3UMYA

Crystal structure of mutant ribosomal protein t217a tthl1 in complex with 80nt 23s rna from thermus thermophilus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTAMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystal structure of mutant ribosomal protein T217A TthL1 in complex with 80nt 23S RNA from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Rrna binding protein/rna
total genus 68
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3umyA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3umyA02
4REOA 3UMYA 3U56A 4DFCB 1U63A 4F9TA 1DWUA 1ZHOA 4QVIA 3U4MA 4LQ4A 1CJSA 3TG8A 3QOYA 3ZQJA 1MZPA 4QGBA 1I2AA 2HW8A 1AD2A 5DM60 5DM70 3FPNA 4QG3A
chains in the Genus database with same CATH superfamily
1V4NA 1TGVA 4M1MA 2FPKA 3R24A 1EP9A 1ZC3A 4DXAA 1KZ6A 3ZGXA 4BLSA 5B64A 1N7JA 3JQ7B 1UPPI 3F2IA 3OPYB 1QFMA 3KB2A 3KQWA 3LFHA 4WQMA 4DVJA 1NKVA 1ILWA 5JSUA 6AT1A 2CEAA 4JGIA 4WK0B 3WYCA 1KP3A 4QTUB 5EZQA 1U1FA 4KWCA 3UB3A 4KXYA 3F9RA 4DS3A 1I3OA 3O3OB 2BEWB 2EJUA 4CKBA 4M6WA 3ZJUA 5LJLA 2C2MA 2RD2A 4HAYA 3TTUA 1XVUA 3BUSA 3LDGA 5E0OA 2QL9A 2QU7A 1ICEA 4UUQA 3O4HA 4NRDA 4MGZR 4CQLB 3ZDCA 2GRAA 5JI3E 1NXVA 3RYIA 4BMCA 1RBZA 3AP3A 4JB2A 1G2QA 4AKEA 1BWPA 1I9GA 4DFCB 3IBYA 4HYYA 4ND8B 4Y18A 2PA3A 4UCFA 4BNZA 4LOJA 5ED0A 2VSYA 3KYCB 1KP2A 5C7OO 4IX1A 4QBHA 1I6WA 1GQRA 3A9RA 5D00A 1F4PA 2LCIA 1GKUB 5JFTA 2BIFA 4CGZA 4KOAA 1FZQA 2EQAA 1WBJB 4D4IA 4BX3A 4HEA6 1GQOA 1RWPA 3E7WA 4H7EA 1WDKA 1JDTA 3RVLA 4UOZA 1VXRA 5CT9A 1WDWB 1J42A 2Q45A 3ONFA 3NWBA 2PY6A 2RGAA 4PTLA 3RAEC 4FHFA 4AN0A 1I2AA 3U7RA 4ZVQA 1CRLA 5AUQA 5SV2A 1R0KA 2FSGA 1YJXA 2EGUA 3C5WP 4RWEA 4CZ2A 5J4HA 2ZU6A 3BRWD 3AJAA 4XYLA 1W8DA 1HA3A 4M0MA 1TEZA 4WBXC 3MJ4A 3W7AA 3H0EA 4LIPD 2EL9A 5T7BA 5B58T 1AGYA 2YWXA 3E8SA 2BC9A 1DAMA 1IQRA 1T8YA 1Y3HA 1YO6A 3K0FA 3VSAA 4ZHQB 2WFZA 1ZM3A 2AFHB 2R48A 1T36A 3EGOA 4QBTA 1IVYA 1RLJA 4GM0A 3M83A 1MQ9A 2PCJA 1Z7EA 2ET6A 3H8SA 2XGOA 4AICA 4MO2A 1GNQA 2ARKA 2OV1A 2IYEA 3JWPA 5BN5B 3UW1A 4RQUA 1NLUA 3VHXA 2FW9A 2FG6C 4JLNA 3VBCA 4B6FA 3P0EA 3OJWA 3T52A 2XECA 1XN4A 3GO4A 3AI2A 4P8RA 5BUCA 4ZYUA 1NJSA 2B35A 2ILTA 1WUIS 1XYGA 5AQ1A 2V68I 1OPRA 2WUGA 4G2NA 4HI0E 1ZL2A 3F5MA 3RSQA 1KMHA 2V8OA 3AHDA 3BSFA 3TQQA 1OYWA 1Y4DE 1W5BA 3PD0A 2QT0A 2IZZA 3SKVA 4PQEA 4WD3A 1L7OA 2O1WA 1J56A 4LXHA 2C5FA 2Q07A 3E5RA 4K6MA 4CM9D 3S55A 2BGWA 2QN1A 1JG3A 2KB0A 1KU6A 1PGJA 2QS9A 2BMJA 4AMUA 1Z5PA 4I9UA 4QRDA 4CQMD 1W25A 2BEUA 3MZ0A 2BI4A 3FG9A 5TS2A 1XU4A 1Z0FA 4G0OA 2WV7A 1G5FA 1W5TA 3U62A 1XIVA 5HZGA 4OK3A 3KJEA 3FPLA 3W3AA 3LCMA 1Y8ZA 3DE5X 1TI7A 4MV6A 1COWD 4RTQA 3CURA 1Y4AE 2O0HA 4B83A 1OZGA 3AI1A 1YMVA 3FWYA 2ZRPA 2E2WA 3C5EA 2ZFUA 4XR9A 4HVCA 1OGYA 2P68A 3V8PA 3MQ4A 3RWBA 4LOAA 3WMWA 3M6WA 5HILA 5K8VA 1UUFA 2VBCA 4CF6A 4YCLA 2JIZD 1MQSA 1OREA 2P9TA 4ZAZA 3EVTA 2TRSB 1E99A 2C1EA 3B1WA 2CFCA 4WKOA 4D74A 3VKHA 4M55A 4NZPA 1QH8A 3AIMA 1KU0A 2H1CA 2ZS8A 3GJYA 3NYQA 5KYTA 4KO1S 3QTBA 3SJUA 4YAFA 3N0VA 4GI7A 3T7RA 1ONPA 1PUIA 4X1IA 1ZAYA 4L5JA 4K9PA 5ICSA 2G25A 4L4UA 4RD3A 3ZE7A 3ZJVA 5C8YF 1T1SA 2XNJA 2X6QA 1SWWA 1PQUA 1EEHA 3JQAD 4QAQA 4EUSA 2G07A 5CFOA 3L7DA 1UZHC 4EA7A 2NZWA 2QTTA 5ITSA 3MWEB 5JW6A 1JUDA 4XDGA 1T4DA 5C18A 2GBLA 1GV0A 2P9CA 1PS0A 3EEBA 3IV7A 1VYUA 1R5JA 3PL5A 3PYMA 1T26A 4C2BA 5HF9A 2LRHA 1GGKA 1XAHA 4ZRNA 4E1BA 2ZJ1A 2W48A 1ISMA 2WR8A 4N5IX 3UK0A 3DNPA 5HRUA 1SOWA 4MUYA 5K3DA 1Z2PX 1UMBB 3OHPA 5AKJA 1MC4A 4GZLA 4MLPA 5CX1A 5AVRA 5G53C 4KDEA 1IZ7A 4K87A 2GTIA 3EFOB 4MR9A 1TVCA 4UVGA 3V2IA 1X19A 4FI3C 4EK9A 5JRZA 2A92A 1EYZA 2ZAOA 4TOIA 3WP1B 4F3TA 3G59A 3P45A 1ZI9A 4QHTA 4HRYA 1BJKA 1PR3A 1WCIA 3C4QA 4GLBA 1A50B 1VHJA 4BTEA 5A0TA 3G0GA 3GEEA 4E70A 3C74A 4I8IA 4WI1A 3AG6A 3SR0A 4OKIA 4QBKA 3BT7A 2DEUA 4WKGA 3O4GA 1W75A 3UUGA 1YQQA 1V1JA 2F3RA 2JB9A 2ZIUB 2C59A 5CCXA 1CR6A 3AUYA 4FFDA 4K3UA 1IXSB 1BHO1 5H3HA 1KPGA 5JG7A 2XA1A 1Z4OA 2QG4A 3CG4A 3L1HA 3G8AA 5EXSA 3OQ6A 4W5QA 2CK3A 1NVWQ 1U4OA 3HJRA 4NH0A 2OBFA 2FGJA 4Q6BA 4JL6A 3IDAA 4R2IA 5HMMA 4N3GA 5LDDC 5EYPB 1BCSB 1O0SA 2B4AA 1U7XA 2I55A 2HF8A 3PU6A 1YE5A 4HR7A 1U5BA 3KKNA 1TQDA 4I55A 3AV0B 4QXRA 3TZKA 1OD6A 2IHNA 4C7JA 3VR6H 1OLXB 2NXJA 3WB1A 4LK2A 1R0BA 3O9MA 4FHDA 3T9AA 4O29A 4XPIB 3T3IA 2RB4A 2CDBA 3VJLA 1UKYA 3IERA 1ZIXA 4TXNA 4NSNA 1COWA 1Q6YA 1TK9A 4RSGA 2AFHE 4M0KA 3EXHC 2A0KA 4C5AA 4EYGA 4J2HA 4BHTA 5A9SB 5GJCA 1GXSB 1PV2A 2GPNA 4FW8A 1X13A 5CB4F 4HG2A 2WVGA 3N76A 2EWMA 4IUBS 1CIVA 1H23A 2BISA 2GBFA 2ZVQX 4OAOA 1M0EA 1ESNA 4W9RA 1UJMA 1A2KC 2OBBA 1MC8A 2OV2A 1RSCI 2OCBA 1KF0A 1K2VN 3DDCA 1VECA 3EPKA 1II8B 3RFFA 4CRWB 3GDOA 2FW8A 3QLJA 3M6MD 3OIFA 3EA5A 3O31A 3OUUA 2O5CA 1AQLA 3H1BA 2C88A 3C5CA 1Y9AA 4M89A 3PWKA 4JKIA 4K86A 1NA5A 4QTZA 3TJRA 1XF1A 3MK31 4JX8A 1OXUA 2H7YA 1JHOA 1PV1A 4R9SA 3PJDA 3QEMB 1J8MF 1W44A 1E6KA 3FGOA 3HBFA 3F4KA 1N8TA 5EHNA 3EARA 4B6RA 4C0JA 1LQ2A 1T5OA 1IUPA 1Z4JA 2H4HA 3LBHA 1IWBB 3Q72A 1BN6A 1B93A 3CX8A 5EVJA 3WYBA 1FYDA 2M98A 2V45A 2JGKA 2REOA 1RMTA 3CZCA 2RHLA 4RETA 1TUBA 4UEWA 5E7JA 2CFOA 5KTNA 1AO0A 4JP3A 4ER6A 5AO9A 4CIYA 1TCCA 1GVHA 1OKKD 1XNRB 1C81A 1FSPA 2PNJA 1HQDA 1DV1A 1ZCZA 1TF5A 2JAXA 2YYAA 3N2GA 4S24A 3T1QA 5J4VA 1A8IA 1N32B 1C30B 5DTEA 2O8CA 4IZIA 1WQ1R 3FPAA 3QLVC 3PQ7A 5M7EA 3FYCA 1B2RA 3OTQA 3R0VA 3HXOA 2XUDA 3OE5A 1QV9A 3V48A 1PZEA 3GEHA 3LU1A 5FXMA 2ZRKA 3W6NA 4KE7A 4BJ3A 4DQKA 4NYMR 4QU8A 4HVTA 1L7BA 1LNQA 2ADFA 1LCIA 4Y9TA 2V6GA 2BF4A 1ADGA 1E6EA 1BE1A 1QOPB 3DZHA 2X4DA 4K26A 5C5EA 5C1DA 4X62B 2O2CA 2Q3JA 3A1SA 4WASA 2A5FA 5J4LA 1WXDA 3KPWA 4TLDA 2D4HA 4X97A 2JEOA 3M1IA 1LJLA 3BB3A 1NFRA 5KYUA 3UXHA 1SZJG 3OIDA 4MWBA 3PBKA 3VKWA 1J2TA 3E3MA 1U0OC 2M32A 3I34X 1CEEA 1DRUA 5KYKA 2CLOB 4F93B 2BV3A 1GKIA 2VWPA 5I4BA 1EMDA 3QE0A 3DV2A 1JG7A 5EFZA 1V8PA 4IDEA 3S2FA 1V1RA 5FWXB 4KBFA 2GLXA 5C7IO 3RUBS 1T6XA 3QU9A 5JRJA 3NTVA 3ZH9B 3AF4A 4LECA 2I9KA 1ST3A 2XEDA 5ALUA 2O2YA 4HNGA 4OATA 1WD7A 1ST2A 4Q0MA 2R1UA 3V8MA 4BN5A 3G0CA 3NP9A 3QUCA 2VR1A 1M6HA 1PGNA 3FCEA 2GM3A 4CIWA 3DMTA 2LTAA 2EFCB 4YALA 2AB0A 3T54A 2X6RA 3KQPA 2NVBA 2ACKA 1M7HA 1TA4A 1HE1C 1FNMA 1WB5A 4DLKA 4YLYA 4LZLA 1N6HA 4X93A 3PX3A 2NX2A 3A6HA 3ICWA 2PL3A 4OD0A 3TPFA 3WWZA 4CT0A 5CDUA 1Z33A 3TLEA 2RHMA 3EBLA 4HH4A 1A1VA 1YC2A 4N3AA 1FU7A 3KSRA 1CNEA 1XAGA 4BTLA 1JXOA 3IMGA 4NV3A 2FPGB 4OGFA 1UXKA 3WGUA 1HQKA 3KUXA 3OSUA 4L72A 4BO4A 5IFKA 3KFLA 1CLEA 1NW6A 4LUCA 5J3JA 2JH9A 3FVTA 4GC9A 1TTQB 1UQTA 1HUQA 2HHAA 3MBIA 4JDPA 4RSMA 5IAEA 5JCJA 3M9XA 2HSZA 1ZKMA 4Q34A 4ZZ3A 1JEAA 5KWEA 4N1AA 1GGFA 1XD2B 1GIAA 2EG9A 3DJYA 3NHWA 2DFLA 1Z6ZA 2K6GA 2VZLA 3QVUA 4N47A 1EWQA 1UBTS 1VPLA 3OE7D 4YI5A 2H1SA 4CM3A 4D6PA 2P5UA 1PFVA 1SD5A 3KDSE 3PNLA 3H2BA 1DXQA 2GXAA 1IR21 2VJAA 3NOXA 3LVFO 4J4TA 4M38A 1YHYA 4PYRA 4V0MA 4PX5A 5D3QA 3RFUA 3S40A 5AP9A 3U61B 3ZVKA 2XMGA 2IYQA 1L4FA 2PZKA 5JC1A 3HXMA 4R5MA 1M33A 3A6EA 5DEIA 3RK0A 4IHQA 4CXMA 1ESDA 1V6CA 1GUZA 2X5NA 4FYMA 2NSJA 4O3FA 1CG6A 1L4MA 2X1MA 4L0CA 2JFVA 4NPHA 5FL7D 3VOSA 4NXMB 2XXAB 4LCBA 3EEQA 4ZHSA 2ZDHA 3BXXA 2HBRA 1L5LA 4DDKA 2XVZA 5COQA 3DVQX 4RZHA 4HC4A 2VHTA 2IYXA 4OQLA 2WHEA 1KAQA 3UWMA 2DOKA 2UZIR 1V1MA 4D0SA 4U5QA 4YJ2B 1JLHA 3SIXA 1YGYA 1D8AA 3VOTA 4HZUB 4AJ2A 4OIFA 2Z09A 4IWYA 1ZMBA 3UJAA 4LSZA 3KZXA 3LW8A 5B53A 4BQQA 1KL7A 2V6MA 5JROA 1TQ4A 2WTAA 1BXGA 3PFIA 5CDFA 3PGA1 2C0QA 2JDID 1KH3A 2QTRA 4PLPA 2ODQA 4D4HA 2Z08A 4ZEWA 5CT8A 1T5SA 4C0SA 4BASA 1P2DA 3CM0A 2BTQA 3NIFB 2FZLA 1U2GC 1LI5A 1VTKA 1TFUA 4Y0NA 3SSNA 3VYWA 2PGJA 2SKDA 5BOSB 2PSSA 4Q7MB 1EQUA 4EWLA 4H31A 1K8ZB 3OLWA 1SJ9A 2MSEB 2CFTA 3I01A 2F8TA 1FP6A 4AMZA 1BX1A 1UM9B 3LF2A 5FTKA 4RPHA 3WIEA 2CNNA 1ULUA 4RWZA 4NU0A 5H59A 4C4ZA 1QIJA 5HSGA 3V34A 4A82A 4EECA 1XWFA 3A4YA 2DFNA 5KWVA 4BFYA 3T1TA 2HEGA 3OJFA 2NUTB 4MGYR 5F9MA 4ZT7A 1O54A 3RU3A 2X3UA 4ECAA 2W2TA 1CZNA 5K45A 1TECE 3BGDA 4UEQA 3DL7A 3PNMA 3ZWMA 5E7MA 3DEZA 3DV0A 4NPAA 3T4UA 3ETCA 3D6UA 1A77A 2D59A 3TNJA 5GZ1A 2UYOA 1N5KA 2WIGA 3QHPA 4DIFA 2EZ9A 1LU9A 3O7WA 1W5FA 1XO1A 4A16A 4BB9A 4DRZA 1QG2A 1A9XB 4E5NA 2ZBQA 2IPLA 3V9PA 3H1EA 4P4LA 1WJGA 4E3ZA 1E92A 2PWBA 2WHQA 3O2QB 5HQJA 3ZHXA 3U4IA 1N6KA 2QSJA 4WZBA 1T3LA 3IVMA 4UBLA 1OFVA 2PAFA 1MTOA 4RJLA 5HK9A 1GGMA 4OQNA 2AQ8A 2PZLA 4X6LA 3CUEF 5E8JA 2PKQP 5K0TA 4YDSA 4CF5A 4WNCA 3H7AA 3MCVA 4KXNA 4XDYA 2WJYA 2JRLA 2WWXA 5A4FS 1HE8B 3NOQA 5DHRA 5U4QA 4EYEA 3QJ5A 4Z3KA 5KI6A 4WHMA 1UJBA 1BEEA 1NX9A 1D2RA 2G36A 3RHTA 1YOBA 3CWQA 2VYVA 3LCJA 3QVJA 4LBVA 1Q15A 4RANA 2Z2IA 2JF0A 1WUHS 5TJ9A 3JATA 1JDJA 5I7WA 1GZ7A 4XX0B 1KTIA 2P35A 5F5NA 1QU3A 2I9PA 1UK8A 2UU9B 2I78A 1JHDA 3PEWA 3H18A 3R7WA 4CT5A 5DH9A 1ORTA 3I6QA 2G1PA 2QRNA 5JT1A 4RVNA 4Y7CA 4KXLA 3KXIA 4FVTA 1XEXB 3IOMA 3VOBA 1OYYA 3OQHA 3HCCA 3AEQB 1P5RA 2WT8A 3GJTA 1VLQA 5IVPA 1K8XB 1SH7A 2D5CA 5KNDH 3HM9A 1IIBA 4C03A 3K8QA 4U9IS 5FV4A 1XMQB 5TQ0A 2RGGA 2FUKA 3RS4A 1PJLA 5IM4A 1QHYA 2ERYA 4IS2A 4LF4B 3AGQA 1GEEA 2VTBB 5DOZA 3UCEA 5I9IA 1HG1A 4MRMA 2EYQA 9GPBA 1U8TA 5ICMA 5IJWA 3U6KA 5FNVA 5KNCH 3CH4B 4NHEA 4G5OA 3VTKA 4JJ8A 4AP5A 4TWBA 1M5UA 2HTEA 2ATVA 2GZAA 1M3SA 4FMBB 4WINA 4TVSA 3I52A 4GOMD 2PU5A 1K1EA 4NE9A 5A02A 3AR4A 2OVBA 2JFPA 3EDOA 1HLDA 4RMNA 5IMBA 4EG7A 5GGXA 4FHGA 1V1RB 2AK3A 2HNKA 2FQ1A 2IYPA 3IIIA 1GT6A 2PMCA 4QGGA 1J00A 4Z0TA 3LDUA 1UC4B 5J9FA 3GJ0A 2HXYA 3JY6A 5EIWA 1ZOSA 4CIVA 3OOJA 2F64A 3TSAA 5ENZA 4B17A 1BCSA 5JPIA 4KU4A 4MQEB 4G25A 5CGZA 3GLIA 1Q0SA 1U8AA 3L1VA 4D41A 2RKOA 4IIUA 4R2MA 1NVBA 3VPDA 3CRVA 1ABEA 4I9FA 3THWB 2VAVA 4LRSB 3LRTA 1QNLA 3PFWO 3QUTA 3SJZA 4U7DA 1R18A 1MGPA 3ITEA 4GC5A 1JPUA 4LRUA 2DH5A 1QRAA 5B58C 3ICPA 2H8GA 3GFTA 1JKJA 2I6GA 4BKPA 2OOKA 4CMHA 2ETXA 5ES3A 3UOAB 1NX6A 1WXXA 2K4MA 1OX4B 2YXLA 1U90A 2JEZA 1ULAA 2Z3WA 3PIRA 4JYPA 4MVJM 3RIHA 3LUFA 3DFIA 3NHUA 4L9RA 2O2XA 3MT0A 5AW1A 4P4GA 3UM9A 3RYFA 1CZKA 2VAPA 1CUWA 5KC8A 4D8UA 1Y7PA 4G1EB 3NIWA 4HGNA 1QC5A 5SYAA 4FI3F 4GKJB 1EDEA 2GA9A 5LN1A 3DAPA 1VIMA 1GADO 2REXB 4X5OA 2YZGA 2ACVA 2GBLC 5DZSA 4DARA 4G8BA 2AR0A 3DZBA 3HDHA 1SUFA 1U7UA 4QBIA 7REQB 1PR9A 3FDFA 1E2DA 4Z0PA 2OV8A 4DIDA 1JDPA 2B7CA 5CP8A 3H5OA 4IGFA 1DCTA 5AOAA 2R1TB 3D2LA 4TTRA 4DLLA 1QLHA 1OBFO 3A9SA 3MCTA 2RDMA 4MKHA 2W90A 4MR8B 2Q4DA 2ZTVA 1Q5PA 5E6RB 3GJXC 2OKGA 1XPUA 3VZSA 4B45A 4DIOA 3SIWA 3D5EA 2PSDA 2XGGA 2ZTMA 2FVYA 4ZFNA 3KSMA 2OG2A 2WPNA 3N07A 1KDRA 1NJ5A 4OBBA 4F9TA 3ROFA 3HJUA 3W0LB 2N1BA 4OX9B 3I01M 2GRUA 4MA4A 2WG2A 3QKRA 2C9YA 4MKVS 4X85A 3WI7A 2W42A 4R0VA 2LGJA 2WJAA 2QJRA 5L3SB 1XK7A 3SBEA 4XD7A 4OY3A 3HTXA 7GPBA 2UUCB 4ND1A 4W99A 4DPMA 3Q10A 3WGOA 1IY8A 5DM0A 4ESHA 1G291 2Q5CA 2FSIA 5D3MA 2F3UA 4PO3X 3GRUA 2FFHA 4LMRA 4ILKA 1G0OA 3FOZA 3P9NA 4GKKB 5ERXA 1CQWA 4AG5A 3S70A 1MJ5A 4UAJA 4QBFA 3LLVA 3TQFA 2LE0A 4KE6A 1MQ8B 4UBOA 3ZD9A 2XTAA 3K0SA 1Z34A 2A1UA 3QOWA 2FSSA 2DWPA 4RKEA 5GJVC 3ZKWA 4M0DA 4BRWA 3ZCPA 4ETNA 1V9SA 3OG9A 2HD4A 1E64A 2RK3A 3E1KA 4PPFA 1ACMA 3F6YA 1NVGA 3BZWA 3ETJA 3ANTA 4MH0R 3R8CA 4BO8A 2CCGA 1ZOLA 3PVSA 3QVTA 3R0IA 5G02A 3UICA 4RHCA 3KJQA 3V80A 1JIQA 2JGJA 3T5TA 1XJ5A 3QXSA 3INNA 1P2SA 3UMCA 2H8KA 3JR7A 1U6KA 2IKSA 4Q01A 2X6TA 3A26A 2RGNC 3ABOB 1CJBA 2F90A 4LF6B 2Q6OA 4D3DA 1LLFA 4KFTA 4MQLA 1GOTA 3FE2A 3GUYA 3N3AC 3VKUA 5IARA 4D9GA 3KZCA 1CQIA 3D0RA 1V11A 3TIIA 3GNTA 1C3OB 5A1TA 1AKEA 1YS1X 3BIOA 4ZOEA 5LJIA 1T1RA 1EJ0A 1FVXA 2GYWA 3LUBA 2D1FA 4FR0A 1GUBA 4MJ7A 4YCJA 4ESEA 1JL3A 3OE7A 3SSAA 4G01B 1FBNA 1PFGA 5C1OA 5AVUA 2BBWA 1F6DA 3ZEIA 4L76A 3DD1A 4ZOAA 2HB6A 2GN9A 3DLPX 1J1ZA 1UBMS 3AF6A 3I9KA 2VPZA 3X2EA 2EKPA 3BGVA 1XRLA 1MVLA 2N3ZA 2Q0SA 1TLTA 3O95A 2OFWA 4LDPA 1ZK1A 2GCOB 1LS6A 2O9JA 2QMQA 1Y6QA 2H3EA 2PGXA 3BL6A 3ZWNA 4AMGA 4EX7A 1ZONA 1CY4A 2GXQA 3A2LA 4MHOA 4CUJA 4A36A 1XKLA 4D7AA 2QMHA 2B69A 5DBHX 4BIIA 1P75A 4OI0A 3H5VA 1SC3A 1BOFA 1QH9A 4QUGA 1PKEA 5G4LA 1RXSA 3K70B 1WU7A 1A72A 4QQNA 4JVLA 3CSDA 1XTKA 4PEVA 2PZFA 2I1VB 2DUUA 2P79A 4C6RA 4X66B 3UH0A 1YQ9A 1Q77A 4KXQA 3WLQA 5FV7A 3ZPXA 3N8DA 5E9JA 3RS9A 3OT4A 1EM8B 2IYAA 3K53A 1DBSA 1VCMA 4OHFA 5E3HA 1B8OA 1MC1A 1ZVMA 4BGIA 2BM8A 3CR8A 1RWVA 2PIAA 2ZIVB 4PINA 4RK5A 1GAXA 1K9VF 5CCBA 1YKGA 5REQB 2NZXA 5A4AA 3QBDA 4LCJA 4X71A 4B4UA 4QDZA 2IZ6A 3K5PA 1JIUA 4UU8A 5K3BA 2AZTA 2I1WA 2PO7A 4BLUA 5AKYA 5T64A 2XZOA 3NYRA 1GUDA 4HUQB 4DSUA 4G5YA 2Q9BA 2RGYA 4OHCA 2I3AA 4AKGA 2L42A 2P6UA 3FY4A 2VJLA 4YJ2F 1R0WA 3PNOA 4NAHA 2CXOA 1UOOA 2X7JA 3ZE2B 4OK6A 1B0AA 4ZO8A 4RVGA 1DXYA 4P3OA 5DHQA 5B7NA 2ODBA 1QFYA 4KR2A 2C5BA 2RC5A 4MMXB 4BRSA 3F6BX 1LRJA 2IDKA 3OQVA 2MCFA 3RH0A 3HYRA 3ROKA 2ZUBA 3L40A 4FFOA 1RC0A 1U9CA 3ZV5A 3A1WA 1JA0A 2D6FA 2HMYB 4AYWA 2O8FB 4REOA 1QF9A 3FMGA 3LWNA 4LJ8A 1HL3A 2YL2A 3UAXA 4F06A 2DBZA 4P3PA 2YFYA 3JQGB 5B2FA 1YDEA 4ND2A 1WMFA 3V1NA 4J0EA 4F8EA 1BXRA 1KJQA 3GLQA 4YAKA 4JL8A 4OLAA 4CIXA 2OB1A 3KVVA 5CFLA 3EPHA 1QHHB 1Q7RA 2OL4A 2C2KA 2XB9A 3GCGA 5GGYA 4AKIA 2NO9A 3D9QX 2YH2A 3MCUA 3FCSB 2ZYWX 1RSZA 2BHNA 2H7XA 2X9VA 4UE6A 3Q12A 5M3BA 4W7IA 4E1VA 4TL9A 2XE4A 3T4EA 1UK9A 1SUWA 4GP6A 1GPMA 4KXMA 1PZMA 3LFTA 3JQAA 3K31A 2ATIA 3MFYA 4KL8S 3B6ZA 2PJDA 4EUNA 4LFBB 1N8SA 3L0OA 3QWFA 2E87A 1YSCA 2EW2A 4A0QA 4C7KA 2AWNA 4F92B 3I5XA 2AI1A 1I3CA 4D9FA 4PZZA 5BOVA 2VHUA 1Y1KE 3MJDA 3X0DA 4OL9A 3DKIA 3W6OA 2ZR9A 4F4IA 3DEJA 3IEVA 1PL8A 3Q7EA 1E77A 1I5RA 2WHPB 5T67A 2AVNA 2QUHA 5JFGA 3ZKAA 4PW0A 4G85A 1GFSA 1TU4A 2D00A 1QLJA 2DMRA 5WRFA 3VDQA 4KQKA 3VPXA 5CAEA 1SXQA 2CHQA 3IOBA 4PX2A 1E9RA 4RXMA 2JBHA 2LKDA 4BEBA 2I80A 1UAYA 4DMCA 4QGBA 3GZNB 5EKSA 3GLIB 1C1XA 1W2GA 2YWEA 1N6RA 2DH6A 2Z1DA 4FNAA 1WMEA 4BVHA 3PUWA 1RAIA 2A33A 2HJHA 4FFBA 2NXWA 3EZNA 2ISSD 4Q37A 1FFBA 2I7VA 1VYHA 1NBAA 2AFIE 3IE0A 4O4JB 4DADA 4ZI7A 2XMPA 4JSTA 3TSCA 1FFSA 4AJEA 3WZ2A 3DB1A 1XMIA 4NQRA 3RUCA 3KQKA 2ECKA 1GPNA 4JI2B 4KIGA 2AOWA 4OQFA 1JJVA 3DLHA 1L4BA 1QFJA 3EQ6A 3N6XA 1SY7A 2P65A 4Q1EA 3HCAA 5E6RA 2W6IA 1D09A 4QPCA 4Q15A 4Q1BA 3SQOA 2P8JA 2F8MA 3EMKA 3OJCA 4RO0A 4JLKA 4YRKA 3A7EA 5HIKA 1VL6A 1PJAA 2CVHA 3A1NA 1ZXLA 1B3BA 4NQZA 3SJ7A 1QZUA 3WAKA 4A27A 1LBTA 3LUCA 2R4TA 3THXB 1WUYA 3NALA 2WJ6A 4FD2A 5LQMA 5A0FA 5JNVA 1HDGO 1MC5A 2JHFA 1AM4D 4OQ4A 4PFJA 2F1OA 3UGJA 2XMSA 3SNKA 3HB1A 2B2XA 2ZDGA 3JVDA 3PHCA 4HNAA 4RZ2A 4QSHA 5K0BA 5FLYA 1SIOA 3AF1A 2DRIA 3D3NA 4H2DA 3SDBA 1Y4UA 2W58A 4RVOA 2IZ1A 1GPLA 1NUPA 5ECYA 1ZISA 3GUVA 3SHTA 3KETA 3K70C 5EJ2A 1L3IA 2TYSB 4OXYA 2V97A 5DIZA 5EJ8A 5I4KA 4IEIA 3GPLA 4UASA 4MP3A 4YAOA 3PCXA 1CD5A 2HKIA 4F97A 4JIGA 3DKKA 4OQXA 1UINA 1HZJA 2Q4EA 4R8LA 1VJRA 2HMUA 2BMAA 3RJ9A 4KN8A 1SCUB 2PR7A 4Q4AA 4UMEA 2RI0A 3PC6A 1DKPA 3TIGA 3ZCUA 1EM6A 3T7TA 4B82A 3GJRA 5IDXA 1QH1B 4F86A 4Y0AA 4QTYA 2DFXI 1B0ZA 1Z29A 4LDJA 3RRNA 3S44A 1KMCA 1R6BX 3EBOA 4UZSA 1HF3A 5CDSA 2QLLA 3QU5A 5LP6A 1U1CA 4KR6A 1SKMA 4L22A 3CUTA 1YAHA 3ZTYA 2WQ7A 2ZSBA 3IA2A 1F12A 2VZ8A 5KYXA 2YOFA 5U4XA 3BA1A 2PD3A 3KFXA 4HJXA 4BV9A 4C76A 2QLNA 5IXJA 1D2EA 1MN6A 3RFCA 4KTTE 1DAHA 1FQJA 3H83A 4CMIB 3O74A 1J7JA 3R3YA 1NBWB 4KR3A 2AL7A 1MUUA 1WPGA 2AA3A 2FFRA 2VPXA 3NHAA 1FLNA 4QGHA 3GUHA 1HV8A 1PFQA 1Z0SA 2F1IA 2EKLA 3F7MA 1IIRA 1QO7A 3SHVA 3BWXA 2D13A 4GBED 4PS1A 1QCYA 5BNZA 4H15A 1T34A 4LDRA 4QWMA 5FI1B 4A1OA 1OFUA 1PR4A 1DMSA 2E55A 3BGOS 5CT5A 3RIEA 1QHFA 2VCEA 2ZS9A 3CF0A 1DCKA 4XOUA 4X91A 3UAWA 1GNTA 2WW8A 2YQZA 2HM7A 4G07A 5FTWA 4C89A 3CIOA 3RVOA 3RV3A 3YASA 1ISGA 1E79A 2JFYA 2ZE8A 3FI9A 4FS8A 2X42A 4ZDJA 3CCFA 1DAFA 3L0BA 3D3KA 3IJ5A 2JL1A 4Q3BA 3I73A 4D0NA 2FW7A 4UD2A 3ZWQA 4BVAA 1AHNA 1SRRA 3WB2A 5DP2A 3MRSA 2Y0PA 2CN1A 3A8TA 3FVWA 4LJYA 3EA4A 4M9ZA 4MEAA 3V32A 3EDRA 1T3GA 1UPFA 2PT7A 3O93A 4C1NA 1T2VA 3JSXA 2R8OA 5UKDA 2PGIA 3E5MA 1A9QA 1P91A 1WEHA 3EYAA 5CFMA 4CETA 2XE7A 2CV2A 4ZCQA 4S2UA 4ZVRA 2Y1GA 1H6AA 1ZSVA 1JQLB 2GPAA 5LQUA 2GZDA 4ENRA 3CLRD 1DJLA 5CVJA 1UIRA 4OMFG 2A1TS 3U7QA 3EQZA 2C9BA 5LVAA 3N2ZB 1K08A 5HUHA 2P9YA 3K0HA 4DLRA 5A4JA 4LVNA 1ZNYA 5ALIA 4G0UA 3ER8A 4H7FA 3H2SA 3V2UA 4ZGWA 4HTFB 5DTIA 2ZR8A 4II3A 4ZREA 2O0KA 2Y1FA 4UFOA 4G0WA 2X40A 4U7FA 5DT9A 2G63A 3ROTA 3W1WA 4M1YA 3ZCXA 4K8RB 4JZYA 3L5KA 1DADA 2CMGA 2J3MA 3BRSA 3D2BA 1IOZA 1QCCA 3ER6A 2ZZKA 1OU4A 2VDHI 2XADA 3EQ8A 3TNLA 4BNDB 2MOKA 5SY4A 2R1ZA 5DMXA 1VPTA 3QVOA 2ZGVA 4Q16A 3D6HA 3FFWA 3PWSA 1EUDB 4JAVC 1NC3A 1S6YA 4N03A 2WV9A 1TPYA 3RKSA 3HABA 3TRIA 1N5JA 1BW9B 1PGPA 1VIVA 4LGVA 1SZCA 4V0OA 4B4KA 5IZCA 4LISA 1NLMA 4L74A 1JDNA 4X63A 4Z1MD 1OXMA 2COEA 4NAUA 3ZI4A 1RRCA 2QRUA 4D9JA 2IOYA 2EZTA 3A4TA 3G68A 3EK2A 4OHUA 3AILA 2IITA 4PC2A 3ADDA 4B9AA 3LSYA 3C39A 5DFAA 1LXCA 1ZH2A 5FUBA 3AOEA 1KEVA 1I4DD 3C1TA 3DDOA 1ONOA 2R6ZA 3NBQA 4AZWA 4DR3B 2VHYA 4CKXA 2IH4A 4UE3S 1XRRA 1FSSA 3WWCA 3Q11A 2DPHA 3MD9A 4UDXX 3CQ9A 3WLHA 4F4DA 1EVZA 2FOIA 3C6XA 1KK3A 1QGYA 2CHFA 2G88A 1VSVA 3PFGA 1JSRA 2V7BA 3AIOA 4PBTA 4URUR 4KQHA 4Z0HO 1VRVA 3JQBC 3GAMA 3EW9A 4UTVA 4K8OA 3RS5A 5LKAA 4OXQA 1PTKA 1B76A 3FUTA 3OECA 1HH4A 5EEGA 1R0CA 3CEMA 3O6VA 2Q3DA 3OC6A 4RLFA 2XV1A 9ATCA 1IRIA 1VI6A 2NNLD 5BORA 2CXTA 4V0SA 1DEHA 3E23A 5BT8A 4YRSA 1E1CB 4H7KA 4ZICA 2UZ1B 3D6FA 3TNYA 1CRWG 2YBEA 4PZPA 4BNHA 1DCFA 3PJGA 1FRQA 4ARIA 1N6LA 1OSNA 4GZ3A 4F7WA 1NN1A 5TB5A 5AVWA 1DBRA 4G9GA 1ZNQO 3D0QA 4HZGA 5JVDB 1CK4A 2XKAA 3EA0A 2WYHA 4JYMA 3DTVD 2P2ZA 3MWDB 4TZ6A 2Q2OA 3C6KA 4ARCA 3W5HA 2CXNA 4FNMA 2ZPTX 2H16A 2CD7A 2WAAA 3EW7A 1Z6GA 1JSLA 3INGA 2JBAA 3SQDA 4GR9A 1VL8A 1WZNA 4CMKA 3DVAB 2J0SA 5ALTA 1R8JA 1KZ7B 1K7EB 2RCYA 2XCLA 3O3NB 5K01A 2WA2A 5BQFA 4IDHA 3V8VA 1WCWA 4ED9A 6LDHA 1BMFA 2AJDA 5TF4A 1CR0A 2OZEA 2XQIA 4EFKA 5C51B 3AUXA 3DPIA 2HN9A 1JRLA 3I83A 3D6TB 3IFSA 4O1MA 3VU9B 4EJSC 2QRKA 3ELYA 2WHPA 2VYNA 3UV3A 1TIKA 4O2LA 4GXTA 3WDLA 2IPOA 1R50A 4JEIA 1SVUA 3S28A 5K8TA 3PPYA 4ENUA 4ZVLA 1V26A 2EJVA 4XVCA 1HNZB 1WG8A 3CXRA 2O7SA 2WQZA 3HP1A 2OT3B 3RUDA 1RYFA 4ZPXA 4FE3A 2AJLI 2XIQA 2E4ZA 3LV8A 4BO9A 1Y4ZA 1ZN2A 1ZESA 2YNMD 4O2BA 1Z83A 4RVHA 3V7NA 4YIHA 2H65A 4YA6A 4J4BA 4ZRMA 1XP5A 4US0R 4BAGA 3G0HA 1JEDA 5BSMA 4JI0B 3I37X 4ETWA 2AZMA 1LPBB 3QBTA 3F4BA 4N12A 3CUWA 1TCAA 1ZU4A 2DKNA 3HWSA 3HJTA 3ECAA 4FONA 5G3YA 4RGBA 5LLSA 2C7RA 1NZJA 1PJBA 1KJ8A 4UXHA 1X94A 2NO1A 2AE2A 1G8YA 1NHWA 2VK1A 2FHPA 1LQTA 4MPTA 3C1UA 3RODA 4YFVA 3WOHA 4R83A 4JR1A 2QTFA 4HWGA 4JT2A 4KAJA 4PAWA 4W4TA 4ZVKA 4C22A 3GVHA 4Y2PA 2Z9CA 1KR2A 3LZ6A 3IIJA 2J31A 3W5IA 5B4TA 3OU7A 1JW9B 2JHCA 4L16A 2FR8C 1B0UA 2IODA 4L0QA 1OROA 2WUEA 1BDHA 3OJEA 1CR1A 1XZDA 3U80A 2FZKA 2VJCA 2EJTA 3AFOA 3K9QO 4O02B 4DUGA 1W85A 4OHRA 4AJ1A 4CMIA 4LRTB 1NDQA 4DCOA 1A7UA 1XU7A 3H1AA 2BGGA 1DC4A 1TMYA 4AJIA 4B2LA 1OJLA 1T8WA 4PY2A 4KK3A 3C3WA 4XGQA 3RBAA 1SCUA 2JK1A 1P1HA 4QHSA 4JJAA 4Q4AB 1S89A 4QATA 3RIXA 1XTZA 3VO1A 3OPQA 1Q20A 1N33B 2J7PD 3TQIA 2YXPX 3BWYA 2G8NA 1OVMA 1M9NA 2J4CA 4D26A 2I2XB 3A6FA 5EJ9A 2VRCA 3ORSA 1PEKE 1X1RA 4FSHA 3UKJA 3BMNA 3P7MA 4QUHA 4EATA 5JU6A 1TYEB 3QPCA 3KYBA 3WLLA 1HEIA 1V47A 3GEMA 1MLDA 5IAJA 1G8GA 4EAQA 2VZ0A 2VHVA 3KYDA 2IUFA 1T4CB 4IRUB 4KDFA 1TTHA 2Z58A 3BBPA 4UNSA 1ICIA 1Y34E 3NAGA 4URZR 4V0KA 2CYCA 4Q1VA 2MSDB 2ZJ4A 1LPNA 1HMPA 2OCDA 4D9CA 1RRKA 4NG4A 1NMZA 2IF0A 5FORA 3W9YA 4GL4A 3TUZC 5I7AA 4N7RA 1PJRA 2ZT8A 1OA1A 2QHXA 2F48A 3FZQA 1NR7A 1X7WA 3TZ6A 4KPFC 1QIEA 2OFFA 4C6TA 5LL6P 2YVQA 1MBZA 4S1TA 3Q8LA 4PZUA 5AWFC 4A8JB 1FPMA 2Y99A 1KXZA 3GLRA 2JA2A 4Q9LA 2CL5A 5NULA 1TZ2A 3WLTA 4QA9A 3ND6A 4KQ1A 4II7A 4YWHA 1K6XA 5HR5A 3E27A 1EDDA 5KYYA 1QS0A 1P4HA 1YE8A 3EUWA 3KPUA 1KAGA 3RS3A 3TOSA 3V1UA 3ZWDA 4DLBA 3OA0A 3DVLA 1S96A 2BW0A 3N86A 2BGJA 4YUXA 3RYCB 3H3FA 3ZV6A 5FTLA 1IEQA 1MA3A 1UBEA 2BFBB 2ZWVA 2FPXA 3TLMA 4UQLA 4N76A 3V7WA 1OKKA 1QWSA 4JBGA 3BQMB 3JQBA 3P9XA 2DR2A 4XARA 1DOAA 3OZEA 2J9FA 2O5RA 1TEHA 3G5UA 4FYJA 3UG7A 2WNSA 3ZNPA 4CEJA 2V0GA 5T8KC 2P69A 3PQ4A 2VHWA 2G9RA 4RAQA 4X61A 3D4IA 2ZJZA 1QIIA 1KZ9A 2R8RA 1M1ZA 5HTOA 3O8RA 5JI2E 1SU6A 1ZEJA 4CYMA 2D1YA 3WRXC 1DEAA 2BONA 1SHZA 3PPWA 1DEXA 2QRVB 3CC8A 3HC7A 5TEVA 4DT1B 2O07A 5H4GA 1AHIA 3O26A 5HFAA 4Q48A 4HLNA 4M0EA 2XRYA 4Y2TA 5AM5A 5I48A 2X4GA 1P1RA 2Z6UA 1ZA2A 3CVVA 4TYMA 4WZBE 5JAQA 3QWHA 4KMRA 2WZDA 1V1MB 1FP2A 1V25A 1Z36A 2DKOA 1S4MA 2R66A 3TTYA 1VKJA 3AIKA 3HA5A 2BFPA 2M6SA 3PHBE 4LDAA 4MS1A 4YS6A 3IOEA 5DISB 4KBGA 4B7ZA 1FTSA 1PG5A 2J0VA 3PFBA 1NBMA 2BP7A 1KRXA 1SMKA 2XNDA 1RJGA 5DGDA 5GIPE 1LBSA 3GLHE 1QYDA 4KTVE 4JYCA 3H2YA 1QDEA 2IL1A 2O8FA 1Z26A 1G0NA 1B73A 1HYQA 2GD2A 2QGFA 3IDQA 3H9EO 1QJCA 2EGGA 3DJFA 1C4WA 5CPBA 1JWLA 2QQ5A 1IBLB 1JDUA 3DEFA 2VQ3A 1NQUA 5ISMA 4GKAA 1X80A 2R68A 1Z6PA 1XMXA 2HMVA 1A4UA 3UHFA 4EI7A 3TGPA 4JLOA 1YB2A 2NZUG 4ZYTA 2OENG 3RVDA 1N2XA 4FDAA 1JHZA 5DNWA 5IKMA 2NMVA 2ES4A 3IKJA 1QGDA 4B4WA 3G6WA 3TLAA 2P30A 1KOLA 2QZZA 1QX4A 3L6DA 2HGZA 2E4UA 4HDCA 1K6EA 1HNNA 1L7DA 4NG5A 1GYQA 3DZ8A 4Q7EA 4RADA 1X3SA 3A11A 3ZGZA 3P26A 3DEKA 4ZPJA 4NMXB 5DEOA 1H0HA 3W79A 2YNMC 3N8IA 4EW3A 1TA9A 8RUCI 4JQCA 3DLIA 2EX1A 2ZSJA 2HSDA 3U3KA 4W5OA 3PFNA 1R2QA 3UUWA 2AG5A 2F3QA 5A9TA 1Z07A 3EIXA 3CZ9A 1A7KA 4GRDA 4NYMQ 2CDNA 2JCVA 3U4HA 2QSUA 2FPIB 4ISBA 1T9GR 3V6MA 5JC8A 4DB4A 2WM8A 3MOIA 5T4BA 3E81A 1Y6ZA 1C1HA 5G41A 3WIOA 4EQZA 4MWTA 1C7RA 1GR1A 4QDOA 1OBOA 4QOIA 3RABA 3UJ3X 1AXGA 3WWEA 2NV2B 3FCCA 4GS5A 2X8JB 4RH0A 4MS3A 3RUIA 4P92A 7AT1A 5IASA 4FWTA 1F5SA 3IPXA 3DYBA 3F3KA 8AT1A 2VDOB 1IY1A 3UJCA 4V0RA 4NCBA 2W0SA 2FKAA 3M9LA 4CKCA 3VUEA 3MMNA 3PQ8A 3EGCA 2FSVA 3U4GA 2E21A 4MCIA 4PHHA 3A3YA 4KLNA 4RDCA 1JHUA 5EMJA 2HQSA 1H5UA 4MUKA 1M6VA 1N6IA 1RRMA 3L06A 4FN4A 3T1OA 4ERNA 2ZIWB 4PX9A 4K2AA 3PI7A 4KW7A 1PNVA 1T35A 4EHFA 3ZVNA 3LDAA 1QG4A 2WU3A 1EXVA 3NVDA 1T2UA 4PSKA 4U1RA 4YDQA 1ZXXA 2BEVB 3COYA 3GDHA 3K7EA 3UIEA 4YJKA 3G5LA 5F51A 1ENOA 1EX6A 1K3TA 1U2TA 3AEKB 4M22A 2XZPA 1BQ4A 4RCVA 5LP6C 4B75A 3W34A 3GJ3A 1U3CA 3MELA 3DGFC 4FFVA 3OU6A 4CTMA 1W88B 2E4XA 3QMPA 2QL6A 4FYVA 5FI0B 1C9YA 4A0RA 4GXNA 4OXRA 3W2GA 4B4VA 4D2IA 4MP6A 5ITZA 1W46A 4DV5B 2R25B 2PGLA 2SHKA 4LJ7A 4OJKA 2C2OA 3O21A 3LT1A 3B85A 4D3YA 1FFYA 1FX0B 2PZGA 4AK9A 4AQ7A 1GG8A 2ZCJA 3KWLA 2J3HA 2QYHA 3EPPA 3RAGA 2H7CA 5JPCA 4DNFA 4R8MA 2W8BA 5EWLA 1PJSA 2LCQA 1E1KA 2GJ4A 3W04A 1FFWA 3DNFA 2C7BA 4MVJF 4RGQA 1DRJA 3ZDYB 4N48A 3KDPA 3A2NA 4WFIA 1LEHA 2OAQ1 1AZTA 4QC2A 3TRFA 5T4FA 3K2BA 2BUCA 4IHJA 1XD8A 4QXOA 4EVSA 4A2CA 3D6NB 4I0WB 1AN0A 3ZLVA 1RQ7A 4UVHA 4YRBA 1YQDA 1JFVA 4YO8A 1C5KA 1DNPA 1NMEA 4GFDA 4JI1B 1U2EA 4RKWA 3SD7A 3F1KA 1JXQA 4NFSA 4WN9A 3O3MB 2WYWA 3Q2OA 3IPCA 2GZ2A 3RANA 1K6JA 5ICFA 2WSSD 1II8A 1AE1A 2MSCB 2YWDA 4IGAA 2VDRB 2DTDA 1WZCA 5FJJA 4K6OA 4AUMA 3KYJB 2ZRBA 1Z0ZA 4WKPA 1BD3A 3A1FA 3MWDA 3O9VA 1Z5VA 4PN3A 3FVRA 2B3DA 3IELA 2NO5A 3CBGA 1UOEA 4KFSA 5FPPA 3SLGA 3UN1A 4DV7B 5KYVA 1EUQA 4MV1A 1GU7A 3VKFA 4JK3A 4ALMA 1TAGA 2IOHA 2PLAA 2C77A 4AZSA 1G38A 1E60A 4LXQA 1NUAA 2NYRA 2HYDA 4OQQA 4RY2A 1OA0A 2QUBA 2IXDA 4TTJA 1R0LA 1QGUA 2ZIAA 1E96A 4KG7A 4XM1A 4EO9A 3C3YA 5ILGA 3ZVLA 5H7XA 5C5DA 5TJHA 4WBSA 1MB9A 2JLQA 4MS4A 4TTVA 4W8HA 5AI6A 3RTBA 5IF3A 5IH7A 4B3TB 4BLWA 2QN6A 2B4TO 5ER6A 3OOSA 5EMKA 3WK5A 2VWHA 5BURA 3TD9A 2RGXA 1PRYA 4JA2A 5D1HA 1H3FA 2OHFA 1U0TA 3LLSA 3DVSX 3WGYA 3AFMA 1JHVA 1N9GB 1G18A 2FFJA 3DTYA 4NZNA 4BCDA 2JFNA 4E2XA 5BSEA 5F23A 1ITZA 4XVQA 5F7XA 2VCYA 3BK2A 5JNTA 3DXXA 4YRJA 3VYUB 1KMIY 4PZCA 2OXRA 3OZIA 3PP8A 5EE0A 3VHQA 3MMZA 1YL6A 2PHZA 2QV7A 1Q7TA 3CR7A 3LG2A 5JXIA 1L0BA 1XCOA 1J0CA 1XTIA 4MV0A 2BGKA 3DYIA 3KUKA 5L6LB 1U31A 3FHTA 1U6JA 3JAKB 1NR5A 2AD1A 1ZSYA 4LDZA 3CUVA 3UJBA 3WIVA 5DIFA 3RSSA 1EUCA 1PVDA 4C3OB 4MR8A 2QRHA 4BGVA 3U7FB 2WAXA 2J9FB 4G1VA 1P62B 1I5OA 1QIGA 2CLDX 1Q91A 2PK3A 3BORA 4PYLA 4QODA 2H2HA 3OO1A 3T5DA 4A0FA 2CLMB 3I8XA 2HJVA 4KHPB 4Q9DA 1SZPA 1UKZA 1OI2A 3IR6A 3P2KA 1KY2A 3NIGB 4OSOA 1FUYB 1QQ6A 2C2XA 2LBPA 4ND6A 1E8DA 4NL4H 2DKFA 1M2VA 1ZW6A 4EEXA 4BMSA 1CJSA 2DR3A 3U3RA 1F0NA 4O33A 4KCGA 5G0VA 1CUAA 1JQDA 2Q1YA 1CR2A 4KIWA 1MJNA 4M86A 2GS9A 2Z83A 4MYDA 5BR1A 3T5AA 3PQCA 3GV0A 3KQSA 3HPRA 3TX2A 1S2OA 2BLLA 1LB1B 1N3YA 1WM1A 2C97A 3AQ4A 4I4TF 3C4VA 1TLFA 4X8LA 1ZK0A 3HKCB 4BFTA 4C2AA 3A2KA 4X44A 4P2GA 4RUBS 1K2WA 3ZWAA 3WIDA 2ZQ5A 1WOMA 3CPSA 3FNIA 3HNOA 3E9NA 4D82A 2JCYA 2PQ2A 3HGTA 1YZLA 3KR2A 2VPQA 3PD1A 3TO5A 4HADA 1FJGB 5HA5A 1E2PA 4BJHB 3RFXA 3ANLA 2D5IA 1H22A 1ZVKA 4GI5A 2PE5A 1TO2E 2C61A 1Q74A 5ALGA 4HT3B 3QFTA 2CYBA 4C43A 1C14A 5DSTA 1IZ8A 1QLWA 1KQGA 1YF3A 4BUZA 3RC8A 2E9SA 1ONBA 3NCHA 5DN6D 2J41A 2QRQA 3LPLA 3NRCA 2IH5A 1RC8A 2IOQA 2WF9A 3PGKA 3WGKA 3ONDA 5EIFA 3WGQA 4L28A 4KQIA 1RQPA 4HRXA 5I8ZA 3A0UA 4ACBA 2QM8A 4IIXA 5EC8A 4UKDA 2B1JA 2F43B 4OX9Y 1RI4A 1ZC4A 1OWMA 1QAMA 2CZCA 2KS6A 3NPMA 5C3MA 4HEA1 1LK5A 5FOQA 1TZBA 3QNUA 3LTEA 5KYNA 2CL6X 2QPLA 2FX5A 1OFTA 1WSWA 1XSEA 4KZPA 2DQYA 5KPDA 3CTMA 3KOXA 3Q6MA 1ZJ4A 5KVSA 3I6IA 5LCXA 5B3LA 3TK1A 1NXWA 3ETHA 4HTAA 1YK1A 3CG0A 4AQDA 2COKA 4FIZA 4LS3A 3Q3CA 1HFWA 4BFUA 2X0KA 3QYJA 5EMLA 4BY9E 1PO7A 2IXGA 3E9QA 2YIVX 1ZUNB 2R4QA 5ALDA 5CDTA 4TMKA 4E4YA 4NU8X 4F2GA 5K6RA 1NOKA 3L4BC 3G2OA 4LZZA 4PWYA 2DHEA 2R8EA 3C3PA 4RKFA 1E2EA 3M2PA 4JC4A 2OCIA 3RVBA 4I1VA 4EG4A 1RTTA 3UENA 1QS0B 2AF4C 1J20A 1S9DA 2ZJ8A 2FRVA 3Q98A 1W8IA 2FUCA 2V4MA 2FE1A 2YX1A 1CX9B 2ZANA 2NXNA 2OFPA 2JFQA 4YRDA 4KJXA 2V7TA 1Z2NX 4LQLA 1SULA 2VBGA 1Q84A 5EXTA 1EAYA 3V7UA 1U5CA 4RPKA 2R5WA 4YJ2A 4WY8A 2R84A 5T3YA 5HG0A 1RAGA 2VP0A 3ZHCA 2WZCA 2UUPA 1VYVA 2H1IA 1K5HA 4W9NA 4Y2SA 1ZUD1 3WV5A 3VDXA 4LFAB 1DUVG 2AN5A 4QUJA 2RK6A 3GLGB 3NXSA 3MGBA 4R6WA 2PPLA 1PWEA 1UBLS 1E2FA 3KTFA 1R4MA 3QFRA 2X58A 2UVPB 4HCJA 4KKVA 1RFGE 1GCAA 1LZLA 1RZ3A 2H07A 1L8OA 3VR6D 2PX0A 1BE8A 1DP4A 2R6FA 2I66A 3ETDA 5K2MA 1NRXA 2A0FA 3JQ8A 5GONB 3ZGNA 4B84A 5E8RA 3F3SA 1PR0A 3DLAA 3TI7A 4X3PA 2GPTA 3ESYA 2Y8EA 4HSGA 3F6EX 4XUGB 1EUZA 1L5QA 1OZAA 3DOEA 4DLTA 4B3GA 4OL0A 3TGWA 1H2HA 2OP1A 3EUAA 4CM5A 3O1LA 4FK8A 4YJ3A 4C6SA 4MRSA 2PBFA 1O5IA 3O03A 1RAHA 1AUXA 5AIBA 3RGGA 2CUNA 4DV3B 4ZAVA 3G2LA 3KX2A 4KDRA 3FHLA 1VZ3A 4QO7A 2XPCA 3ESQA 3FOFC 1HT1E 4Y1FA 3UCXA 2I3BA 2FJPA 1RBLI 3FKSA 3R0QA 4J6EA 4M1TA 1GUFA 3F97A 3NM5A 1MENA 3B89A 5JZMA 3OEWA 1EGQA 3H2JA 2VSFA 4OQMA 2PANA 4RIEA 1OZFA 3BTOA 3CCBA 3MF4A 3VI4B 1HT3A 2Q2WA 4RZ3A 3EVZA 3IUEA 4XLLA 3ACDA 4DUPA 5C1IA 1RKQA 4HFJA 3CE9A 4YCMA 2QAJA 3IXMA 1MABB 1NSTA 5I7OA 1K8RA 4GBGA 3TZBA 4MARA 3LC7O 5IDVA 4DILA 4FB4A 2ZE5A 5KKNB 3R0XA 2VH2A 3CRW1 1M2OB 3AUUA 4I55F 4ZVUA 2QL7A 3CVOA 5C52B 1XVIA 2SCUA 3PRJA 2UYCA 3RNOA 3BWBA 4PPYA 3S68A 1CE8A 4E5SA 2ZYHA 1WW3A 3JARB 4LJ9A 3KBBA 5DHFA 5CDGA 3ICCA 2OZPA 2ESRA 1KAMA 2NU6A 3D1LA 3O4IA 3PC8A 1J21A 5AM1A 5HFNA 1EWYA 3UV6A 3N2EA 3WKCA 2YKGA 2D2XA 3ZZ0A 4QVKA 5K3FB 2HLHA 3I9MA 3SR3A 3TRDA 3L0DA 1YBVA 1SXJD 3IQFA 3WGIA 1F51E 2IQIA 3GRRA 3OZRA 4BVEA 1RXCA 1BROA 3NOOA 1WZ2A 3FCUB 1IBKB 4QJ3A 2HZBA 2QVCA 5GMOA 3CA8A 2WTUA 4N4AA 2FZVA 1OE0A 5FNVF 4RKYA 1KH1A 2D7JA 2XE6A 4EH1A 5FOSA 4YT8A 3PTAA 3RLIA 5EN4A 3CXUA 4G81A 4C3ZA 3L92A 2HWYA 4EUHA 4YMSA 1MIOA 3T34A 1N8KA 2W2QA 4DE5A 4C5BA 5TQ0B 1BDBA 4YUYA 1JPVA 1LSOA 4V2UA 2YHIB 4D92A 1AGNA 3G8CA 4L8WB 3NVKI 1E1RD 3PDIB 5DHSA 5FO1A 2H1VA 2HIHA 3D4OA 2IS6A 1OGIA 3OZAA 2WFMA 3EASA 4IOJA 4EGSA 2EVWX 3BHMA 3HZOA 5DB4A 3W78A 1UT5A 1TYBE 1YR3A 9LDTA 3DE2X 1Z2DA 2XT9A 4HB0A 4S35A 3V2GA 3LQ4A 4ISCA 3AKCA 4TRJA 1WSAA 1DAPA 1CRQA 3DPUA 3PQEA 5J2TA 2B92A 3H11A 3MCWA 2VHEA 4OK5A 4R7GA 3WOVA 1C7QA 4I6EA 3SIRA 3WMGA 5K0SA 4JVMA 1SQFA 5IANA 1UBHS 1DU4A 3HU1A 1LKZA 1NSFA 4LOHA 2JFHA 1X1EA 4Y98A 1FIUA 3OIVA 4JC0A 5ESDA 1VC2A 3F2VA 4I99A 1F17A 5E6UB 1UWVA 5HKLA 5IX8A 1AKTA 4RD4A 1XMVA 4XD7D 5BQ5A 1Z28A 5FWDA 3QI2A 4JQSA 4RKQA 2VHJA 4MEJA 5K6AA 4FLFA 3P2IA 1OFUX 1I80A 4Q1AA 4AUNA 3KOWA 3NEAA 1QRSA 1MW8X 3WB0A 4Q7QA 3N2IA 5AM0A 5CEEA 2JLUA 2GN2A 3U60B 3VFDA 1XZLA 4HYEA 4YI3A 3IAS1 4YAUA 4QEKA 4JLMA 3RSHA 4UMFA 4D45A 3MERA 1Z0AA 1F2VA 3AETB 1Y1LA 4AL4A 2C5HA 4HLUA 1S8FA 2Q6TA 2ATXA 3AIIA 1RHMA 1R7RA 5KNDA 1U28C 2XB2A 3NMUF 4CLXA 4RK6A 2B1GA 3FB4A 4GMGA 5F77A 1NU6A 3GW8A 4FGLA 2IYUA 1PT8A 4OH7A 4HXYA 4JP5A 2HHLA 1P44A 2DWCA 1YHZA 4LJAA 1KKMA 4WZ6A 5AHWA 3WA6A 2HHCA 4EPRA 1WBDA 3SBDA 2Z04A 1GLGA 1KEUA 3EF0A 4OPMA 3BEOA 5I9TA 3DAFA 3LRXA 4HS4A 1KO1A 4J76A 5CVVA 3PB3A 2HQBA 2ZJ2A 4YXWD 1MDFA 1OV6A 5CVEA 3WC4A 5IHPA 3AZPA 1PL7A 2P0EA 1RADA 2QE6A 4GR4A 3MPUA 2OGWA 5E95A 4YQZA 1QO9A 2EDAA 4XLZA 3LLMA 1YUMA 3R7DA 2X5OA 1X7XA 2LXNA 1P4AA 1P3JA 4NC9A 4AW9A 3B7GA 1VCHA 1Q0PA 2BL4A 1ZHFA 3HJAA 1BC5A 3JWEA 3N39C 3N53A 3PPIA 5JIBA 3O83A 4UUBA 4QRHA 4TMVA 5KX5B 3T7JA 5F5XA 4JV5B 2ZP1A 5C7YA 3N8HA 5G0SA 1M1NA 4JEUA 1YBFA 2QZSA 3LXRA 3N28A 4RM2A 1KMQA 5H80A 1CRPA 5I51A 2J5QA 1Z4NA 3F7TA 4BP9A 1CQJA 3JZFA 3WADA 2C5AA 2FWJA 2NP7A 3DR5A 1MB3A 1YIDA 3GT7A 1EFAA 2RHOA 3PE4A 3IILA 4JU8A 5B1HA 4FFWA 2Y76A 2WYVA 5HE9A 2L82A 5IJXA 1W36C 4FCTA 4XSVA 2UDPA 3WQBA 4XWAA 3GFRA 3OCYA 4L8YA 5LA6A 1P9NA 5JV5A 3CX4A 3ADCA 3U4DA 2I4IA 1VJCA 1JU3A 2C8VA 3Q3GE 2IU3A 1HZZC 3VSCA 2ZTLA 4H4CA 1CSEE 1HG0A 4DMKA 4G36A 1XTTA 2HCTA 4EL0A 2O2HA 3EIFA 3CGGA 1V8ZA 1FFGA 4WY5A 4FCVA 1WKVA 5HMLA 5IVIA 3UK6A 2GCEA 2VFAA 1RT9A 4CMJA 1LF0A 1P4SA 1RAFA 2QJWA 3B2NA 3DE1X 1GVNB 3MMSA 2D8AA 2FVXA 3Q9UA 3RTCA 8ATCA 2OVFA 2V5UA 3PHLA 4WXYB 4IEFB 2FETA 5J1TB 1FMTA 1J0XO 3ORFA 1H9CA 3SC4A 3N7UA 2EFEB 3X1JA 1SD1A 3EWIA 3SX4A 2GTHA 5GY7A 3T3GA 1PUXA 2L19A 4F4FA 3JQ8B 5GONA 2X9NA 4CF4A 2ZYUX 5ADHA 1ODJA 3RUPA 4P4SA 1A9PA 3ZXWB 2G1KA 1DRVA 1HYBA 1TJPB 1LX7A 3W3AH 2XZLA 1YVEI 3K4PA 4JROA 1RZUA 3O8DA 4Z7JA 2G9UA 2AI3A 4DQLA 3MWLA 1NXSA 4LRYA 5EJFA 4Y67A 3L8YA 1B2LA 2GD6A 2L69A 3QF4B 4TL6A 4RVUA 4EGAA 1GA4A 4BZPA 3CVJA 3VO8A 1YCGA 1JVBA 4AKTA 4B3DA 3ZWKA 2SECE 1V9LA 1GLNA 2XGMA 5HIAA 1VLHA 4L1KA 2ZRLA 3WRWA 3AJDA 1EUDA 3HA3A 3OP4A 3DEHA 5EE9A 4P3XA 1ZD4A 2XKBA 4NYJR 4MYTA 3GG9A 2JIDA 3C2QA 4X9XA 5AJHA 3H1FA 5HCIA 1MOPA 2GJ8A 4GX0A 4P7JA 5TGZA 1Y9JA 4MWCA 3AEXA 2XRFA 4PYKA 3B13B 4KAXA 3WO0A 1U7TA 1KDOA 2AMVA 3DZDA 3GG2A 5CB8A 3AVWA 1TF2A 3NGMA 1ODIA 3WL8A 2VEOA 3BWMA 4ARSA 3M34A 5BSFA 1GN9A 4M88A 1U1IA 2OXTA 1F20A 4E03A 1D2GA 4RMJA 4RTRA 3WBFA 2GPBA 3PE6A 5DV9A 3OQMA 3VYVA 1DC5A 2QTWB 3NJ8A 721PA 3WL7A 4R1TA 4RCYA 1TEVA 3FNHA 2GCOA 3AOEC 1PL0A 3E7FA 4PSDA 4U00A 4HAOA 2DPLA 3C8DA 2J32A 4MUFA 2P4UA 3PQ2A 1L5GB 4U5XA 4EITA 1SG6A 3WAJA 3U0BA 4PLVA 1C0IA 1O6ZA 2RHRA 1OTHA 2XUAA 2OV6A 2ZRDA 1W2HA 3FLEA 2CYAA 3GFQA 1VG1A 3KS9A 2WOOA 5JAOA 2BCJQ 1FF9A 1RXEA 3EXIB 1BKSB 2II6A 1TT7A 1UJ6A 2IPNA 2GA8A 1W76A 3FPSA 3HJCA 4MKGA 4ZA2A 4BAUA 4ZJZA 2NYAA 3O8LA 1GXSA 1PQWA 4ODIA 3QKIA 3ERCA 4FXOA 3QENA 5K8IA 2BMEA 1GYRA 4D9IA 3L6OO 3HXQA 1UJNA 4XJTA 5FKJA 4B76A 2ETVA 1DC6A 4F72A 1F2TB 1NSYA 4KUHA 4MV7A 4QU0A 4ITUA 4HMOA 3DAHA 2RHDA 4WNIA 3HBJA 5BY2A 1E3SA 2OM6A 1N5IA 1LDEA 1EVKA 1SOUA 4KJZA 4O4HF 1J0EA 2VTDA 1XRJA 4KGXA 3FDZB 1IAVA 4PN7A 1RRVA 1C3LA 4RY0A 3AVPA 1T13A 3TQTA 1RWXA 1R5NA 1EFRA 3MS4A 3T9FA 2ILVA 3T1HB 4Q3CA 1FYEA 2HRDA 1OR8A 5AXDA 1NV8A 4AG6A 4Q4CA 2V67I 2UYHA 3V4ZA 5HIJA 3DBLB 4CV3A 4WMLA 1TC2A 3IDFA 3F6CA 3LBIA 4NX2A 4TXJA 5BVHB 1C4XA 2I6UA 2DT5A 4HEHA 2GFQA 3PZBA 5HJ5A 5L8VA 1TRKA 4TXMA 2G5GX 1C9JA 2D5LA 2VTEA 3MAAC 4CKEA 2V7PA 1N2ZA 3ANMA 1ESCA 1TUBB 3K9NA 3N8NA 3VX4A 4K9MA 3WZMA 1HBJA 2PXCA 3H6KA 4UAVA 1QRRA 2RKWA 2PQMA 1UBUS 1ZGGA 2P7IA 3A28A 3JVUA 4L50A 2PJRA 1JSZA 3PQDA 5CRIA 1N5MA 3RASA 1EUYA 2DP4E 1AZSC 1DAEA 1CY0A 2W00A 4JHXA 4PHGA 2V6BA 5IU6A 3WLMA 2R8YA 1B00A 4BX2A 4I9HA 1IZZA 3A6LA 3T5BA 4KPEC 4WW0A 2VKQA 4AJOA 3IKMB 4G0YA 3HB0A 1C9KA 4HL6A 4A8PA 1YOVA 4MUJA 3EE6A 1UQUA 4Z1MA 4GPIB 1C3XA 2HDHA 1K92A 2X1LA 1VI2A 1UCFA 2QG9A 2ZJOA 4ARZA 2Y05A 3DP7A 2HJSA 3RVPA 5JZBA 2WPDA 1QF7A 3P4UA 3R1IA 2HF9A 4A03A 5LQJA 1QCDA 1ETHA 4G1MB 1RXWA 1C3JA 4QUAA 4M2LA 2J3EA 4KVZA 5K0LA 3O1JC 1XZAA 3B3FA 3MUOA 2JAPA 2LDBA 2QP3A 4XR4A 4PM4A 4DTCA 4GOND 3GX1A 4PE5B 4IIHA 2YRXA 3NH6A 3X2SA 2W6ZA 3OU2A 4MWOA 2OAP1 4GLJA 4ND3A 5C31A 5CAEB 1TPZA 3TTXA 4KMSA 2CJXA 2PZAA 1ECPA 2QSZA 5BN3B 4I55B 4LKOA 4W5WA 1U5BB 4TZKA 2ZUWA 5JHHB 2BFNA 1I1QB 2YJZA 4GNKA 4XKJA 2CB0A 5DGHA 1EI9A 2SNIE 5FR2A 2PS1A 3T12A 2HV8A 3DDWA 5T6BA 2FJ0A 2ZYTX 3ITNA 3UCFA 4RJTA 4BYMA 3W8FA 2C3YA 1D2CA 3SHQA 3T9BA 4CN8A 2FSPA 1SUPA 1MAAA 1YFZA 2CNBA 2P1ZA 2IT1A 1V3UA 3EDYA 3H6GA 4WOCA 5KC9A 1QE3A 2HFKA 2QX9A 5IBRA 5B6IA 1AKQA 3H13A 1CY8A 4B6QA 4YREA 1E5QA 1XZEA 3ZJ4A 3MM4A 3QX7A 5LIPA 2XGJA 1RQRA 1FFDA 1RE1A 3IQZA 3WDKA 3PEYA 4JUIA 3R7BA 5EQFA 4B48A 1HOTA 3CKKA 1IVSA 3OX1A 2WM3A 5FUVA 1LJUA 3DBVO 1E79D 2ZEJA 1JKXA 3LX6A 4X7PA 3VH3A 1U9IC 1A88A 1EVQA 3Q0TA 4WZAA 4MJXA 4DVGA 3C7KA 1GKLA 2ZUVA 5AW2A 4PSVA 4ND7A 3LQFA 3KB8A 1BWRA 4IICA 2A14A 3MJEA 4YC7A 3EGXA 5AMXA 2C57A 1NP6A 1RPNA 2ECQA 3N7AA 5LLDA 1IXZA 1PR1A 1P1JA 2F3TA 4RACA 5MN5A 3FB1A 3DMGA 4DOMA 2FA9A 2WINI 1UPTA 3PR2B 4AS3A 3Q6IA 4DCSA 5B6PA 4XYEA 4B47A 4HLUC 2GAAA 3ENNA 4WKNA 4DNQA 1MO4A 1C50A 4YUWA 2LUOA 1H05A 2G06A 4FNOA 3OH8A 3T3OA 4UTPA 2X1HA 2HH9A 2H4FA 3C98A 3DQQA 4I1YA 1OXKB 4Q3KA 1Q92A 3OEED 5J2TB 3LZCA 2MYUA 5SZJA 1G98A 1GGNA 3DKVA 2JLRA 2OBLA 1KR5A 3T3DA 1NI4B 2ZBGA 3KE8A 1N2GA 5FWXA 4OYRA 4DSOA 4HVLA 2ZWOA 1S1CA 1UF9A 5TY0A 1NU8A 4KWIA 3KT0A 2IYOA 5EE3A 3VU0A 5DCYA 1P2BA 1BMTA 3K5IA 4R5HA 5IFLA 2C00A 4JWKA 4L2IB 1DPFA 4C01A 3D3JA 4OGGA 1NLFA 3L7JA 4JR0A 5FF9A 1T5TA 4EW6A 3HRHA 4GT1A 5JQGF 2YCLA 5CA0F 4I2NA 1AQIA 1C8LA 1SBZA 3FZYA 3FM9A 2PJZA 3KEMA 1MRSA 1D07A 3O75A 4HSEA 2GUGA 2I7XA 2WC1A 3RV4A 1XLVA 4RD6A 1A95A 1VDMA 2PVSA 4DC1A 2ZT7A 4DRYA 3A1EA 2IEBA 1GZ6A 1TQ6A 3IUMA 2W6JD 4P3YA 2D1SA 4ARUA 5LQDA 1CUSA 2ZIFA 2JFBA 2YMLA 1O6BA 1YKSA 4YRMA 1RI5A 2QG6A 2RHWA 3F6RA 3GJ4A 4ZQIA 5DM2A 2DE0X 1HY3A 2HGSA 1HFEL 2IZ7A 2D0OB 3ON5A 1V5IA 3IALA 4J16C 2QRVA 4QYXA 4WLEA 5FCDA 4DMMA 4DT1A 5BOSA 4JUAA 1W9HA 4HH0A 4M0PA 4C0KA 2PBRA 4P3KA 5JSZB 4L78A 4RK7A 3WVNA 4LE1A 1MXHA 4FGUA 1E7QA 4X7RA 2H85A 2EBHX 1GSOA 1RP7A 1R4ZA 1F38A 4FQ5A 1C4OA 1RVV1 1IN8A 3LMKA 1BDJA 4D9EA 1X42A 2CSXA 4C3VA 1L5RA 1QBGA 4AIIA 3CEJA 3E1SA 4ZYZA 2QXYA 1YVUA 3R6DA 3P9QA 4LJ5A 5DHAA 4B9EA 2ASEA 5KX5A 1JEYB 4A1FA 4NR0A 2PYDA 3TBKA 2OCAA 2WF6A 3HMKA 4F85A 5KVVA 1V8OA 4R2KA 2F17A 3N74A 2OZVA 4G24A 4U2CA 5FWYB 3VR5H 2XQGA 2VPYA 2VF4X 2SICE 1V5WA 2GN8A 3LC0A 4D42A 2C4WA 1ZSNA 2YFHA 3EZ6A 4S1OA 1OAOC 2V69I 4Y2UA 4DB2A 1WHTB 1GQSA 3PVCA 5LZ4A 1JQBA 1KKUA 5GP1A 2YHBA 2J0UB 2PUGA 1XDBA 4JGBA 4NYIR 3LKZA 3UAVA 3PC4A 3UHOA 4IXNA 5LZ8A 2C7GA 5KTOA 4OHYA 3Q8WA 1ECGA 2ZWIA 4B80A 1ADJA 4WERA 4YO7A 2ZJ7A 2AFVA 1E9AA 2XD4A 5DCUA 4GMXA 4AECA 2Q2QA 4XOIA 2NU9B 1CBUA 1RMQA 2YV4A 4RTPA 3PXXA 4MYSA 2A9KA 4YPOA 3D0KA 4TTQA 3OJOA 3R0ZA 1GAQA 3HHPA 4YDHB 3NM6B 4P81A 4HUTA 1QIHA 2IOFA 5FP0A 1YIOA 1V71A 1SQSA 3OCWA 3DWIA 4CCWA 4IWNA 5A5VA 3TJMA 3Q4GA 4KAFA 1G59A 5D2CA 3DGEC 3ZNOA 3GLKA 4YRIA 1E2NA 4E12A 5KQMA 2FP3A 4LCEA 1QPGA 3KVNA 1N2CA 3Q1LA 1FXUA 3OZTA 2QWXA 3LX5A 2V9CA 4HAIA 4TL7A 5JCJD 1BIFA 1NJ8A 1RXYA 1XZNA 3DFFA 1T24A 3A14A 3ZHZA 2C83A 4MRVA 3LAWA 3FIJA 1LX6A 1XNHA 4OHMA 1JR6A 5CK4A 2OR3A 1YCDA 1Z82A 3A6KA 3DCJA 2RH9B 1VMIA 3RD5A 4B0PA 3MINB 2IX3A 2IYSA 5A2QA 5JPDA 3VNUA 3H99A 3PC2A 2HA7A 4GIBA 4PYOA 3NTQA 3JZAA 3O73A 4LYFA 4MCJA 2CFRA 2DHDA 4V0NA 2GO7A 4QELA 2VNHA 1N9KA 4GEKA 3HJHA 4X7BA 1IQUA 5CPFA 5KOJB 4WT7A 1NR1A 2P1DA 1H8HA 4M37A 2XTMA 3W2TA 2PTGA 2I03A 1SVOA 1XYYA 3GQVA 3V4FA 5DGIA 4PG5A 1X87A 1NXTA 1Z47A 4HHHS 3K9WA 9MHTA 4RULA 2V1XA 4LTNA 5FFFA 2EX4A 2HT6A 3ZOZA 1T9BA 3ZY5A 1J39A 1W48A 4U2DA 4X6UA 3ZX4A 4AJKA 1L4UA 1WAMA 4H3SA 3LT4A 2PKWA 2XAAA 1ZRHA 3IDZA 3WZLA 1RABA 5D1NA 1SXIA 3RVNA 1YB6A 2KM1A 2BLNA 3GD5A 3V4OA 1RJDA 3AVTA 5ANRB 1KQPA 4GI2A 4D5EA 5FX2A 2FMIA 2GH1A 3ZHYA 1BFUA 1YU9A 3HKDB 3KR1A 3L3BA 3GRKA 4BNFA 4D4JA 3MYYA 4ZAGA 3JV7A 1TKBA 1G5HA 1UODA 3O84A 4BX0A 4NVRA 1L2TA 4D9BA 2C7OA 3P9PA 4RJJA 1GNVA 3Q7QA 1MB0A 3NRBA 1Y5RA 4MHTA 4M36A 5KTYA 2AW5A 1Y3FE 1NBIA 4FGJA 4Y1EA 4EPXA 4EG8A 5ELMA 4TS9A 3MTJA 3KQHA 2WJVA 3NXKA 4BNUA 2GK6A 2C92A 3C3CA 4FDUA 2XXBA 4BLQA 1YZGA 1BXKA 2QLMA 4WZBB 3RS0A 5JXJA 5DWVA 1FMCA 2JNWA 2YMQA 2PX3A 3HDVA 1SBYA 3WWYA 5LMCA 4LHWA 4WDQA 2XF8A 5ED4A 3LS2A 1X39A 2VHQA 2XJ4A 3C0KA 2W2MA 2YW9A 1OAOA 4OYYA 2JKYA 1CF2O 2V63I 1T4BA 4W8OA 5ESXA 5HXAA 2HWUA 3W9SA 4EJFA 2JLZA 1THMA 2WAOA 3K6SA 1DG1G 3GBVA 4QEZA 4F0KB 1Q22A 1R3DA 2Q49A 2R5FA 3C6ZA 3EUEA 2C2WA 5EKUA 4EA6A 5FI5A 4Y2VA 4MS4B 4YQFA 1X7GA 4WVLA 5JDIC 1ZRMA 1CUYA 1Y8RB 3BFXA 1PR5A 2G9QA 3K2IA 1U6IA 4TUYB 4TUYF 2GBCA 1I10A 5F4ZA 2DVMA 3MTAA 2W6QA 4TS4A 5B2ZA 3U3JA 3FMFA 3DKRA 3MUFA 3LUJA 1UP6A 1G20B 1LBHA 1UMCB 2XKKA 1WQ4A 4A7PA 4KIJA 4XASA 1DUSA 5E4FA 1VBKA 2VVTA 5BV1A 2PA0A 5BRNA 4J3NA 4QYTA 4Z9BA 1XDGA 2PUTA 1QHEA 2LZ0A 2VTBA 1JDBB 1YB1A 3I23A 2G8LA 4R8RA 4UULA 2QZ4A 4HF7A 1UBGA 5CH3A 3VZQA 4DXHA 2Q1WA 4F21A 2D0PB 3WGHA 1IJFA 5C7LO 4N0PA 1PF7E 1XJ0A 4J2TA 4MAAA 4B3SB 2P6PA 4U9UA 2KQUA 5D6OA 5KB3A 4PAGA 3JAMA 5BVGA 2YWFA 4NENA 3M6AA 2H1FA 4YR7A 4XXHA 1MHPA 3R9KA 4D3XA 1ZNZA 5L6MB 3R3ZA 1DI0A 2PMWB 4R98A 3ZUPA 4MVJI 4C0LA 5EGNA 3TTVA 1R5OA 1S01A 4XQEA 5J4KA 3ZZUA 3UK2A 1EP3B 2HADA 5BV7A 2RSLA 2ZCUA 4RSHA 1D7OA 2Y27A 2GAIA 1AIPA 1UL1X 2NAFA 4LC9A 2GZ1A 2G1JA 3HDTA 3LO5A 4PX3A 2PDAA 3A0RB 3G9QA 4HGPA 4ZV9A 2OYCA 5ICCA 2G3YA 5FL3A 5K3CA 5KVCA 2FEKA 3T1YB 3HKCA 3Q7IA 3LUGA 4LHZA 1M34A 1PQ4A 3MQ2A 3FWZA 3IJEB 1WLSA 4WUTA 5FOWA 5EHZA 1HX7A 2IYZA 1VKNA 1V8BA 3RREA 4ZYWA 1U1EA 1OWPA 1E7SA 2O8BA 1TO6A 2DPMA 3KEOA 4IDDA 3D3WA 1KQFA 4QGAA 4KQMA 1F60A 1HDRA 3DOUA 3H42B 5EIHA 2P3LA 4CMEA 1PGQA 4WAUA 4J07A 3Q3HA 4TKUA 4AC9A 4D98A 1OVGA 1SXPA 1M0WA 3HSYA 2JLXA 2CD9A 2EWWA 3PGMA 2HEIA 3GRYA 4HMPA 5K8LA 2A6PA 1ZNWA 3AFHA 2I4MA 2B21A 3IE2A 1Q0HA 2J9RA 5E3IA 3UTCA 5L3QA 1KZ1A 2AG1A 1U8YA 4N82A 1E2GA 5EZYF 4BMVA 5B4VA 2PNFA 1FLDA 5DRTA 4LG1A 4IKOA 1JR3E 3FW1A 1R6UA 1ECBA 3VO2A 4YRZA 1BXNI 4EY6A 1GLVA 4DLVA 4F4JA 2M6RA 4CR7A 2GKGA 2YHUA 3AM3A 3GRZA 1YBAA 4QFMA 1WCXA 4ALKA 4YPFA 2UZ0A 3NNNA 4K9QA 3LVBA 2BFMA 3GPDG 4X1IB 4YAGA 3OIUA 5LQSA 1T1JA 1KO7A 2PMDA 1T1IA 1Q11A 4HGZA 4MWZA 2AHOA 2WYIA 3E15A 1Y3BE 3F4LA 4FWBA 2WPDD 4DCTA 1V48A 4EHJA 4ZCSA 1EINA 4OTZA 3VA7A 4JDUA 3DOJA 3DEYX 1GD1O 3G17A 3FOAA 1J8DA 1VJ5A 2ZJAA 3FNQA 1BG6A 4HAZA 4IH9A 5AHKA 5FB3A 5KDDA 1WLYA 2AUMA 1KKLA 5LFAA 2F59A 1Q0RA 4MVXA 2PZ8A 3K1ZA 2H92A 1W5SA 2XJ9A 3TBFA 2A8YA 3U16A 2JFZA 2PUHA 1GPUA 1UMBA 3ILVA 2P9BA 3OAAD 4HWRA 2PMKA 5BMVB 1L5MA 5KBYA 2AXPA 2Q5OA 5FFMA 3T0FA 4IKEA 5DSXA 1HURA 2XXJA 4MKIA 2BGMA 3OFJA 2MSLA 1ZUHA 2MINA 2XQVA 3RJZA 3BZBA 1Z18A 4XWOA 2FB9A 2JZOA 4RCZA 4B4OA 2G0NA 1O9HA 1JF8A 1DX4A 4JELA 4KPGA 5F2OA 4AY2A 1RCFA 1SVNA 2EFYA 2CJWB 2UVPA 4YP7A 5HS6A 2M6LA 5BN5A 4YRTA 4BX8A 2FXIA 2HO5A 4AJ4A 3NONA 2FLWA 1CRZA 1H66A 1CUUA 1RPJA 3QWAA 4QUDA 3UC9A 3V4LA 4ADSG 1H65A 1A7JA 1EIZA 3TEFA 4DV1B 2NNWB 4E33A 3HB9A 1BXRB 5K0JA 3DTVB 2V7QD 3INYA 4JI6B 4GYJA 1YFLA 3CX7A 3EUFA 1B1AA 4Y6SA 4AF7A 1G17A 3QLEA 2C5GA 3ROXA 4CDNA 5K20A 1KYZA 2QTBA 3LQKA 2FHSA 4KI0A 3E8MA 2DCMA 3DPSA 1I8TA 4EQ6A 1UFQA 3BD9A 3ENWA 4QXMA 4O2AA 2EP8A 1SCIA 1T25A 2PFGA 3AONB 3IKLA 5HWSA 3WSWA 3A05A 3HQ4O 3KAPA 4PYIA 3HO6A 1VKHA 4M8LA 4RL4A 4CL8A 1KOGA 3SC3A 3CMCO 3H9BA 2BCGY 3FVQA 2Q21A 4RVSA 3TSYA 4TV8A 1TZMA 2F4VB 1GZ4A 2PUFA 2OMKA 1N6PA 1NXOA 1D9XA 2VT7A 1AV7A 2CB9A 3IBSA 4FE4A 1VPDA 2AIRA 3RS7A 1GPYA 2Z6QA 1OW3B 1RYNA 4LYHA 5GPBA 4G8JA 1EM8A 3E9DA 5E7QA 1FU8A 2XA9A 4KSCA 4QVIA 3C6QA 5IT0A 1N1DA 4G56A 4PZEA 1T2FA 3HWX1 2OD9A 1GDHA 1VE6A 2BUBA 3O8OB 4IG9A 4RFSA 5JY6A 5AT1A 5HOQA 4XAQA 1FP1D 3Q15C 3WX0A 3BDAA 4QTTB 5AKGA 1DDIA 1FUUA 1GL9B 2I4NA 2J0UA 4FBLA 3S7TA 4OOEA 3U9TA 3OUTA 4KNVA 3MTDA 4UQPA 2QIOA 3CZQA 5G1PA 1DCMA 2BGIA 3KKPA 3NUQA 3WXBA 1Q1NA 4QULA 3SS9X 3WNQA 4KQ2A 2JJ8A 2AGVA 4JYBA 2NU6B 1G20E 1YJBA 2ZYIA 3ZYCA 4DV0B 3C5HA 2OGSA 4ZI7B 2OP0A 4XJVA 1M67A 1KSFX 1PNRA 3IHWA 1O58A 4EZEA 1VL1A 1XJWA 2R0QC 1L1RA 1FYFA 3OFND 1ZGBA 3NUZA 4I4NA 3VHLB 4AZ0B 3KFVA 4OP3A 1MCZA 1N8NA 2WG0A 4QQRA 3SFZA 3NI2A 3QKWA 1G5QA 3N70A 3THXA 4PANA 1OT3A 1KK0A 3ICQB 3JD1A 4FYKA 3ND8A 3X1MA 2X9LA 3SNHA 4W7SA 1Z8DA 2JFWA 1UXGA 3IULA 5ITZB 5EWJA 4ZMBA 5I4IA 3F73A 1WSBA 4TXHA 1E4YA 2ORED 1F5NA 5BUZA 3UV7A 4Y6GB 2ADOA 1MVOA 1FTNA 3N59A 2V0NA 2YJ6A 3PJFA 2A9JA 2J3JA 3GFVA 3IOYA 2R4UA 4X90A 4NARA 2Q9UA 1P5FA 2P75A 1YIAA 4MIEA 3HKEB 3LFUA 4C0WA 5KVQA 5B6JA 1WB9A 1NUSA 5EESA 4Z4QA 4LX0A 3OZUA 1LV7A 2V9ZA 3K0EA 4LKRA 2C4KA 5BMOA 4FMCB 2OC9A 3LHSA 4H3KB 4JB8A 3ZBPA 1NE7A 1GA1A 3GWGA 3I09A 4JUBA 4D4MA 3CUSA 4MJLA 2BRUA 2QQEA 4A3SA 2BHTA 1Y5LA 2XOXA 4UDOA 1UPUA 2JAUA 4MWEA 2RGRA 3IQIX 5IXSA 4IF6A 3CF4A 5HF8A 3GNQA 5TMEA 2IUYA 4H4DA 3X1ZA 5I8WA 1XD9A 4HNUA 3BCUA 1NLYA 3DMFA 4O4JF 2FCRA 3G5TA 3WYGA 1G8JA 3FSGD 4FEGA 5EJGA 2Q29A 2WZQA 4IMJB 4QICA 3UPUA 1QYWA 3I9FA 3OZWA 1DBWA 1RCUA 1T8PA 3DZFA 4R31A 2XT0A 4B32A 5K0ZA 1IOVA 4RS4A 3R8FA 4IKPA 3ZCVA 3ICEA 4U6SA 2PKQO 4MUGA 3PIIA 4ZK2A 2N0SA 3VVMA 3NOVA 4WIAA 2BR4A 2AW3A 2IXEA 3O82A 2VF7A 3D7KA 3RYHA 1NJ2A 4CDRA 3STWA 4D3SA 3B5IA 1AV6A 1DQZA 1YV9A 4LE0A 3NAZA 2BFEA 2NZ8A 4ZCRA 1UIMA 3FWPA 3RK4A 2IHYA 2CDRA 2OV3A 2FG5A 4RTMA 4PR0A 5HM8A 1H42A 4G4SP 1B23P 1G6KA 4UREA 2C8JA 4M0CA 1MV5A 2QZPA 1WHSB 3OQJA 4GM1A 2GZRA 4DEVA 2OSBA 3QLVA 5DN6A 4EI2A 3AY0A 2GPWA 1MNAA 2EKQA 4NCIA 3LGXA 3KK0A 1U9YA 1VE3A 3JAKA