JBWA 3TLXA 3B7GA 1FNNA 3PE0A 2DR3A 4C0HA 1QLYA 4DCUA 2EYYA 4XVQA 5JS8A 5LPNA 4ITRC 3QPVA 5J4HA 2F9MA 4DLYA 4IVPA 5KNDA 5FR1A 4MUBA 2HCKA 3UMFA 2MMCA 2ONJA 2IF0A 2AK5A 3WYAA 2PNIA 2ZSEA 3TK1A 5CITA 3UKDA 3KQHA 2GK7A 4U00A 1RRCA 1XEXB 3B1ZA 3SQXA 3QKRA 4TWZA 1Z2CA 4Y92A 2IIMA 3ASYA 3ADBA 1E2LA 2V55B 1U81A 1TF2A 4MKHA 1CF4A 4PPGA 1GFDA 1NY6A 2OLJA 1AWOA 1KYIA 4ZDKA 2O0JA 4CGZA 2ZRCA 2E1RA 1N6IA 2OILA 3TSOA 2DA9A 2CVFA 1XFAA 3QENA 4RTZA 3CLVA 1ZD1A 2GXUA 2DFLA 4AURA 1XNJA 3BK7A 4DSUA 4EFNA 2CT4A 4L16A 2QP9X 1UG1A 1EWRA 1E2PA 1E2HA 1W48A 1R5NA 1KSGA 2ABLA 1W4BA 3T1OA 3MFYA 2GETA 2WWWA 4DSOA 1C9KA 2AN9A 3T06B 3GFTA 3MAAC 1IY2A 4PZYA 2JA1A 4P32A 2JW4A 2RQVA 3AF0A 2LP5A 2G3YA 2VBCA 2IYRA 2WKQA 1UECA 3IEUA 4POAA 1K8RA 3KQLA 2IUSA 1SKYE 2W6JA 2BEJA 1G5PA 3H1TA 1A0NB 4LWZA 1DO2A 1M7HA 2QMUA 4Y0VA 4PC2A 4A15A 2DY1A 4QBIA 2D8JA 1JAIA 1SRLA 3LVRE 4LK2A 5DHAA 3EARA 1UEIA 3P32A 5BN5A 4RUGA 2RGNA 2OCPA 2REBA 4L9WA 4F38A 1FUKA 1N0WA 3J81k 3PEWA 3FMIA 1OXXK 2J7KA 2EGAA 1NMZA 2PMDA 3MMPA 5L3VA 2HEIA 4QXAA 3W90A 4RKEA 1WDTA 3K0SA 1N5ZA 4UXJA 2XZLA 2O8CA 4Q9JA 2OI3A 2CEAA 2IXFA 4LJ7A 5CLQA 2GJ9A 3VX3A 5IK2D 2Z83A 5FPSA 3M0QA 4V0OA 1S9DA 3W6OA 4F4JA 1YZUA 4QOSA 3RANA 3VU9A 3U7FB 3PV0A 3BFKA 4R7ZA 3NC1C 4UNSA 1JAHA 2AL7A 3K8YA 2ZRHA 4M53A 4DEYA 1SXJE 2AD5A 2RAPA 1XJCA 2GVDC 1KAOA 4XWOA 4C0BA 5GJVC 2V6JA 1E79D 3CW2A 2R2AA 3RRYA 3LWNA 5JSZA 5EP4A 4MA4A 1XX6A 4M4ZA 2ZTSA 3I32A 4N1AA 4V0KA 1NVVR 1V43A 5DE3A 2W6ID 4FINA 5FH9A 4KFUA 3ZL7C 3KB2A 3ZZTA 2ZRFA 1EFUA 2GF9A 4G1UC 2JIZD 2DILA 3SEAA 1MABA 4Q1DA 5JZVA 1EFTA 1W5SA 3AKEA 3IDQA 4FCTA 2EFEB 2ORWA 3VKHA 4FMCB 3O8RA 2JMAA 2XX3A 3MUFA 1S8FA 3R9XA 3DKPA 5AJYA 4LPKA 3WHLA 2NTYC 1K1ZA 5BN3A 3PUWA 2MMGA 4HCKA 1E2DA 2IYYA 3ZH9B 1SKYB 1ODFA 4XIGS 5A0FA 2Z4RA 4DLVA 3RVBA 2EBPA 1G18A 2WWHA 2OCAA 2QZ4A 1IO6A 4MRSA 1N5JA 2A5JA 2G77B 3PEVA 4Z8YA 1NBME 1U9IC 2HXYA 1WLPB 2PT7A 3HU2A 3B2EA 5AUOB 4WAUA 1Y0MA 4A1FA 1A2KC 1Z0FA 1OV3A 3BGWA 3L82B 4Q21A 3TUJC 4ASUA 4CZ2A 2FRWA 2QPAA 2WKRA 3ZDQA 2J05A 3QKUA 1KO1A 4NCHA 1KOFA 1XZPA 1WI7A 5CK4A 2PBRA 1UKYA 2XTZA 4Q02A 4Q4LA 3QEJA 1YN8A 5SZKB 2R6CA 3KX2A 4XVUA 2VVKA 1H8HD 5CDFA 5J4YA 1QHIA 2QE7A 3M0PA 4M1WA 1G5TA 5F3WB 4LHYA 1NVUQ 2A7QA 1WP9A 2IL1A 3QEOA 3W8NA 2ZYWX 1NY5A 1NLYA 1N6NA 1ZP6A 2QENA 1KK3A 1GCQA 2WM9B 2XOKA 3LD9A 4LC0A 4C30A 5D3MB 4DLSA 1KI7A 4A36A 4Q47A 5C2JB 3ZVMA 2XB2A 1C1YA 2WOJA 3I1FA 3WMFA 3PJRA 2O8FB 5JRZA 4Z51A 3FOZA 4QRHA 4Q9LA 1FX0A 4PZZA 2HT1A 5ANRB 1OF1A 2FSHA 4XD7A 5KDOA 4ZNXA 1TQ6A 4LHZA 2QP4A 4CW7A 4K46A 2CE7A 1U0JA 5CYPA 3H4MA 4HUTA 3PR1A 5L3SA 1A4RA 3BJIC 2QQ0A 5JJIA 1IBRA 1CULC 4X8LA 3AVQA 4NKRA 3H86A 2CUBA 2FSGA 1QHSA 2VHQA 4Q9HA 3A36A 4DKXA 4OK5A 5JHGB 1G7TA 3CNNA 2X2EA 1AM4D 2EGCA 3EG2A 1XPUA 1A7JA 2F43B 2PEYA 2FFQA 4M9QA 2F2XA 1BB9A 1BOFA 5I11A 2OXRA 3LW7A 1UPTA 2KT1A 2DFTA 1FNMA 1JPNA 3I72A 1BYUA 5DO9A 2JCSA 4HAUA 3W6NA 2JLYA 2D4HA 4LC1A 1P72A 4PHGA 4RD3A 2BBOA 1X3SA 4A4DA 4D4KA 1P3JA 2VP2A 1Z29A 2PLRA 1EFCA 1P75A 1KJWA 3VS6A 2WPDD 1XXHB 3RHFA 4Z8AA 1S1NA 5D3MA 3QXXA 5DYGA 2FG0A 1VCOA 2WMOB 3EX7C 2IYWA 4OQFA 4OQXA 4TL8A 3EG0A 2ZRBA 4QHSA 1LB1B 1FP6A 2AKLA 3LDAA 1HH4A 2ZU0C 4MGZR 4E07A 5C4MA 1SVWA 2W0MA 1FUUA 5KO2A 3U44B 3LO5A 5FWBA 2VSOA 2IW3A 4C0SA 2VHCA 2HYDA 3TVDA 4D4LA 3CWQA 3SN6A 2ZRNA 1G6HA 1HE1C 1Z06A 2FGJA 1XMSA 4EFLA 1ZAKA 2D3WA 1GRIA 1DAMA 3GLIE 1M3CA 3D8BA 2IK8A 5K8TA 4B43A 3F0TA 2J0QA 2R9VA 1HYQA 4AYTA 2HUPA 4B6EA 1UJYA 1HT2E 4M9ZA 4TLDA 2AKKA 2G6FX 1G8PA 3IGFA 4KJZA 4DDWA 4HVVA 2P0EA 3WP1B 1T91A 2ECKA 2XGJA 2D7DA 1I07A 3CM0A 5I22A 2GZHA 2OZEA 1PRLC 1CJVC 4GBMA 4JLPA 4JSYA 4DIDA 4DUGD 5FOTA 1KY3A 4Q4HB 5H68A 1J7KA 3ICQB 4CC4B 4EJSA 3SJBA 4PSKA 4C9BA 3F8TA 3ND8A 4HZIA 3GD7A 4G5RA 2AZVA 1HJDA 2ZU6A 1X6VA 4Q1BA 2GKSA 4LDJA 4NYMR 2QROA 3WP0A 3NVAA 2GQIA 4E22A 3T15A 3LAWA 3VS4A 3VR6A 3WY9A 2WJIA 4LHWA 2VTKA 4AC9A 1OH7A 1Q57A 2YUNA 1JECA 3H0HA 1KDOA 4I1UA 4Q4JA 3GLHB 4PC3A 4OJKA 3NGPA 3THXB 4MRVA 4RTYA 1ZUKA 2Q9AA 4OL0A 5GVSA 1FMKA 1XXHA 2BV3A 1AJEA 2WSSD 4FSSA 4MH0R 2PX3A 4Q7MB 4BLTA 1X2KA 1JNYA 4J0QA 1W1FA 2ANBA 5G40A 5IXFA 4KITB 2GA8A 5AJWA 4B2LA 3SEMA 4JLDA 3DDCA 2X8AA 1DG3A 2ZVPX 4EIKA 4D8DA 2BMFA 3AP2A 1F5NA 3LA6A 2QMHA 4NP6A 2XTNA 4RSGA 1R7RA 4D6PA 4M1MA 1MO3A 2RQTA 1UTIA 2OJ2A 2JLUA 4LJ8A 3SYLA 4LBWA 2EFGA 3FKQA 3AB3A 4JLBA 1ZUIA 2FG5A 1XDBA 4NCIA 2NZJA 2V4ZA 1MT0A 2OFWA 4KBGA 4RZ3A 4MRRA 2J6OA 4WZAE 2GAAA 5UKDA 3W5IA 3DVLA 4GZLA 2DNUA 3BRWD 4F14A 1Z0DA 4KI0A 1SKQA 2WWXA 1P9WA 3AVXA 1Q1QA 4FD2A 1UKVY 1SXJD 1N6OA 2KBFA 2WMNB 3TNFA 2F55A 3AP3A 1W2HA 1YWPA 1XTRA 3NMZC 1ZNYA 2F6RA 1KZ7B 2KRSA 2F9LA 2R44A 5L3QA 2CL7X 1SXJB 2JIZA 1OHHA 1KZGB 4BLRA 3R9IA 4B3BA 2RN8A 2GJ8A 3CRQA 3D31A 1E2IA 3OIYA 3QE0A 4P4UA 5DHFA 4ZIRA 2KI5A 3U7HB 1M74A 4HVWA 2YKGA 1G20E 1X6BA 5KSYA 4Q01A 3ADCA 4OHXA 4QHYA 5EXPA 1W5TA 2OM2A 3NDBB 1ZUNB 2QG6A 1ZM7A 2XTMA 3SS8A 2ZRKA 3KFVA 5G53C 3TQFA 1HD3A 2VF8A 1PLJA 2SEMA 2IYVA 2DYBA 3L0OA 4F91B 4JLAA 4A92A 1VYVA 3E1SA 3AKCA 3B6EA 4D0GA 4QNRA 1G3IA 3NPFA 4Z88A 1EK0A 1X8JA 1UGVA 2IEYA 1N6LA 2J46A 3QPUA 3E5HA 1FQKA 2GCOB 4ACAA 2NPIA 2BMEA 2HT6A 3GEIA 1KO7A 1NIPA 3U3MA 1AZEA 3KQKA 2BWJA 3OE7A 3QWXX 4UXHA 3SDZA 2V1RA 1W0KD 3QVVA 5GADl 4KU4A 3FHTA 4TZ0A 2AWNA 1H65A 5KNCA 3IHLA 3M1IA 2Q3FA 3U3JA 1QF9A 3W6PA 4ACBA 2YJTD 3FJ5A 2ATVA 3NH9A 2GJAA 5B58C 2Z6VA 5EP3A 3NHBA 5EP1A 4EPRA 1II0A 4BZQA 1YR6A 2BMJA 3B9PA 3R8CA 1ZMXA 2JAQA 4BRUA 3KXIA 5JMTA 3KQNA 2XSZD 3TUIC 3RWMB 2B7BA 3NC0C 3ND9A 5KDDA 2FA9A 1BU1A 1CIPA 1U8AA 1KMQA 3FTQA 1LVGA 3RNLA 1TF5A 3C5CA 1CJKC 2G0TA 2OSBA 2I0NA 1TQDA 3H84A 4JJKA 2ZYUX 5EUQB 2R65A 3GFOA 5KUTA 2QDLA 4ERNA 3BOSA 3EG3A 1UDXA 2OG2A 4GOXA 4M4SA 2NGRA 4XTCS 3V4FA 1X8KA 3RRZA 1X69A 2ECZA 3QQ5A 4EKDA 3N2EA 4JL6A 1OB5A 2QT0A 4PO9A 3W3ZB 3O47A 3QXJA 1R8QA 3GLIB 1QCFA 2B21A 1VG9B 2LKDA 3CPHA 4Q66C 4LY6A 4QGGA 5M04A 2OEPA 3B1WA 3KKNA 3ZIAD 3UA6A 1KKLA 3NH6A 1GAJA 1PUIA 2J1LA 4MYTA 2O8EA 1OXTA 2ZS7A 3MG9A 4PAQA 4RKFA 5FOSA 4ZDIA 2D2EA 3P20A 1KJZA 4W5WA 2KGTA 2EU8A 4NYMQ 4CEIA 1Z28A 2Q21A 2JLRA 1OPXA 2GGRA 4FXPA 4KSBA 3W5JA 2RHMA 3G82C 2XXAB 2DBKA 4PO8A 2DWQA 4TT3A 3SFZA 2FPLA 4M9SA 4KYIB 5L3SB 1R5BA 3K09C 1NSFA 4HEJA 4Z8XA 3VAAA 2HSPA 2WKPA 4PSVA 2KRNA 3GP8A 2ZJBA 3S1AA 2A37A 1Z47A 3FDIA 3L43A 2EWWA 4PPQA 1RJ9A 3MRSA 3K9HA 5FUWA 4BE7B 2ZI9A 1X43A 1KI6A 4TSFD 1TNDA 3U6KA 4OMPA 3I35A 4C0JA 5FOXA 1RLQC 2CE2X 1K76A 2IYLD 1BMFA 2D0NA 4J9FA 4Q4JB 5E4FA 3NBZC 3ZS9A 4EPXA 1UHFA 5EE9A 2A28A 4FI3C 4I99A 4IIMA 1CR1A 2PMKA 2NO6A 1AS2A 4P33A 1OYWA 3UANA 3DZ8A 2N46A 3DOFA 4Q03A 1VDZA 1GCQC 2LWIA 3D7MA 2SRCA 5BYJA 1N0UA 1OYYA 4LUCA 3RDPA 2OLKA 2CJWA 2FF7A 2NWMA 2QBYA 1KY2A 5DISB 4DUGA 4DDVA 1EFRA 5ELXA 4UJ5A 5HTKA 2ZI3A 1PRMC 1UBCA 4GSYA 4HB3A 1FQJA 2ZJ2A 2KE5A 3HYTA 3RNJA 2AX4A 2WOOA 1OFUX 2I1VB 2AHOA 1GFCA 4PQFA 1P7CA 3LBIA 3CRMA 5JEEA 2OAP1 4LN2A 4TSFA 4US0R 4W7SA 1MOZA 1SEMA 4I81A 2WJVA 4YXWD 2ZUBA 3VHXA 1ZC3A 4R98A 1OV4A 3AVOA 1JB1A 1D2EA 2J6FA 4CC3A 2WSMA 3IKJA 1BBZA 4RTVA 2D74A 1XTQA 1IM2A 1N5KA 4G5OA 3SHWA 1QKWA 1OFHA 1CR2A 2J06A 1NMXA 3TBKA 1NVXQ 4TMVA 4ZV4A 5DLQC 4DCTA 3PVSA 3KJGA 4HAZA 2JJ2D 3AF4A 3M4YA 1CSKA 2IHBA 4OBEA 1ABQA 2WHXA 1GRRA 2EWVA 3PUVA 1I1JA 4M1TA 1BS1A 3W34A 2KROA 4BLOA 2G1JA 2A5GA 3HDTA 5K8IA 1WYXA 1T4GA 4KAXA 2EFCB 5JHHB 1RE0A 4W9MC 2QM8A 3CF2A 3EIHA 3I4LA 2OXCA 3HU1A 5FL3A 4E03A 2CSIA 2VYFA 4PPFA 1Z6GA 2PCLA 1MUZA 3OIWA 5C46F 1R0ZA 2CUDA 2CHGA 3N70A 4DJTA 2QTHA 1SQ5A 5FOUA 3NEYA 3PEUA 2FFHA 4DZZA 2JJ1A 2KB0A 1JXMA 5AWFC 1GWNA 4QM7A 2F1HA 1OH5A 2WSSA 3CR7A 2IYQA 1YP5A 2OAWA 1II9A 2FOLA 2XZOA 2F1IA 4O2RA 4AFUC 4KBFA 3AVWA 3K0EA 4Q1CA 4PX9A 2JJ2A 4V0MA 1SSHA 3M0RA 1KIMA 1NNEA 4V0LA 1KHTA 3ZVNA 1NMYA 3O5ZA 2NQ2C 1R8SA 1IN5A 1LFDB 2LJ3A 4A6XA 2JTEA 2BCGY 3FPAA 4BASA 3UF4A 1NKTA 1XXHE 1UBEA 1SULA 2RB4A 3BS4A 3NDPA 3AVTA 3QIAA 2W6JD 1CLUA 4OHVA 2ZJYA 2RCNA 5HKKA 1UEJA 3WYGA 2Z0MA 3FHOA 3QSYA 1UDLA 2SHKA 3HP1A 4RZ2A 5FTJA 3NBXX 4HLDA 4JJCA 4IOMA 2VLIA 4QJ4A 1RLPC 1W0JA 1EFNA 1H92A 3N5CA 3P26A 3GJ6A 4ZPXA 4MUAA 2BKUA 4CEJA 1SVSA 1XCPA 4NDZA 4KYUA 1E2FA 1S96A 2BIFA 2WBLC 1CR4A 3FKSA 1GVNB 1M1YE 3SJAA 3UG6A 4BRWA 5EXSA 1TEVA 4BECA 1ZYUA 2W2TA 5JJKA 5FTMA 1Q1ZA 4HLCA 4NCNA 4QBGB 4WXRA 3K70B 4LCBA 4QGAA 4ESHA 2IHYA 1NBMA 3KKMA 2BBWA 2ZS9A 2KXCA 1JALA 4RTWA 1GM5A 2XSZA 1U8YA 2KBEA 3FMOB 4NL4H 5FBQB 4TMZA 1NP6A 2KR3A 1AN0A 4MITA 5H70A 2DX1A 4X8HA 4GOKA 5IHKA 4LHVA 4FWTA 1XEWX 2PLFA 5KTYA 5KDLA 1QHXA 2CK3A 1NN5A 4EAQA 2YOGA 3KUCA 4BFWA 3CF6R 4XSHA 4ZDWA 4BUJA 4K11A 3AUXA 4MGYR 4OJQA 1TEXA 2OHFA 2VHTA 3IPYA 1LV7A 3WRYC 3EW9A 4ABYA 5HCKA 1WQ1R 4YDHB 1UF9A 2OBNA 2J41A 1OH8A 4A2PA 5FTKA 2PZ1A 4DLUA 3VR2A 1NG9A 4D80A 1E69A 4TLAA 2P65A 2ESWA 3KJIA 5KSOA 2HJVA 2DBYA 3CRW1 4LJ9A 1RFLA 4Q4HA 5IF9A 1G7CA 2IEZA 1QVRA 4N0EA 2GXAA 2M51A 3VTKA 4QBHA 1YRBA 1UFFA 1ZCAA 2ROLA 1CKBA 4IW3B 4DT1A 1LNZA 5JSZB 4JYCA 1W70A 1K5DA 2AFIE 3CNOA 1XPOA 1A2BA 2LCSA 1FZQA 4RZUA 1AVZC 3R8FA 1OIVA 2ZUCA 2WTUA 1G83A 2UZ3A 3ZGXA 3A8TA 2IYUA 2ODWA 1DE0A 3VHLB 121PA 4BFZA 4H9GA 2KRMA 5HPYB 3AKYA 2JM8A 2RMOA 3NXSA 1LY1A 5BWMA 1QG2A 1WFWA 4JT4A 2IYSA 3A1VA 2BMDA 1YZGA 4AK9A 3LLUA 2FO0A 1BYIA 4S2EA 4XVRA 4MYCA 4JVMA 1DARA 1ZIPA 1ZVQA 2IS6A 5C4GB 1KSWA 1OLOA 1XJ0A 2RQRA 1I0CA 1LF5A 1DPFA 2IYXA 5AUNB 4ZO4A 1GFIA 1KK2A 4FW9A 4EPWA 1Z0IA 2PZFA 2QNRA 2MSCB 4JZ4A 5D3QA 3U4QB 1JU5C 4X8OA 3T1TA 1JBKA 2XAUA 4B35A 4CIDA 4G3XA 4IDOA 4D81A 3VKGA 1SHGA 2DWPA 5E95A 2GCNA 3CRRA 3K0CA 4CEHA 1P73A 1YZNA 3LXXA 3WNBA 4Q7JB 1D9ZA 2KBTA 1NLOC 1YNZA 4PO1A 5LB4A 3DPUA 4IEEA 4PQYA 4RJLA 4TYNA 4OHWA 2QMOA 5EUMA 4A0FA 2OO7A 3RS2A 3ULRB 1UJ2A 4JLJA 3IQLA 1WBDA 3JZMA 1T8UA 2LZ6B 5BQ5A 3WMEA 3B1VA 5HE8A 4MRPA 3REGA 4ARZA 1RW4A 1ZNZA 3BH7A 2REXB 3OZXA 4PANA 4GDFA 4LE9A 2NUZA 3X1YA 3AVUA 2FEMA 2MSDB 2F7SA 5TDHA 2O9SA 5CIWA 2BHRA 1ZINA 3ADKA 3TVTA 3D6TB 3MWJA 3KTAA 2DYKA 3EG5A 3GJ8A 1XD8A 3CH5A 5J4LA 1ZUHA 3ZZUA 1X27A 2Q9CA 3I73A 4HLQB 2D06A 2A78A 1YE8A 1IXRC 2CXXA 4NTZA 1CXZA 3AF3A 1QHYA 2NO7A 1RPZA 2ED0A 3R6NA 4TLBA 1IN8A 2EVWX 2DVJA 1S3SA 5FPHA 2BTTA 2FV8A 1F48A 3LQRA 3T5GA 3M0TA 2GCOA 1KDPA 3EZFA 3W3AA 3AM1A 4GBQA 4EDHA 2DM1A 3QXCA 2FFAA 1KDTA 5CM8B 4R9UC 2PX0A 1M3BA 3TW4A 1H8EA 2CCKA 2ZETA 3OFNA 3Q3JB 1RIFA 1WB9A 2AK2A 2C0OA 2MSEB 1Z6YA 4AG6A 2C04A 2EQBA 2OFXA 4XSGA 5CB6A 1M3AA 1P2VA 1SHKA 2WAXA 1ZIOA 3LY5A 2V1UA 4QHTA 5FPTA 5KSPA 5TXGA 4HAXA 1FOEB 1A5TA 3RS3A 4A2WA 1DAFA 1CRPA 1FYNA 1OPLA 4CEHB 4P4SA 1E2NA 1ZJ6A 4IOJA 3LBHA 1SXJA 1Z07A 4TL6A 2VEDA 1ESMA 2C9OA 4L4UA 2NIPA 3L2OB 4AG2C 4JKYA 4C0AC 1E9FA 1QG4A 5AUQA 2K6DA 2X3XD 4NYJQ 3EASA 4A8JB 1T0HB 2ZRLA 4B33A 2H8HA 4AYWA 1NG2A 2L2PA 4LUEA 2OCYC 5EP2A 821PA 2ZRPA 1XMVA 2ZS8A 3I8XA 3NG1A 4ESVA 4AY2A 1JR3D 4V02A 3MD0A 1M8MA 2EYUA 2GXQA 3AVPA 4Q9KA 3CNLA 3GFPA 1M27C 3A98A 2LQWA 2ONKA 3DL0A 1G3MA 4HAVA 2YUOA 1VIAA 4LX0A 5IXBA 1WXQA 4QNMA 2G88A 4H1UA 4P3YA 1G4UR 2V54A 5C18A 4HB0A 4RFVA 3VQTA 1ZM9A 2O0HA 1UBFA 3MJRA 3SZRA 3PXGA 2JEOA 3QF4B 3QKSB 1R2QA 3NKVA 3OE7D 2WJJA 3WYFA 3HYRA 3L8YA 2HDAA 4Q4AB 2ZJZA 2ZQ5A 4I1SA 1E4YA 5H1YA 4PR0A 4V03A 4OHZA 2FEOA 1DAHA 3RSLA 3KKQA 1AZGB 4DBLC 4M1SA 3K0CC 2YUQA 2O8BB 2F43A 2C78A 5G3YA 3VMFA 1P61B 3JVUA 3U23A 2VHJA 1OSNA 4IOKA 3RS4A 2C2HA 1G6OA 4B3DA 2Q0HA 3IQXA 5HE9A 1IHUA 4Q9IA 5SZIA 2ZI6A 1RKBA 1J70A 5EJEA 5FFMA 4BWYA 3REBB 1A1VA 1ZM4A 1MO4A 1TUDA 4F16A 1P9NA 2NMVA 3A1WA 1U8ZA 3FFAA 2UKDA 1AGRA 1AK2A 2ZSFA 3R7WA 3A6PC 4RFSA 3CQTA 2XJ9A 3THWA 3AVVA 1SVMA 1W0JD 2ZYTX 2FPKA 3OHMA 4GP6A 4ASUD 2V7QD 1AZSC 1KI4A 4B74A 4DIEA 1OKKD 1B0UA 4PC6A 4IOLA 2W58A 3Q5DA 421PA 2LQNA 3JZAA 2R6GA 3QG5A 1PNJA 1GRNA 2A5YB 4GI7A 3THWB 2J7IA 2NO1A 4TZ6A 2CHVA 4UNPA 4AD8A 1EESA 2HXSA 1HEIA 2ZROA 5HZHA 4TTQA 2C0TA 4DCSA 2O8FA 2H18A 4EQ6B 5DI9A 3A58B 5HCNA 5IT5A 2VIIA 4E6RA 2FPDA 3C0CA 1NJFA 3FE2A 1KSFX 4JSTA 5J47A 5FI1B 4FMCF 4AI6A 1LF0A 1F60A 2VP0A 3MGCA 3T34A 2A5FA 2ZEJA 2JLVA 1JR3E 4FMDB 2NOAA 5CDFE 3EG1A 3FHCB 2RQWA 2CNWD 5IHNA 3GJ3A 4AFSC 2AK3A 4AYXA 3IHWA 3MLEA 4AG5A 4ZCMA 2BBSA 4KLNA 3KKPA 3E2IA 3OAAD 4CYMA 3PENA 1IJFA 1NVVQ 5FOWA 2CHQA 3TMKA 4MQBA 4J9DA 1O3YA 2XNSA 1RC8A 1VECA 2IA5A 3I5SA 3BD9A 2BM0A 3CX7A 1OFTA 2PZGA 2EYWA 3FB4A 5DYIA 2FPMA 1XTKA 3RS7A 4KLZA 4HB4A 3T5DA 3S1AB 1P2UA 3ZD7A 3HR7A 2K5UA 4JJDA 3QF7A 5LDDC 2ZSAA 3KFXA 1E2QA 2CMKA 3X1ZA 1ZU4A 4D2IA 3VKWA 3KZ1E 3TKLA 5SZHB 2R6FA 1GDDA 1NLPC 3RRNA 1ZNWA 2Q6TA 4B3GA 4RTUA 2JLQA 1N6RA 2HBWA 2GJKA 4HB2A 5JEDA 1QDEA 1G7RA 3HU3A 4B76A 2QAGA 4LYAA 1ARKA 3DKVA 1XBTA 3U7GA 1GNPA 2CNWA 3FGNA 2O88A 1S0UA 1W47A 1U0HC 1N5IA 1TU4A 2C03A 1UBGA 4PHFA 2DBMA 1N6KA 2YWEA 4DLZA 4HAWA 2AR7A 1DOAA 2FNAA 1DAEA 4LSGA 1VG0B 1FX0B 1T9HA 3IIJA 3PUYA 621PA 4DLTA 1PKSA 5JECA 5KU1A 1Z9QA 2R62A 3ZZ0A 4D0NA 1QHGA 3AEZA 1M2OB 2VHUA 1IQPA 4MYHA 1R4AA 5DSZA 4TTRA 4EFMA 2FJUA 1PZNA 2W83A 2KJQA 4YLGA 2GXSA 5L23A 2V1XA 2F2WA 5F9HA 1L4UA 1JQJC 1U90A 1JJVA 2VF7A 3X1WA 1LCKA 1CEEA 4C7OA 3VX4A 2H16A 1Z6XA 2V6IA 3CRVA 3NIBA 3ZD6A 4D26A 2E9SA 1QVAA 4TT3D 4LV8B 1W4AA 3QJYA 4JVSB 2FE4A 4M21A 2EPDA 2CDNA 3TAUA 5FOVA 3WNCA 2QSZA 1C4OA 2C9CA 1G64A 2L3QA 1MO6A 4K81B 3U2QA 2ZSDA 3UA7A 1W49A 2JM9A 1D9XA 3EZ6A 4PQRA 5P21A 2X19A 3VS1A 3NWJA 1IOZA 3VNVA 1G5RA 4PC7A 2H92A 2MIOA 4RTTA 1TUCA 3CONA 3SFVA 4A6PA 1RRGA 1Z6TA 5A4JA 1UE9A 1Q1EA 4KFTA 5FPKA 1KMHA 3EZ9A 3GJ4A 3MSXA 3OF5A 1OXSC 2V9PA 2FMXA 5L8VA 4X8MA 2FWRA 1SVLA 2REOA 2ZJOA 4LGMA 3IBGA 1U2RA 4XOIA 5FL7D 4DSNA 5HZKA 1E9CA 2GTJA 4P4TA 3B85A 2G9NA 1JJ7A 2EFDB 2QTVB 4CRWB 4I1OA 3I92A 2HEQA 1AGPA 3QY0A 1SPKA 1JI0A 3VS0A 1FMJA 4FCWA 2D62A 1M6NA 1T0JA 4PC1A 4RD0A 5DIFA 4Z89A 1UDWA 1X8LA 3V9PA 1OIXA 2ODEA 4CEJB 4QGFA 2FPFA 1J2JA 3AF2A 5EE3A 1KNXA 5L3QB 1KO8A 2AXNA 2K2MA 3NTUA 4WVFA 4OKSA 4D0LB 4TN1A 3VR1A 3K0AB 2KT8A 1WIEA 4ZIRB 1WA7A 3P4XA 1LW7A 2C9YA 1N2CE 3A1SA 1NN3A 4HSEA 4DWJA 4US2R 2JS0A 4UQOA 3RBBB 1MKYA 2J7PD 2RKOA 3QOFA 1ABOA 5E3HA 3QG1A 1ZX6A 2W2VA 4PAMA 2JLXA 1AS0A 3EA5A 4TYQA 1QKXA 1RUWA 2L3PA 5TMPA 5IDVA 4DVGA 5CJ2A 4V0ME 2OAQ1 2ANCA 3MWKA 3IIMA 4IJMA 1KFZA 1UHCA 4DDTA 5JLJA 1O87A 1L7VC 1D8TA 1QRAA 3LBNA 4U02A 2QP3A 4JLKA 4URZR 4IHQA 4Q18A 3VR5A 3KKOA 2K3BA 2QAGC 4GL2A 3QNUA 5AJZA 2O8EB 1XF9A 1G7SA 2BC9A 1FFHA 1TUEA 2F1JA 4ON9A 3SI7A 1YZTA 1M30A 3FVQA 2EW3A 3LW8A 3NHNA 2CVHA 3GLIA 1RYHA 4CC2A 3F3YA 1AZTA 1DTSA 1YR7A 5C1BA 1F2TB 1U98A 4PTLA 3U60B 3NEJA 2CCGA 4UKDA 1W36D 2WIAA 3I5YA 2KNBB 2ZR9A 4Q4AA 1VMAA 1U3OA 1Q0UA 4RCYA 5HCIA 4J9GA 3KJHA 2XXAA 1T0JB 4XWAA 1OKKA 2VWFA 2BOVA 3T12A 3ZQJA 4AKIA 4A0RA 1XTJA 2BJVA 1OHHD 1W1WA 1IAQA 2PEZA 1E6CA 1SGWA 2QE7D 4WZ6A 4WOPA 1SXJC 1TF7A 2L0XA 2ZVQX 1MRNA 2PTKA 2JASA 4U5XA 4BLPA 5CK5A 5EXXA 3I5XA 2GZDA 5IK2A 1X1RA 4BFXA 2W0ZA 3Q8XB 1TADA 2A2ZA 2DPXA 2I4IA 4HVUA 1Z0AA 3LX8A 2CL6X 1X1SA 1NI3A 3Q7QA 4JLOA 2ZUDA 1XD9A 5L3RA 3BH0A 2H8KA 3ZJYA 3A4MA 4E5UA 4IDPA 3C7KA 1MR3F 2HF9A 1AKEA 5DH9A 1E98A 2FGKA 4FWIB 4LBVA 2QSYA 2Q3HA 2YOHA 3EIEA 1ZD8A 2B92A 1LTQA 3EHQA 5EE5B 4HUQA 5G3ZA 2BKEA 3ONWA 1HE8B 1GL9B 3A4LA 4G5SA 1Z8FA 1T5IA 2HCBA 3BFXA 1EXMA 2GTOA 2P2LA 2FDCA 4LZZA 3WMGA 2ZE6A 4J9IA 3OAAA 1N25A 2P5TB 1G16A 4LV5B 4YDSA 1LS1A 2IS4A 1U06A 1V1CA 1VA7A 5HR5A 1W4CA 5TY0A 1AWWA 1Y63A 2N42A 2JATA 4F93B 3PITA 4OYHA 5E7JA 5F2EA 4Q00A 1T3LA 4TMTA 2RGNC 3VRZA 2RGGA 2GVZC 5GJBA 2AZSA 2QEQA 3BWDD 2J87A 1TG0A 1GILA 1RJ9B 4KXFB 4URWR 1TAGA 1HV8A 2LX7A 4FMDF 2WJHA 4KCGA 2O8BA 1V5WA 1IY0A 3UWOA 4C0QC 3LVQE 1E7OA 2WICA 2VP6A 3WXMA 5KPJA 2FRYA 4ORZA 4HZUB 4F7WA 3PG5A 2DB3A 1W44A 2RGXA 2QAJA 5JI3E 1YWOA 1D5CA 1ZNXA 4NYIR 1RRFA 1AOJA 2DFKB 2N1BA 4BFSA 5F9FA 4DSTA 2ATXA 3ASZA 3PVLA 1QWFA 1P62B 4L9SA 4B44A 1W4RA 2HF8A 1M7BA 1BKDR 1P4SA 4O25A 3V4RA 2FX3A 1D6JA 1WBBA 3ZIAA 2V1QA 2R6DA 4HLUC 4W5HA 1G41A 2GCPA 4PFSA 1T3SA 3AGPA 3EPLA 4G5GA 1B23P 3TRFA 3UWKA 4JLMA 3SJZA 1R10A 1KDRA 2IYTA 3EWAA 2QGNA 4B6FA 1GL5A 4ILEA 1EX6A 2CLSA 2ZRJA 3SBEA 1TL7C 2QRZA 5GVRA 2FPEA 4B71A 2I3BA 1UKEA 3MJHA 2CREA 3U61B 3UXMA 1KI2A 4MDEA 3BB3A 1E9EA 2GEUA 1P5ZB 4NU0A 1EWQA 1II8B 2GEVA 3B1XA 3QF4A 2BVNA 3OIUA 2P5SA 4JZKA 1ZRHA 2J5XA 3RRMA 4F4IA 4CEIB 1M7GA 1LS6A 2YV5A 4IIOA 2VP9A 4E09A 1KK0A 1OPKA 2QI9C 4HDQB 3GLGA 2FZ4A 5DNYB 1QHHB 5KHOC 4RD6A 4HDOB 4EPTA 1KGDA 2NO0A 1Z83A 3NBYC 4BEJA 4KVGA 3O8CA 4LI0A 1Q1BA 5JRJA 1E6GA 1YKSA 4KVAA 1NKSA 1UKZA 4R71A 1OEBA 2CH4W 4IRUB 3EPJA 1J3TA 2OT3B 3LLMA 3KXKA 3Q9LA 4RD1A 1Q3HA 5CIQA 2RGAA 3R7WB 2YZ2A 3T1QA 4FN5A 4DC9A 4AKHA 4OMLA 1XPRA 1XD2A 2O0KA 4BFTA 4D82A 5KYKA 4KV9A 3K70C 2QU8A 1G8GA 1W36C 4BGDA 2QBYB 3C14C 4QC2A 2O2OA 1AS3A 1GKUB 4DLRA 6Q21A 1N6HA 3PUXA 4I1VA 2F3RA 3BIFA 1YQTA 2WWIA 1GUAA 4TMKA 4OQNA 2ZRDA 3VS7A 4AWXA 4KSCA 3K9LA 2JJ1D 2ASEA 4D8KA 2NG1A 3CB4A 3P27A 4JZ3A 2P6UA 2J0SA 4MRNA 1RZ3A 2QPOA 3HR8A 1N0VC 3THOA 5JWOA 1PLKA 2RGBA 2ZITA 4Q1EA 3VFDA 2EW1A 4OK3A 3EIQA 2XITA 1GBRA 2JMCA 1E0SA 3CPEA 2J0VA 1WXBA 4K8OA 1SVKA 2EVRA 3AKDA 3OESA 4B32A 4D4JA 2G6BA 4I4LA 5AJXA 1K0SA 4A8JC 2OE2A 4BFYA 4BQSA 2C77A 4YQFA 3I5RA 5FUYA 2QA5A 3VU9B 1K0XA 1XTIA 4II7A 5JJLA 3A4NA 1XU4A 1F3OA 1CS4C 1CJMA 3SOPA 2DWOA 3Q72A 2B86A 4YMUA 1IN6A 2EGEA 3KJEA 3IQWA 3OFND 4IVRA 1XMIA 5KPDA 4R2HA 1E1RD 2B8WA 1JEDA 3CX6A 1TMKA 1G8HA 3C5HA 1DADA 4LYJA 1WF3A 1Z63A 3QI2A 2V7QA 3IIKA 1XZQA 4TL9A 3TUZC 1WE2A 2ED1A 2ZI4A 4NBSA 3TJZA 3A1TA 1Y3AA 3W9YA 5GJCA 2ZR0A 2O8DA 2DRMA 3WRXC 1MV0B 3K0FA 3EPHA 2CT3A 5GJWB 1NJGA 1XOVA 2W2XA 2OBMA 4QKQA 1TU3A 2HV8A 1DG1G 3DHWC 3Q85A 1DO0A 3QBTA 5B57C 1GSIA 4IDHA 1E2KA 3H41A 2ZJ8A 1G21E 3B78A 5FTLA 2JLWA 2CSQA 1G17A 1AD5A 4QFMA 3KL4A 3LX5A 4KODA 1HT1E 2C98A 1OT3A 4NCJA 1U0LA 1FTSA 4TTPA 4AKGA 2JXBA 3QVUA 4M8NE 2JJ8A 2QMEA 3PUZA 1E79A 4GLMA 2LJ1A 4P0TA 4EJSC 2FU5C 2LKCA 3GLHE 4L15A 4J9CA 4Q1FA 5BXQC 3RSOA 1YZQA 2R8RA 4LOAA 2CK3D 4IDNA 2CLDX 5FPYA 1E6HA 3LNCA 4JMPA 5LD2C 3GLFB 2C95A 2W6IA 4L8GA 2LJ0A 2P4RA 1PKTA 1M34E 2IYZA 1E1QD 1ZM3A 2JLZA 1TTTA 2XB4A 5FUVA 4OMOA 1H3HA 2GWHA 4JVLA 1E9BA 3CWZA 2RPNA 4DT1B 1H8HA 1WXTA 2X3WD 1Z2AA 1XEFA 2GJSA 1P60A 4WA7A 2ZRGA 4O2LA 4B2PA 2A5DA 1G4AE 1R0XA 4JJZA 5FTNA 3TE6A 3UMRA 2E5KA 1JPJA 3AH8A 1P9RA 1MABB 4LJ6A 2GHIA 4PPNA 2ZRMA 2ENMA 2IUUA 3CZQA 2CJWB 2VP4A 1G19A 1S9HA 2AKAB 4EIWA 3DEFA 4OMQA 1GIAA 4TMXA 5H8WA 3F5FA 5LB2A 1MV5A 3O8DA 1ZUYA 1S1CA 1JR6A 2C99A 4QG7A 3CKLA 1G3QA 3U44A 4RD2A 3IUYA 3LH5A 5IH2A 1NN0A 4BEBA 3IEVA 3RABA 1Z9ZA 4AFQC 2K79A 4XD7D 4CDGA 4DDUA 2O52A 5E7MA 1E0AA 1Q21A 5J4VA 4ZCLA 2AFHE 1MV3A 2J0UB 2ZJ5A 4URUR 1XWIA 3FWYA 5EE1A 1TQ2A 3RC3A 5F98A 1PV4A 1ANKA 2LNHB 5J4KA 2ZI7A 4EPYA 2IXGA 3RS0A 1GBQA 1RVDA 2GBLC 1MH1A 3CR8A 4JLVA 4GFDA 3PCRB 3GLFA 4IFEA 2IC5A 2ZE5A 4Q7LA 4C4PA 1I4DD 5JWRA 1E9DA 1M8PA 2B6HA 3IILA 4OI4A 2YDLA 4TYPA 2Z43A 2D2FA 3ZS8A 1XCGB 2ODNA 1X2QA 3BC1A 3G5UA 4F17A 2JDIA 2YSQA 1FP7A 2UZIR 5EE0A 5EQTA 1XTSA 1N5LA 1U94A 2WJGA 5FR2A 4BPBA 1HQCA 1KIKA 2NO9A 4XTRA 3GJXC 3W8RA 2GESA 2ZE8A 4DB2A 4JIMA 1T0HA 3TW8B 2AWOA 2MCNA 4OI2A 4EUNA 2J3EA 2ZR7A 4H1VA 1COWA 4MKIA 2ZPTX 4KO8A 2P67A 5E7IA 1KSHA 3B13B 1GP2A 2DL5A 4GRAA 1Y57A 2RGEA 2RGCA 3K1JA 4J9EA 5SZJA 2KE9A 1AQYA 5BN4A 4OMNA 3PEYA 1CKEA 4LPSA 3K0FB 2ZJAA 4NPHA 1XB2A 1E96A 2BEKA 3AV0B 2RHDA 5FWCA 3TH5A 2YUPA 4NYJR 5FL7A 3OEED 1XMJA 4NCKA 4KFRA 4QJ3A 1NRJB 3VR4A 3U4QA 1ZD9A 1WCV1 3CX8A 2EYQA 2H57A 2KYBA 4JJBA 1K4US 1KMHB 3B5JA 3MCAA 3U3OA 3LV8A 3UG7A 5BW8A 1XCMA 3X1XA 1GTVA 2WPDA 3GMTA 4B47A 4KRTA 1E2EA 2DL7A 2P3SA 1CKAA 3ECCA 5JFGA 4PAOA 2KXDA 4JL5A 4FIDA 2A36A 1G1MA 4NH0A 1CRQA 3A1UA 1YRAA 2FZLA 2KYMA 4G5QA 3M0SA 1COWD 1EGAA 1GITA 1VTKA 4IKEA 2HJGA 1Z22A 4LJ4A 2YC4C 2TMKA 1OJLA 3OIVA 2RQUA 4QJ5A 1PWTA 2P6NA 3SJCA 4UJ3A 4M1KA 4TLCA 3I9QA 1QZXA 5B64A 1XP8A 4TMWA 4LNPA 2IX3A 2F3TA 1DS6A 3THXA 2QQEA 3CO5A 2FFBA 4QL3A 3GBQA 2V3CC 3UIEA 1W7AA 1E9AA 4CC7A 1GOTA 2NZ8A 4GP7A 2J45A 1D2MA 1NYFA 1W2GA 2AD1A 5IHIA 2VRWA 4B2IA 3H0FA 1KAGA 4M22A 1GNRA 2BZ8A 2F1RA 5EZ6B 4HLUA 3CIOA 4Z1MD 1EFHA 4C0LA 2WVJA 2YC2C 4A82A 3QPWA 3SQWA 1US8A 2G0NA 4NYIQ 4BZPA 521PA 1OIWA 5AK0A 2MOXA 2KEAA 1P2SA 1KI1A 1PUJA 3JV3A 3VR3A 4URVR 3R9WA 1KJYA 1VHLA 5AUPB 3HPQA 2PZEA 2YWFA 1EFRD 1PLLA 2X77A 5GJWC 1EG7A 1AWXA 1K6MA 2VPPA 2JGNA 1OE0A 1YZKA 1ZBDA 2WAYA 3K09A 2ZREA 2GBLA 3A37A 4IDQA 4WBSA 3T35A 1NEGA 1CBUA 1J90A 3CUEF 3FYHA 5DI3A 4QT7A 4WW0A 1NM7A 4DXAA 3AP1A 1UFQA 1AWJA 2WJYA 3U5ZB 1ZUUA 4UNRA 4KFSA 4RCZA 1E0JA 1YU9A 2WZQA 2IWRA 1QBKC 3VNUA 4HAYA 5EC7A 3IO5A 1NIJA 4FMBB 4GZMA 4TQ9A 1Z0KA 3FKSD 2ZRIA 3PFIA 2DHRA 5LD2B 4RFSB 1I2DA 2FSIA 5BYKA 4HZUA 1GZSA 2QT1A 1WXUA 3TSZA 3QBVA 4GPTA 4LBYA 1G3RA 4RY2A 1SVOA 1FTNA 1VPLA 5B30A 1E2JA 5JI2E 1HURA 2IBMA 2XZPA 5KNBA 3U6BA 4QBFA 3ADDA 1U5SA 2DFNA 1AA9A 4RZXA 1W6XA 1NF3A 2IT1A 3EA0A 1YCSB 4LUDA 2CBZA 4XJXA 3EAQA 5CM9C 4YONB 2ORVA 3QKSA 2UVQA 1E1RA 1RYFA 1YR9A 1IXSB 2L3SA 2BCJQ 3B1YA 3BB1A 4OQLA 4F4CA 3TGPA 4U7DA 1GL6A 1B3QA 3EC2A 2J7PA 4L5BA 5DN6D 4IEIA 1UADA 3P4YA 5LBIA 3REAB 4D4MA 2O8DB 1FL9A 4N0DA 1E32A 1R0WA 5ECAA 2ZANA 3FMPB 1DAKA 3WBJA 2GRJA 3UMSA 3L0IB 1E3MA 2VKNA 2H7VA 4IXNA 4HYYA 5CLLA 1WRBA 4Q1AA 1CU1A 3GEEA 5TVKA 2PL3A 1KI9A 3VS2A 3UPUA 1VCIA 2WWGA 4NMMA 3VRYA 1P6XA 3PIRA 1DAIA 3RS5A 5FBVB 4MKGA 1UM8A 3M0EA 4OHYA 5G41A 2RH5A 1OXUA 1W46A 1RI9A 3IO3A 4QGHA 2JT4A 1Q22A 4C3ZA 1WMSA 4IFBA 3LRPA 1VG8A 4ESRA 2ERXA 5JBQA 4MYUA 5JS7A 3K70D 3NHAA 3H2YA 4A8JA 4B48A 1E4VA 1KI3A 1DELA 3K0AA 3SNHA 2GK6A 4ZI3A 1U99A 3GLFE 4PXAA 4RVCA 2ZE7A 1VYTA 4JYBA 3H0KA 3REFA 4J9BA 1RRPA 5A5GA 3GLGB 5J5CA 2X1VA 1JEGA 2VSFA 3BBPA 1DBSA 3KTAB 4FCVA 4MGIR 1B07A 4PHHA 5CJPA 4WXPA 3TIFA 4ARZB 4ZI2A 3JVVA 1OOTA 1E1QA 3N2IA 2K7AA 1AKYA 1Z08A 3SR0A 1K5GA 2C96A 1NSTA 2VH5R 2CH4A 3GJ7A 1JXOA 3EWSA 1QHNA 2BJWA 3TQCA 2OV2A 2YYZA 3IBYA 4YMWA 3ZYCA 3AGQA 4TL7A 721PA 1ZM2A 1CR0A 2GF0A 2W00A 2ZAMA 1BIFA 3WHKA 2BM1A 2FH5B 5IRCD 2W0SA 3CF0A 2GBQA 3TR5A 1UAAA 4EQ6A 4YMTA 4KHZA 2X2FA 1KTVA 2WWFA 2IWHA 2YWGA 4PHTA 2PT5A 2DLPA 1FPMA 5FBRB 2JDID 2HLDA 3C41J 3NBFA 4LYHA 1J8MF 4X1VA 3M6AA 4M1OA 2Z4SA 3ETLA 5DGXA 1PVOA 3SHFA 1S3GA 3T61A 1TUIA 5TB5A 2YWHA 1ZCBA 1S2MA 1TQ4A 3KQUA 1T6NA 1Q3TA 1JQLB 1ZC4A 3AQ4A 3QXHA 2IS1A 1TPZA 3RYTC 2A30A 2JLSA 2BDTA 4JT2A 1II8A 5FBLB 3ZLJA 1L8QA 2QTFA 2ZI5A 3KDSE 4NE2A 5KOYA 3V00A 3VS3A 5AJVB 1OFIA 4A9AA 2O31A 1BMFD 2QY9A 2V8OA 4V0NA 3ZVLA 1A82A 1DAGA 5JCPA 1KK1A 3LFUA 1KNQA 4B75A 1T5LA 1P2TA 4WCIA 2A3RA 2L0AA 1R5OA 5AR1A 5EZ5A 4Q7KA 4GMXA 4M0LA 4M9XA 1E94E 3LQQA 2HLDD 4G01B 1G8FA 4AFZC 1JQQA 2WIBA 1GG2A 1NEBA 4MDFA 3FFBA 2OESA 2XNDD 3GJ5A 4J9HA 2PH1A 4ZCIA 3KB1A 4AG1C 4A63B 1GCPA 2OCBA 3BB4A 1DVRA 4LJ5A 1H8ED 4MGKR 1TX4B 4DLWA 2D1XA 4CVNA 2CL0X 1T8TA 4YMSA 4NONA 2H1LA 2QGZA 2PJRA 1S4QA 4IVQA 2ZIAA 3PVQA 2O8CB 3THYB 3K53A 3Q7PA 1ZLMA 2CDTA 2CLCX 4A2QA 1CTQA 2YHSA 2AXPA 1HTWA 5FI0B 5DI3B 4YXWA 4MKFA 4R2IA 4BZXA 1CP2A 2A9KA 4F92B 3OEEA 3AVYA 1UUEA 2EKHA 2AKYA 4TYWA 2YVUA 4S35A 2ROTA 2IF2A 3AF1A 2D8HA 1FMLA 1IXZA 3BERA 3I62A 4A0HA 1PHTA 1ZU5A 3CBQA 1HQYE 1MRSA 4O0MA 5EXTA 3DOEA 3FMFA 1SVIA 3CZPA 1AEYA 4HI0E 1JO8A 1YR8A 3THKA 3C16C 3SC3A 4B34A 4Z54A 2YNMA 3RLFA 4P4SB 1IN7A 4UNQA 4OI0A 1I4TD 2VSXA 4LBZA 3QUSA 1HA3A 3ZQ6A 1NVWQ 4JVNA 3RWOA 4YMVA 1VCNA 2IUTA 1OH6A 3GCGA 4IXMA 3WBKA 1XEWY 8OHMA 221PA 4OI1A 3ICEA 1NYGA 2ZYVX 3H0IA 1VIYA 1SRMA 1F2UA 5CYOA 2RMKA 3B60A 1Z6AA 3GQBA 2EYZA 2XMFA 3L8ZA 5FBWB 4US1R 1OB2A 4TQAA 2G83A 1DEKA 3DM5A 5KSZA 2Z5FA 3KXLA 3DMDA 1AQUA 1BK2A 3I8SA 3TAHA 3D3QA 2QUZA 3EPKA 4JS0A 1YVDA 1GRQA 4O3MA 2GNOA 1WA5A 3VS5A 2YOFA 4ZKDA 1F2TA 2DL4A 4HUQB 1W36B 1IN4A 1XEXA 4Z1MA 2DL8A 1HUQA 4PSAA 4NZYA 3EZ2A 2VL7A 4DCNA 3K9GA 3X2SA 3DMNA 5TARA 2VP5A 4RD4A 1E9RA 1KI8A 3SU8A 4BFVA 3U3KA 1KKMA 1E2MA 5FW9A 1ONBA 2ODBA 3EC1A 3BFVA 4Q48A 1U9IA 4URXR 3THYA 4XWKA 1X86B 4GMDA 2IS2A 3TR0A 4HATA 1VYUA 1NLFA 1R6BX 3E70C 4GT1A
chains in the Genus database with same CATH superfamily
1XDZA 1G291 2XLBA 3OQIB 5BVHB 1SZPA 1E5TA 4N5LA 4DB4A 4KQEA 1DQRA 1VHQA 3ZVRA 2NSYA 1YI8A 4XR9A 2OYCA 3U3RA 4EITA 3CG4A 4DXDA 4ZYTA 2P6RA 2LRHA 4Q5IA 2ICAA 2I78A 3L1HA 1ETUA 5LA6B 2V5UA 3HE3A 2FEKA 4L72A 5DN6A 4C5AA 3CKYA 1XROA 1XRLA 3AUYA 1I3CA 5TV2A 1EFAA 2FZEA 2P8JA 1BH2A 2XB8A 4C0KA 1V5FA 4EI7A 1ESNA 2P9CA 4IG4A 3ZBPA 1GPMA 3HABA 4I9HA 3C15C 3FHJA 3HRKA 4M2LA 4NU8X 4RQUA 5EJAA 1XJQA 1KO4A 1N3BA 2OHJA 1UXJA 1UJMA 3AIKA 2Z2JA 1VJGA 4N82A 4BLSA 3MQ4A 3H5VA 3NM4A 3RKXA 2WV9A 3UFXB 2JS2A 4G0XA 3HG7A 1WZCA 1RWMA 1T9GR 2IZZA 2J9FB 3KLMX 4HXFB 4L07A 4LJAA 1WSBA 4JDPA 5AW5A 2QI9F 3B6JA 3FRHA 2A58A 3WYCA 2DY0A 5LVAA 2BZYA 2HV9A 4ZU1X 5JOQA 1H9AA 3V1TC 4L9AA 2IY7A 4HSGA 5AM4A 5GAJA 2IDMA 1K97A 4GQIA 1DIHA 4B47A 4NZZA 4YRZA 1BDMA 1OYXA 1M10A 1X2EA 3PX2A 4LRWA 1VSBA 4Q19A 3JASA 1D07A 2C8VA 1V5EA 2UUAB 2I91A 2DMOA 4IUUA 1L2TA 3TTUA 3UWMA 2RF0A 3IQDB 3KOOA 5IEJA 1RPJA 4O1HA 3AR3A 5H5JA 1ODCA 2C4VA 3HYSA 3NRJA 4A4EA 2YUTA 3BK1A 1CS0A 3PKZA 4TQUS 3VPAA 2FVYA 5IBPA 5C35A 3DF9A 5AVXA 2J6KA 1EUYA 4XQEA 4QEZA 4ALNA 2AN1A 2Y1KA 2HC9A 2R6AA 3N1UA 3CHYA 3ZHSA 3JWJA 1XZNA 3CH4B 3R0QA 4FU0A 1JAZA 5DY9A 2ST1A 4ZVLA 1YDHA 1RTTA 1QHHA 4JB2A 2C8KA 3HSKA 1SHFA 4Y2UA 1G8MA 1JG2A 5GMKm 3D0QA 4CT4B 1ONOA 2CHEA 5JWHA 1ARZA 3JWPA 5GANe 1F20A 2XOKD 2C5LA 1Y6JA 3JQAA 5FIUA 1WHHA 2PVCA 4QU8A 1J2YA 4CM5A 4ABTA 1N8NA 1EHIA 2PXAA 3G9TA 1VQMQ 1SKBA 1VL5A 2ZIEA 2FP4B 3M6WA 3TPFA 1RJWA 3DGFC 4PZEA 5K45A 3KUDA 5C6SA 1DIRA 1H6BA 1QP3A 1FX7A 1HY3A 3BWXA 4OHFA 4YJGA 2X41A 3OOWA 3E5NA 2ORIA 5U4QA 5B2ZA 2A57A 3TEJA 4OK6A 1AXEA 2P30A 3HPRA 3FWZA 4NNOA 4WIAA 3ZHUA 1UP4A 2FOIA 3I53A 1MAHA 1SCNE 1JKJA 4M54A 5LC1A 1GCGA 3ZK7A 3FLBA 2M0YA 3RTGA 3BE4A 3OICA 4KRGA 1ELOA 1Q12A 3O8BA 1AKMA 1QNFA 1TW2A 1Y4AE 2QYHA 3JWEA 3AHEA 1QWEA 3ZW9A 1HT0A 4NHOA 3WV4A 4JLNA 1E8NA 1JXAA 1JEEA 4QUGA 4EPVA 3FI9A 2I6XA 4Q3BA 1E1YA 3QTTA 4JBYA 1XLTA 2P90A 2V7BA 4H6PA 4S24A 4GM1A 5D6NA 1OYVA 1UP7A 4C7VA 4G4SP 3MLAA 5DRTA 2PJZA 1UMKA 4G0NA 1F6WA 3M56A 1SD5A 5BV0A 4C2UA 4OQMA 3Q3IA 3HCBA 1JHOA 1RKQA 2WDZA 4CM9A 1YJNA 4BWFB 2FWAA 1Q16A 1GTZA 2D2IA 3WGGA 4JL8A 4JR0A 3O95A 5JCZA 1VKJA 2ISSD 1GL7A 1VE6A 4KQIA 3T1VA 2H2IA 3GLGE 3K9WA 1K08A 4GWLA 4TKVA 3Q5EA 2XMQA 3EXAA 2YT6A 5IMBA 3VOSA 5IDYA 5DRYA 4I1IA 3V1NA 4ZGDB 1VRCA 1ZGGA 3C4JA 3KQSA 4I6EA 4J3FA 2H5EA 4UXIA 5HX7A 3ILXA 4F72A 4EMKB 2GTPA 1SKUB 2GZRA 1NVTA 2A08A 5EYPA 2O48X 4CTKA 4I9NA 1TM1E 2YYYA 2C0IA 4V2SA 1KZ6A 2FY8A 2VDQB 3R5FA 5EIHA 5HK9A 5B3KA 2GCGA 3WYDA 1IUPA 4ZT6A 2GFAA 4PSDA 4M89A 3GLHA 1BGWA 1I4LD 1ZGAA 2R7MA 2PTHA 1PQYA 3LC0A 3TD6A 1RM3A 3KL2A 2I80A 1SG6A 2WU8A 2C1EA 1T8YA 1S7GA 1OREA 1XZGA 3KZOA 5H02A 3SYNA 4WEQA 3ISJA 4TM8A 1RI4A 4X6LA 2PR7A 5T3UA 3SBDA 4AJHA 4D0RA 1G21B 3UPTA 3WQRA 3P1JA 1ZN2A 2HM7A 3PDIB 2RI2A 1RQLA 4G4IA 4OHKA 1Y96A 1Z3IX 2HYIC 1EBFA 3D6FA 3B7GA 4JBWA 2C5BA 5IYZF 1S3FA 2O06A 1O95D 2EKDA 3KLBA 2HIGA 4ATNA 2EYYA 4L59A 2AG8A 4F6LA 5DBFA 5LPNA 2WPNA 1ZL0A 2IU0A 3FPKA 4F1JA 3CCRA 4DANA 1A96A 1BDBA 5FR1A 4XCVA 3OI7A 2HCKA 2C06A 4X34A 1DO8A 4PYMA 2R5WA 3ONDA 5SY9A 5JAHA 5LP6A 5CLIA 2AK5A 4TXHA 3WYAA 1TECE 4MICA 3GZJA 1N4AA 4CLRA 2BEWA 2GK7A 3NHMA 4PS0A 5IAAA 4K9DA 5AW0A 3B1ZA 4Q3KA 1NBAA 4TWZA 3QYGB 4EW1A 1YT5A 2YXPX 2FB7A 1FRQA 4Y92A 2I1WA 2H65A 1DWUA 3ASYA 2N9UA 2V55B 1TF2A 3RJ9A 4PPGA 2BAGA 2H6EA 4FHFA 4YK7A 3ICPA 1T2NA 2QUKA 3BYZA 3GBSA 4V38A 1L1FA 5BPFA 4DV2B 1N6IA 1PZEA 3DKMA 4WZZA 4ZO9A 1TIKA 1C7JA 4YUZA 4W5OA 1XFAA 1EA5A 3HADA 3QENA 4X95A 2QTRA 2GXUA 3GVXA 1OLUB 2DFLA 3BCUA 1F0NA 4HADA 5C5DA 1NJ1A 3PNBA 1L9KA 1UG1A 4B45A 1R5NA 4FQ5A 1ZA1A 4H6XA 1SPBS 2ABLA 3COPA 5HF6A 4YJGB 5HIIA 2P91A 3MFYA 3CMAA 2GETA 1G59A 5BWOA 4KN5A 3T06B 2K6GA 1LX6A 2Z4TA 3MAAC 3RTCA 2WU0A 2XMRA 4XVHA 4P32A 5DX8A 2PUCA 3A31A 2G3YA 5CGZA 4N54A 5IYZA 2IUSA 5CIYA 2BGJA 1A71A 1NVFA 1HG0A 1ZQ9A 2P79A 1U04A 1Q0ZA 3EXEB 3F6SA 4LGVA 2I2WA 1M7HA 3JAKA 4KPUA 4KWEA 1UGRB 1L7NA 3E7WA 4JX9A 1L5NA 3SJ7A 5IFKA 1SOMA 2UUCB 3DVSX 5BR1A 1EXWA 4DUYB 1XMOB 2GRUA 2EKOA 1UDBA 1SRLA 1U28A 2I65A 4PQGA 5DHAA 4EZBA 5BW5A 3N58A 2P7HA 5AVOA 5HFJA 1Y7TA 3RYHB 1XRSB 2RGNA 1CQJA 4BDSA 5BN5A 2REBA 3NC4A 5KQGA 1FUKA 1LLQA 2YJ4A 3AU8A 4RUKA 4Y2PA 2VHEA 4LQDA 4QULA 1NMZA 1NT4A 1AMOA 2LC4A 1NI5A 1L0BA 4RKEA 3AF6A 1N6AA 1UPUA 1Z74A 1ZI6A 1N0HA 1WDTA 2Q1TA 1N5ZA 1SB8A 1T13A 2L82A 3IT1A 4OUDB 3K0SA 2CEAA 5DP2A 5K4HA 2IXFA 4LJ7A 3CLTC 1ZJ5A 3VX3A 1T5BA 1QPGA 3KVRA 3M0QA 2B4RO 3W6OA 4QOSA 1P0MA 1FWZA 5KVVA 2A0XA 3ZWWA 1R18A 3ZV3A 2MYNA 3R6OA 3VNQA 1UPAA 2RAPA 3EXIA 1ZHOA 2J33A 4BDZA 3B53X 3WK8A 3EVCA 2H1CA 4D5EA 1XDUA 3QIIA 3KOYA 4C0BA 2VYND 3VKFA 2V6JA 1HK7A 5AQ1A 5LMNB 1JV2B 1YI2Q 4TUYB 3WV5A 1D09A 3HNRA 5EP4A 1ZPDA 1VKRA 2F69A 3I32A 4QUHA 1NVVR 1RYZA 1LUAA 2LDXA 3KPJA 4ZFNA 2W6ID 2ORYA 2QW8A 4FINA 3H9GA 4JI7B 1Y81A 5B7QA 4FS3A 3SEAA 1CF9A 3ECSA 2V7GA 4MEBA 1NNLA 2CWWA 9ATCA 3BDAA 3MGKA 2WSFE 3FRIA 3GAMA 2P75A 2J3DA 4NS4A 2LBPA 2XX3A 3ZV4A 1GGFA 1FU8A 3R9XA 5AJYA 4GE3A 4WKCA 2P3LA 2W6PA 4J8PA 2IYYA 3ZH9B 1N4DA 5KVSA 4LXXA 2WJPA 3R5KA 1M2EA 3JB9I 4XIGS 1YCYA 1GA1A 5CDHA 3A8MB 1KHIA 1IZ9A 3RVBA 1EGMB 4RAQA 3D6NB 1EUDA 4DLKA 2G77B 4QXMA 3PEVA 4PSCA 1DRJA 1RVV1 5ITZB 1LJLA 1Y3CE 2V96A 3W8EA 3CLSD 4K6FA 5AUOB 1VE3A 5E6RA 1A2KC 1L3BA 2WC1A 3HACA 1OV3A 4G24A 4Q21A 4ZMBA 1VB3A 3CXRA 2IITA 3ICVA 4CZ2A 4O5VA 1YR1A 2FRWA 2ZYAA 4UU1A 4E1BA 3GLQA 2J05A 1WW3A 1T2DA 2BF4A 5TEWA 2JZ2A 4RIEA 4BP9A 4EF4A 2D59A 4PRZA 1JPVA 1PR6A 3ZHYA 2FW1A 4XQ9A 1Y8QB 2GN1A 5CT9A 3IMFA 1QHIA 3GWZA 1UKAA 2FSVC 3ADOA 2AIRA 5IARA 1TCCA 1G5TA 3LY8A 4LHYA 4M1WA 2WE8A 3O8OB 1V4NA 3TL3A 5F3WB 2NUBA 5EJ6A 4C8QF 2IL1A 1BI3A 3COZA 4E2WA 5C32A 3QY9A 2ZYWX 1NY5A 3OJFA 1NLYA 1N6NA 1ZP6A 4LC0A 5K1ZA 4O02B 3LD9A 2B8NA 3CMAT 1UBMS 1DG9A 4F1KA 3UJHA 3HI4A 4FFRA 5F73A 4KMMA 1YRQA 2FK7A 5I7RA 3ZVMA 1C1YA 1E8DA 1KVRA 3E23A 2PSFA 1CRLA 1NULA 1R66A 1YZVA 4K3VA 4RYLA 4YBZA 4Z51A 3P52A 4Q9LA 1TEHA 3MELA 3WBJA 2HT1A 5CVIA 1OF1A 2K87A 4KX3A 2UXBB 2ZIFA 3QX7A 4D4HA 4ZNXA 1JZQA 4FLMA 1TQ6A 1D3BA 2FRDA 2QP4A 4LS3A 4CW7A 4DNXA 1SCUB 3OYDA 1Y7IA 2X42A 1VSTA 1U0JA 3W5BA 5IP5A 3H4MA 1WPXA 3DC2A 3HBAA 1ZOPA 3PR1A 4FVTA 5B1HA 4HUTA 3RSZA 2FHDA 1DIGA 4TSRA 1PU2A 3BWYA 5KAPA 2FK8A 5K5EA 1PYGA 2HQHA 2P9FA 2JFHA 2YUIA 2VYVA 3H86A 4OP2A 2FSGA 3RDVA 1SBNE 4UMVA 3A36A 4OK5A 4YMIA 1XL1A 4WK4B 1RJFA 3CNNA 3M4ZA 3VR2D 4ZYLA 2NZYA 2EGCA 1SN7A 2CLLB 1YD7A 1VQNA 3DB2A 4OGFA 3PXBA 1XPUA 1VQOA 3KEQA 4BYMA 2F2XA 1EM8B 3PHHA 1ADYA 4WXYB 5I11A 2OXRA 2Q4DA 4KR0A 4FR0A 3ZOZA 2EGHA 3GMDA 1L6IA 2JLYA 3HYLA 2CZ0B 1SOVA 4L22A 4C5EA 4OU4A 1J9ZA 4HDNA 4C04A 2VHXA 1Z29A 2Z2IA 4S04A 1B3BA 1KJWA 2WPDD 1X77A 1DQPA 5A0VA 1LBIA 3QXXA 4D6WA 2SCUB 3HJCA 3U56A 5U1PA 3W5DA 5EMHA 5EXDA 3A5ZB 3E35A 5CG1A 4E5SA 1B16A 4TL8A 4KNYA 2ZRBA 4FGJA 1FP6A 1V9LA 2XCLA 2M6LA 1RWOA 3E9ZA 4MGZR 1FSZA 1T0IA 5KYTA 3PYXA 4AQ7A 2WRZA 4GX5A 3U44B 3AR6A 3LO5A 1EQ2A 2A0WA 1P0CA 2IW3A 2VSOA 2VHCA 3PXCX 4DL9A 1RQ2A 2CDRA 3IX7A 3SN6A 4D4LA 2WSEE 1AZLA 3EISA 1Z06A 1UJNA 1ZAKA 3SU8A 1S2IA 4Y2XA 5G02A 1GRIA 3SEQA 2H1HA 2X6RA 3RG2A 5I47A 2IK8A 3KQWA 3MPUA 3F0TA 1PKXA 3TBHA 4Q34A 2R9VA 5BWBA 5K8TA 1HYQA 3BSSA 3CLUD 4ZYZA 2J0QA 1FXUA 3QUAA 4X84A 1UJYA 5DHPA 2ZPIB 2PSJA 4RY0A 3VA7A 3USCS 4DDWA 4M7DF 5T41A 2P0EA 6REQA 4MR7A 1H66A 3D6JA 4PPYA 5H3CA 5A3SA 3DR3A 3A6EA 3F97A 1U9CA 4BFCA 1B2RA 4DIDA 4JLPA 2I6FA 4L4RA 4L2IA 4DUGD 2RB6A 3P45A 4U2CA 2BFBA 2X9HA 3NTHA 3G2QA 3VPFA 4CMHA 2DF8A 4GKBA 3H6KA 4HZIA 4X63A 4YWJA 1IDN1 5JD3A 3RLIA 1OZFA 2GD6A 4G5RA 3NW9A 2GKSA 4HOYA 4NYMR 4EZEA 3KJXA 2FPUA 1CUFA 4WFIA 1P1CA 1WZEA 3LRXA 3MS4A 4RLQA 4WXHA 3VR6A 4BNIA 2YHIB 5KJFA 3A25A 3FPSA 4AC9A 1OH7A 1WV0A 3WYBA 1NVBA 3LCRA 4ZZIA 3O2SB 1EJBA 1KU0A 1EDZA 2DJIA 3CN9A 4LMRA 3UFBA 4DMGA 1KDOA 1BC5A 1P0FA 3NGPA 1W4ZA 1BW9B 4RTYA 4OJKA 3THXB 4AQDA 1BG6A 2JLCA 1FMKA 1V4BA 4M7DB 3OLZA 4BV2A 3WO1A 3DKIA 4MH0R 2PX3A 3A9RA 4QXOA 4EMKC 4RV9A 3NHLA 5G40A 4FEGA 1THMA 5FDFA 1VXRA 1YB7A 2GA8A 5AJWA 2OCDA 4C92A 1OUMA 3QVKA 4F93B 4MARA 4BUGA 2X8AA 3NHKA 5JYEA 2ZVPX 2H3JA 1NJSA 1BMQA 3LA6A 3RC7A 2QMHA 3VPXA 1H3ZA 4KQ9A 3HBFA 1R7RA 4WT7A 4RXMA 4D6PA 4EVRA 1UTIA 4HF7A 1TQ8A 4EJ2A 1DNPA 2AEEA 3MRTA 1PZGA 1G3YA 2PZBA 3PYLA 2XAAA 1X80B 4LBWA 8AT1A 4J6XA 3PXAA 3FKQA 2HTEA 1ZUIA 3WIBA 2JCVA 5GAN8 1MT0A 2V4ZA 4ZVVA 3HGTA 3QFFA 3PFNA 3HU5A 3L0BA 2AI2A 3OA0A 4RZ3A 3AEQB 4WZAE 3T7DA 3ZDYB 5GANd 1KBQA 4GZLA 4RKRA 2CVZA 4C0GA 4F2GA 1ZVKA 2PTGA 4HDKA 4QYWA 1Z0DA 1SKQA 3TCXB 1O1YA 2OTLQ 1P9WA 1Q1QA 3CISA 5HMLA 3WFIA 4YAUA 3JYLA 1KAHA 1ZS9A 3FIUA 5JMPA 3TZHA 4B8WA 2XUZA 1XKLA 3RV3A 1W2HA 1YWPA 1XTRA 1XTVA 5ADWA 2OBBA 4JA0A 2KRSA 3R1IA 4RVNA 4RL4A 2KLBA 3UHOA 5L3QA 5EKSA 2HWWA 3IEMA 1LJOA 3HFOA 4HEA6 2PFKA 2EJGA 2C4UA 1Z2PX 4Z2YA 2B8EA 3CRQA 4P4UA 3HL0A 3OIYA 1E2IA 4OHOA 2EZ8A 1E5LA 2Z57A 4ZIRA 3D7SB 5I7AA 3U16A 1SM4A 3GUZA 3GNTA 4HVWA 4RENA 4M7DA 4FGWA 4Q01A 4FNMA 2QMQA 4JQZA 5JD6A 1TCUA 3R6GA 1DDOA 5FWYA 4UUBA 1DXHA 3TQSA 2EARA 1QZUA 2PWAA 5DM4A 3E81A 3IPAA 5C53B 1HD3A 2IYVA 3L0OA 4AFNA 4FFOA 4JLAA 4MS4B 5HIMA 3AKCA 4O2BB 4D0GA 4G84A 3R8XA 4EM6A 1G3IA 1Y8RA 1ULSA 2ZBUA 1PFYA 2RJNA 4HGQA 1UGVA 2AT1A 1LBTA 3E5HA 3QPUA 4V3CA 4ACAA 1VJ5A 2HT6A 5JUWA 2IHNA 3CCFA 3H4VA 5J5VA 5I4KA 3KQKA 2BWJA 4RWEA 1XLUA 3ME9A 4CL3A 5EIAA 3QWHA 4B3IA 2PA3A 3LYHA 1U28C 4J3JA 5LZ4A 4DV0B 2FZ5A 4BFLA 1YJAA 2RARA 3IERA 3PP8A 3IHLA 3M1IA 2Q3FA 4HYEA 3U3JA 3ZD9A 1AT1B 2LQ8A 1H0SA 4Z49A 3T1YB 3W2GA 5B58C 5EP1A 2PH7A 1F38A 3SF8B 1NBIA 3R8CA 4JYPA 2BSAA 1GZHB 1ZMXA 2JAQA 2XUDA 3WKBA 1KRXA 1T10A 4W63A 2XSZD 4JBIA 1V8OA 3QKJA 4KGVB 2H5JA 4JLSA 1QKIA 1V9CA 2Q6KA 4J3NA 1Z4MA 1GL3A 1XHFA 3EK2A 5EHXA 2FE1A 2M02A 1T4CA 1GN9A 2XMZA 4RLHA 3A1FA 5L4NA 4F56A 1CZNA 3RVQA 5H9WA 2IGBA 4HC4A 5L95A 3RNLA 1N1DA 2DTEA 2K4YA 3K15A 4BMVA 1IBSA 1WCYA 3BHMA 3DEHA 4JJKA 4EVQA 2R6ZA 3X25B 2FZVA 3ZHXA 1UDXA 4MPTA 4GI2A 4TUYA 3DBOB 2NGRA 4M4SA 4UZEA 4ZOAA 2Q7XA 1P6QA 1SFRA 3OS1A 4UTPA 3N2EA 1QAQA 2B4QA 3BJRA 4PNHA 1T2EA 3LP6A 1OB5A 4PO9A 2H0QA 1RL2A 1Y89A 2IVFA 2LCIA 1CHNA 1SUPA 4ISCA 2VBIA 5G2OA 5A6SA 1OI1A 3RT1A 4LY6A 4JXKA 3B1WA 1CLEA 4HN2A 3ZIAD 1SBHA 2VC2B 1XTBA 4MRMB 4P22A 2PRIA 3L6OO 4HDMB 4EBFA 4XK8E 3KIPA 1AKRA 2O8EA 1WJQA 4ZDIA 3WLNA 3RBAA 3DHYA 2FKAA 1A5BB 5GAMf 1OGJA 4W5TA 4B6MA 2KGTA 1IHYA 1U9JA 4O3FA 4X64B 2V26A 2PM8A 4QELA 1O6FA 1U8FO 2BEVA 3L1VA 1P4AA 3K2IA 2P11A 3JYOA 3RJTA 3SFZA 1MIOB 2FPLA 1N2ZA 2P78A 1R5BA 1KH1A 4M77G 4M78A 2DXBA 1D2CA 1NSFA 3O5AA 4HEJA 4LCEA 3T6KA 4IY1A 3IQIX 3KXPA 4RS3A 2JPDA 2O14A 4G8JA 2HSPA 4Z8XA 1MPXA 1BCRB 3PCXA 2WTUA 2KRNA 2NZ2A 2ZJBA 1QH1B 1O6CA 1RCFA 3GLUA 4NNJA 4F4FA 2N1MA 2EC5A 2X4XA 2ILTA 4CTMA 2AJTA 2CNNA 2O54A 2LZ0A 2JRLA 4RHYA 4NDAA 4BE7B 4UAJA 4RTNA 4KDFA 2WVGA 4EG7A 2PIDA 4RM3A 2H0AA 2DU8A 3CVOA 4IQ8A 1YVUA 4IH4A 5FOXA 5CBKA 1RLQC 4X1YA 1B26A 4AF6A 1XQ9A 2C88A 5E4FA 4NI5A 3MWGA 1U8XX 2VJMA 1PDVA 4I99A 1WTAA 1U8TA 3VVCA 2BJHA 3O8QB 4XQ0A 2NXWA 4PSUA 4G9EA 3OX1A 5JPDA 1Y1PA 1X75C 3DB3A 4P33A 3TLZA 1OYWA 3UANA 2P8SA 5IG2A 3H5TA 5JG7A 3CD6T 3DOFA 2CFRA 2MSWA 2X2PA 2O2DA 3D7MA 4ZICA 2QM0A 2YJNA 3L5KA 4LUCA 3RDPA 1U80A 2FF7A 4OXKA 2EJUA 2C9ZA 3FTPA 4K87A 5BURA 1KY2A 5KWEA 2VHWA 4PG8A 1EFRA 3GLTA 4UJ5A 5HTKA 2A6PA 4PQEA 2O23A 5AKZA 3UUEA 1UBCA 5KCHA 1H1LB 1XAGA 4QW2A 5JVDB 5C1IA 2KE5A 3HYTA 3OM8A 4PXSA 2FRDC 5E8JA 2IUYA 4PQFA 5CQYA 2O2IA 3JZFA 2DQZA 1EXNA 3GFVA 4RPIA 2OAP1 5E9WA 2OR3A 3FNRA 4J4HA 4TSFA 3RVOA 3SEZA 3HRTA 1SEMA 1I6LA 1U2QA 2WJVA 3RJ5A 4J7UA 3I9KA 4YXWD 5GAOq 3VHXA 5ES4B 2LCLA 2LW7A 1OV4A 4RG2A 1FNDA 2WSMA 1T2VA 1NA5A 1RYYA 3MN1A 4XYLA 4Q4CA 5GAMd 1N5KA 1KZHA 4J0JA 2V4MA 1QKWA 3WYNA 5LJLA 2FQXA 2PH3A 1CR2A 3TBKA 2DD5A 1GSHA 4TMVA 1Z35A 3P9YA 1O97D 1V8DA 2JAOA 1HDGO 3CE9A 1HE4A 1NU6A 1AVTA 2VUSA 3FOWA 2JJ2D 3AF4A 3GO4A 1YJ9T 1CSKA 1IHXA 3CT4A 3HHEA 4HAZA 4JUAA 5LIPA 1Y1KE 3LI2A 3PGLA 4NAHA 4TRNA 2WHXA 3QU4A 3K31A 4TVBA 5KYXA 1Y3HA 4FOSA 1BS1A 1BIBA 1PM3A 2H7YA 1WUIS 2V74B 4K1XA 5ERXA 2EFCB 1ICEA 1RE0A 1HZZC 1JIQA 3CF2A 1EFVA 2B83A 4FZ3A 2DSTA 3I4LA 3ZJVA 3IESA 1BWPA 1YS1X 2A84A 3HU1A 4IHKA 4GXQA 1Z6GA 1CUGA 1XVIA 3VNRA 4C3UA 3S68A 1QORA 5DSXA 3OIWA 1OU8A 2NO4A 5KNBH 1IJKA 3M55A 1V6CA 2FN7A 4QEDA 1D4ZA 1VIMA 2IBTA 5HKLA 2QTHA 1J33A 3GRPA 3KKZA 5KKCA 4DZZA 1C41A 2D5CA 4LDYA 4LD9K 2OORC 3F90A 2FW6A 3PEFA 4JH0A 3ER9A 2X0IA 3NPMA 1ONNA 4LKOA 2ZTUA 2WSSA 1S8NA 3CR7A 8AT1B 1YP5A 2OAWA 2XZOA 1T4DA 4FN4A 1QZ3A 4IZ6A 4AFUC 3JARA 4KBFA 3AVWA 4YAJA 3R9XB 4WJKB 2FVXA 4Q1CA 5IU6A 3LUAA 5HRUA 4PRKA 3H5AA 3P2EA 4V0MA 4JXZA 1E8MA 1KXZA 3VOBA 3BEDA 3D9QX 3ABQB 1HYBA 1NMYA 4C92E 2Z5LA 5WRFA 2C58A 3D2BA 1GJRA 4G5HA 3KSAC 2WJWA 1L9XA 2UDPA 3EGCA 3IA2A 4BASA 4C3OB 4UDNA 3KTDA 1UBEA 1ZMTA 1JHAA 4FNOA 4FHGA 4BO2A 3BS4A 2DXIA 1NV9A 2W6JD 4D56A 3WXMB 2IH5A 5T64A 3Q7IA 4FB4A 3LPLA 5IHXA 5BSGA 5FTJA 4JJCA 4IOMA 4R41A 5AK5A 4IKFA 4KTTE 5H16A 3DMRA 3OIDA 4JB3A 4KNVA 3FLGA 4Z5XA 1WX1A 2DHCA 2BHNA 3AEKB 1XCPA 4NDZA 5KQPA 2OOKA 2XMDA 3MCZA 3K30A 4R84A 3S3TA 3ZQUA 5A7HA 4KWHA 4BMPB 1ZH6A 1NE8A 3PU6A 5T6BA 4FONA 4L57A 1PG5B 1PL8A 1M1YE 1SIBE 2DULA 2I6UA 1UP6A 4I14A 4BRWA 5A3RA 1BHSA 1KEVA 5TGTA 4E2YA 2OP0A 1DX6A 1Y6GA 2G6TA 5CVTA 1T36A 2IPAB 4TTAA 1DSSG 1Q1ZA 3OE4A 4NCNA 3V8MA 2F64A 3VDRA 2JKZA 1V16B 1CUJA 4QGAA 5HS6A 5A6SB 3SYTA 3KKMA 3UB4A 1Z0SA 4P4LA 3JZDA 2RKWA 1PQPA 5FAXA 3KD3A 2BDEA 2CLEB 3GOQA 3JCMg 3I12A 4CV1A 4BKOA 5CXUA 2JBWA 1BH6A 4NL4H 5FBQB 1YI1A 4ED9A 1V6SA 4HN4B 2WP0A 4C0WA 4J0DA 3UJPA 1C30A 3M6VA 1FP4B 4PGGA 4AF7A 2EBHX 2ONYA 1MX3A 2G08A 1QHXA 3WG9A 1QE5A 3UMMA 4I1PA 2A1UA 1KPHA 4WRRA 4EAQA 1KQPA 3KUCA 4Q9AA 4BFWA 4J2OA 2XBMA 1LI7A 4ZDWA 3A9UA 2AUMA 3AUXA 4OJQA 3UCEA 1QC5B 4O4LF 5J3JA 5CT8A 5IVDA 1PEKE 1OH8A 3GMIA 1AD2A 3F6PA 3N2GA 3QKIA 1BQEA 4LQ4A 5A0LA 2PZ1A 2CNDA 4CKYA 1NG9A 5TVGA 1E69A 4P08A 3KFLA 4TLAA 3KJIA 1DRVA 2VNJA 4QDXA 4BE4A 3NVDA 1QVGS 1RFLA 4Z7JA 3X28B 3VO9A 3LUCA 4NE9A 1IRIA 4KUDK 4Q37A 4Q3EA 1UFFA 4F1WA 3L0ZA 4RY8A 5JSZB 4IW3B 4XKJA 4DT1A 3RAEC 2CP5A 2XUAA 1O96B 2QJWA 4BVAA 4XUCA 5K3FA 1K5DA 2AFIE 2LR0A 3ADPA 4QLAA 3V8NA 3HB9A 4GIBA 3VZQA 1OU9A 2XKOC 3SBEA 1OZ2A 3K5HA 1QS0B 4P4GA 5BPHA 5K6RA 1AVZC 3DOCA 1TTQB 2QG4A 1WKBA 1G83A 1W5AA 1PR3A 5HMMA 4Z4HA 1DE0A 3FZEA 121PA 4RNDB 1QVFA 1A77A 1CUXA 1H4SA 1R27A 2GBFA 4HGYA 1N5OX 2RMOA 2WT8A 3NXSA 4WD3A 3JS5A 4JT4A 1PEDA 3HWRA 2IYSA 3A1VA 4TOIA 5IVIA 2IUEA 4YHHB 1QIIA 1JFSA 1BYIA 2TMGA 4HEQA 3ZKAA 1ZVQA 3K72B 5REQA 3E9MA 1ECLA 5C4GB 1OLOA 1XJ0A 1TXGA 3FZYA 3Q1LA 1DPFA 3G71T 1E63A 2CWDA 4MQEB 1YQUA 5JT1A 1KK2A 4FW9A 4ZVQA 3BE6A 1NJ2A 4RMNA 4GQBA