3UWOA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
194
Chain Sequence
GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
total genus 79
structure length 194
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwoA00
3I92A 3BORA 1PVOA 2V4ZA 1I4DD 3WP0A 5C1BA 2JATA 4M1OA 4JBYA 2XJ4A 2CNWA 4Q1FA 4KLZA 3VU9A 1JQJC 2O8BB 4JVNA 1T4GA 4M8NE 3N70A 5AJXA 5FL7A 4Q48A 3KQHA 2PMKA 2Z4RA 2WJJA 3FOZA 2BHRA 1C9KA 3NTUA 5DN6A 2ERYA 3J81k 5AUQA 4IEIA 4LI0A 4M1KA 1HV8A 1G7SA 3CZQA 3K0FA 3TGPA 2BC9A 2W00A 4HLUC 3S1AA 3R7WA 5FOUA 5LDDC 2YYZA 4D80A 1EFCA 1KZGB 1QVAA 4H9GA 1XTIA 4ON9A 1SXJE 2WICA 4FMCB 2V6JA 5IRCD 4KFTA 3HWSA 4D4KA 3FMIA 2WTUA 4LHWA 2HJGA 3MRSA 3PUWA 2HUPA 2Q9AA 1S3GA 3KKNA 4FMDB 4LZZA 1YVDA 3K9GA 2FGJA 3E2IA 4Q7MB 1Z0IA 5DSZA 5CLLA 1YHNA 2W2VA 5JI3E 4ZI3A 1OLOA 4UNRA 1OFTA 1S1MA 2C95A 1BO6A 3U61B 1S4QA 3MG9A 4AC9A 1OKKD 5G53C 4EQ6A 3L8ZA 1E2LA 1P9NA 2VYFA 1VDZA 3TAUA 2ZAOA 3ZQ6A 3ADKA 1W47A 2QENA 4KBFA 3Q5DA 2DB3A 4HAYA 2DYKA 2O8CA 4K81B 3BH0A 3R9WA 5J40A 3EA5A 1AS3A 4Q4HB 4IRUB 4TLCA 3L8YA 4PPFA 4CGZA 2X2FA 2CLCX 3DOEA 2G1JA 2IWHA 3PXGA 2RGDA 3FWYA 2XX3A 4KHZA 1Z6YA 3D7MA 5GJWC 2BMJA 1OFHA 2FMXA 5DHFA 1Z0DA 4A2WA 3TR5A 2HT1A 3SJAA 1OKKA 3VHLB 2EFGA 1WDTA 3LWNA 1W0KA 2ANBA 4F92B 3Q7QA 1TF5A 1BOFA 2J7KA 2J5XA 4ILEA 1TUEA 4MRPA 4EPRA 1DVRA 2WPDD 2CDNA 1E4YA 1E9SA 4NCHA 2CL0X 2A5JA 1Q20A 3LV8A 5JSZB 2WZQA 3BXZA 4JLDA 1ZU5A 5AUPB 1W4AA 1SZPA 3I61A 2VO1A 4RKEA 3RANA 2P0EA 3NWJA 4LBZA 1UADA 5DH9A 2RB4A 2XB2A 2OT3B 3AVQA 1CP2A 4BZPA 3BJIC 1KKMA 1W5SA 2O0KA 4M21A 2CHVA 4TLBA 4P33A 3IBGA 1NNEA 1EFUA 4F38A 5AJYA 4C0AC 3D31A 2IYZA 3FDIA 4NYIR 5LD2B 1M7GA 1NVVQ 3GFOA 1MOZA 2FPLA 1E9EA 2OM2A 4G5SA 4LOAA 5FPYA 2ZS8A 1KNXA 2WWYA 5B2ZA 4G5RA 1R0YA 4Q5IA 2FFAA 3O8DA 1XEXB 3K0CA 4KFUA 2B8WA 3P27A 3SQWA 4IXMA 3QPWA 1F60A 2I4IA 2HDNB 3V4FA 5KNBA 4F93B 3R9IA 1KI9A 1ZCBA 3GLFE 4LYFA 1COWD 3TUJC 1VTKA 3I72A 1LW7A 4GRAA 3LAWA 1GILA 4I1OA 3QKSA 4FWTA 1E94E 3LVRE 2WAXA 4GNKA 4V0LA 3UIEA 2X1VA 4E03A 3ZD6A 3NH6A 1YRBA 1DADA 3FTQA 2R6AA 1DE0A 3GJ4A 1VKJA 3I3SR 3GMTA 1E4VA 1KSGA 3OE7A 4B35A 3P4XA 4RD6A 2WAYA 1XX6A 2WIBA 5TXGA 4MRVA 1G3MA 2VP4A 1QHHB 3SYNA 1E96A 5JS8A 4ESVA 3ADCA 2J59A 1S3SA 1CR4A 3CZPA 2QTHA 1H8HA 1ZD1A 4EDHA 5JJIA 2CMKA 2XXAB 4IDNA 4Q9HA 1FUUA 1AQYA 4TWZA 1II0A 2C8VA 3I5XA 4C2TA 3BOSA 3K53A 2VHJA 2JDIA 1KO8A 3TSZA 2WMOB 2PCLA 2FDCA 1FX0B 1U2RA 2P5SA 2R2AA 1F2UB 1KI1A 3GJ3A 1K5GA 4PC6A 1E2EA 3KX2A 5A5GA 2IYWA 2F1RA 1KDRA 2GDJA 2NO7A 4GFDA 4IOJA 1CU1A 3BFKA 3CRRA 4Q9JA 2QEQA 1OF1A 1W0JD 3WYAA 4ZDKA 5EQTA 1ZINA 3VFDA 1E9BA 1W36D 4IDHA 1JEEA 2F6RA 2IYRA 2DPXA 3ZZUA 3K8YA 4LYHA 1CLUA 4IXNA 4LJ4A 3QXCA 4CYMA 1QG2A 4DJTA 2W0SA 3CF0A 3CX6A 2H57A 4DDTA 4OHYA 3CM0A 1TNDA 1AM4D 4CEHB 1G21E 1U0HC 2GETA 4WVFA 4C0LA 1AZTA 4TL7A 2WWFA 2C9CA 2GJAA 3RC3A 1QHGA 1AKEA 2HF8A 1ZNWA 2QY9A 3B1YA 3U7HB 2DFTA 1JR3E 2ZE8A 2O8EA 1ZCAA 3QEOA 5EP2A 4BECA 2FN4A 2OEPA 1M74A 4V0ME 1KTVA 2IEZA 3WHLA 5E95A 1KIMA 1S8FA 2PBRA 1X3SA 1E79A 2OLJA 4YONB 1E2KA 4Q9IA 2HV8A 1D8TA 3V9PA 2ORVA 4NMMA 4N1AA 3BFVA 1OIXA 1KK0A 2CVHA 3DZ8A 2DWPA 4M1WA 4CIDA 4AYTA 4EJSB 5JWOA 1E0JA 1DBSA 1KOFA 2KJQA 4IOMA 5TVKA 4K46A 2ZRCA 5B30A 1DG3A 1ZYUA 4LYAA 4B6FA 3QUSA 4QKQA 3NG1A 3UWKA 4TYNA 4PFSA 2BM0A 1BYUA 1O3YA 1RC8A 2EVWX 1E2NA 4Q9KA 3QY0A 4A6XA 5BYKA 1XTJA 1T3SA 1G4UR 1UAAA 2RGAA 5HKKD 3DO6A 4S2EA 1P2UA 3CUEF 1N6IA 1OH6A 4IFBA 3TQCA 4KYUA 5CJPA 8OHMA 1OYWA 4TZ0A 3RS4A 1GOTA 2XOKD 1RKBA 2VP2A 1SULA 3AVTA 2YOHA 2GCPA 1K5DA 3QG5A 4OI2A 4Q4AB 4WZ6A 1UEIA 1YQTA 1Q21A 4LBWA 1G41A 4O3MA 3CRQA 5JWRA 2FX3A 2H5EA 2ZETA 4B48A 2WVJA 2MSCB 4DSNA 4CEJA 1VHLA 2FF7A 1NKTA 4TYWA 2C5LA 2A3RA 3AKDA 2AX4A 2OCYC 2G6BA 4LRWA 1T0HB 1XJCA 4RFVA 2IYYA 2XTNA 2WMNB 2Z83A 4TQAA 1JXMA 3CWQA 4QGHA 2ONKA 1E9CA 2IUSA 1DPFA 1T3LA 3HPQA 1P75A 2OCAA 3LQRA 2Q0HA 2YV5A 1RPZA 3GD7A 3A1UA 1U0LA 3QPVA 3T5DA 3IQWA 3ICQB 3CX8A 4HDQB 3DKPA 3GEHA 4Q47A 3FB4A 1UM8A 1R0ZA 2FSHA 1C4OA 1GKYA 2NPFA 5LD2C 1G3UA 3LFUA 2QP3A 3LLMA 5GJVC 2YWHA 3MFYA 4EPWA 4RZXA 1IXSB 3A1TA 3QQ5A 4LHYA 2PCJA 2NQ2C 4Q1AA 2A5DA 4D0GA 4D81A 3X2SA 2ZANA 4AY2A 4Q1DA 4CEIB 2A5YB 4A2PA 2QE7A 1M34E 4WZAE 1CXZA 1QF9A 3BERA 3U7FB 3B6EA 3KXLA 5J4KA 4TYQA 4NE2A 2F43A 2HXYA 2VSXA 2V3CC 2CCKA 2RKOA 5BYJA 3K0EA 4QJ5A 5FTLA 3RS2A 2ZUCA 2YWFA 4HZUB 4U7DA 2IF2A 1WB9A 4C7OA 4D4LA 3X1XA 4IKEA 4POAA 1IN7A 2ZJOA 1CTQA 2FPMA 2EYUA 1KI4A 3VR2A 1G18A 1VCOA 1U81A 1X86B 2IHYA 4RVCA 2NMVA 2QG6A 4A8JA 3JVUA 4CVNA 4HDCA 2E9SA 3VTKA 2IXFA 5C46F 1BYIA 3H86A 4W7SA 4DEXA 5F9FA 1YR6A 2QAJA 2OFWA 4OJKA 3SS8A 5DI9A 1P9WA 1Z6GA 1Q44A 3IO5A 3JVVA 3K0CC 3PENA 4B74A 2H1LA 1Q1BA 2G77B 2WBLC 2PZGA 2QAGB 2IS6A 3KTAA 4A0RA 5JRJA 2ZI6A 1ZNYA 1JI0A 3LX8A 5ANRB 1Q3HA 4NCKA 2P65A 1D2EA 4WIAA 2F1HA 3A58B 1KK1A 4NHOA 4RD2A 1G6OA 3F3YA 1R7RA 2ZEJA 4P0TA 4LHVA 1FL9A 1V5WA 5B64A 3KKOA 2IT1A 1MR3F 4MKHA 1YJ5A 4DB4A 5DNYB 3WXMA 1UFQA 3QF4B 2RHDA 2CE7A 2V54A 2I1VB 2P67A 1GNRA 1FMJA 2ZITA 4AURA 3CB4A 4KYIB 4PQRA 4TL8A 4X8MA 4OHVA 3VX4A 1VHTA 4KODA 1BS1A 4EFMA 3ZGXA 2WIAA 3W3AA 3RRYA 2JLWA 1OHHA 2FH5B 3V00A 2PL3A 4PZZA 3GPLA 2BDTA 4DIEA 4CT5A 2QM7A 5EXSA 5FBRB 3MD0A 2FWRA 5SZIA 3SBDA 4D82A 1DAIA 1R0WA 2HYDA 1JR3D 3FHOA 3PCRB 2RGEA 4CEIA 4JYBA 5KYKA 3REGA 4ZCIA 3UXMA 1W44A 3MSXA 4YMTA 1Z83A 2V7QA 4BFXA 1UBCA 3QXHA 4LC0A 4BLPA 1OW3B 2QN6A 5CIWA 1KSFX 2PZEA 2XB4A 4V0KA 1F3OA 2D74A 5GJCA 2EWWA 1IJFA 1XMIA 2EFHB 2W6JD 4YQFA 2GVZC 3C4JA 3JZAA 3KUDA 1NJFA 3QI2A 4V03A 5IT5A 1XBTA 1UKVY 1KZ7B 2ZRPA 1KO4A 5HZHA 1G64A 2AL7A 2RGXA 1PLJA 1Z0KA 3K70C 4HLCA 3EIHA 1JR6A 1EFRD 1PJRA 3A1WA 2OV2A 3ND9A 5AJZA 2Z43A 4BASA 1TADA 1F2TB 4TSFA 4EUNA 1ZNXA 2OZEA 1GKIA 1N6PA 1E9DA 1UDXA 4MA4A 3BB1A 3MCAA 4TMXA 2N42A 3T1QA 4TZ6A 4URZR 1AS0A 4HAXA 3QKSB 3IIJA 4Q4JA 2VA8A 3M0EA 3F5FA 3KKQA 2D3WA 1DTSA 1F48A 4GZMA 1Z28A 2B92A 4QGGA 3UATA 1X8LA 1NVUQ 5H68A 4R2IA 1ZC3A 2ZI9A 2WOOA 2J41A 3AVXA 4D2IA 4PAQA 5CB8A 1EFRA 4DWJA 4M9XA 3KDSE 3N2EA 4Z51A 1E98A 3CNLA 4RKFA 4IDOA 4C0QC 4P3YA 1G20E 3HR8A 3EWAA 5FR1A 3ZS8A 3FMFA 1IN4A 2ZJBA 3GJ8A 1QHYA 2EW1A 2IYQA 5JZVA 1D2NA 3WBJA 4LDJA 1NBMA 3P20A 4QJ3A 4B76A 1OXSC 1DS6A 2C98A 3GLFB 3U7GA 5K8TA 2G1KA 1SVOA 2WV9A 1B0UA 2XJ9A 5FI0B 2YC4C 3OFND 5G40A 4TL6A 5BW8A 4FIDA 4CW7A 3F0TA 1RFLA 4MYUA 2GAAA 2GAOA 1OXVA 3UANA 5SZJA 1YE8A 2J7PD 2OBLA 4JBWA 4QG7A 4EKDA 2DWQA 4RJLA 2P6RA 2ORIA 4B3XA 3I32A 2CJWA 1RRGA 3LW7A 2IYLD 5EE9A 1QG4A 3Q5EA 2CEAA 3GJ5A 3QNUA 2YWEA 4C0SA 5CITA 4MKGA 2GF9A 1ZUHA 2ZR0A 4NKRA 2BKEA 3D8BA 3QE0A 2QORA 1FZQA 2D4HA 5CM9C 5FTMA 2VF8A 2YINC 4K8OA 5HE9A 3H2YA 4KFSA 1ZVQA 1JAHA 5P21A 4MKIA 4L8GA 3M1IA 1SQ5A 3AF3A 1RE0A 4MKFA 621PA 1EFTA 2ZJYA 3AF0A 1XMVA 1S9HA 4OHXA 5EJEA 1OPXA 4PHTA 4CT4B 4LBVA 3EPLA 3OESA 2YVUA 3VKGA 4U02A 5EE0A 1XPOA 2YZ2A 1DAHA 1FOEB 2ZPTX 2REXB 4B3GA 2GZAA 1WXQA 1XD9A 1ZW6A 2D2FA 2IK8A 2AD5A 2Q3FA 3QXSA 2EYQA 1N6NA 1FFHA 1Z2CA 3CNNA 1XMJA 1MKYA 2BKUA 4MH0R 1T0JB 5C4GB 4JL6A 2P5TB 2YWGA 2WKRA 1W46A 4NCJA 1LVGA 4Q02A 1A2KC 1P2VA 1KI6B 1SGWA 2VBCA 4ZPXA 4ARZA 2QBYA 3VU9B 1EK0A 4QM6A 3IKJA 2ZE5A 1JJ7A 2OBNA 3BIFA 4V0OA 2QMOA 2QZ4A 3OAAD 1JBKA 4JS0A 4QJ4A 3RHFA 2C78A 2W6IA 3LBHA 2JASA 2CNWD 1E0SA 3TMKA 3WNDA 2L0XA 4DEYA 4TQ9A 2F3RA 1VMAA 1XWIA 2A78A 4GDFA 1VG0B 3HR7A 4WA7A 3EC1A 2YOGA 3KKMA 3U3KA 5JJKA 4LPSA 5TV2A 4ITRC 1Q3TA 3WYGA 1EX7A 3GLGB 3CH4B 2DFLA 5L3VA 4TYPA 1AJEA 2CVFA 5J4HA 4F4JA 3AKCA 1XD8A 2IBMA 2JLYA 3ZJYA 3LXRA 4B2IA 3GLIA 2EFCB 2ANCA 1CR2A 4CEJB 4IFEA 3HU1A 3TSWA 4XVUA 1M6NA 2RCNA 2NOAA 2XITA 1GNQA 2VPPA 3L0OA 2C04A 1G7CA 4Q4JB 3GFTA 4OQMA 2G0NA 1NIPA 5KDOA 2QU8A 1JR3A 4PC7A 4V02A 2VSFA 1X8JA 1OJLA 1QHHA 3Q3JB 3I73A 5AUOB 3ICEA 3LRPA 2XNDA 4OK6A 4DLSA 1MRSA 4B3FX 1MH1A 2VRWA 3T12A 1G5PA 1KY2A 3K09A 1HA3A 4DLWA 3BS4A 3OIVA 2R8RA 4NH0A 5CK4A 4PC1A 5L3RA 4ASUD 2R44A 5IDVA 4DT1B 5AJVB 2BBSA 2YKGA 4WAUA 2IYUA 4NYJQ 3CX7A 2JLVA 1VYUA 1V43A 3CR8A 4A0GA 1ZM3A 2PZFA 1TQ6A 3C5HA 4PZLA 5ELXA 2ZJZA 3RWMB 2DCUA 1EWQA 4OQFA 1QHNA 2E87A 4GOJA 1ZC4A 1W2GA 2DHRA 4TYYA 4DKXA 1SVMA 3DOFA 2IS2A 2N1BA 3T34A 2F1JA 1MT0A 3QXJA 2W0MA 1T6NA 1NSTA 4M1TA 4Q4AA 2GK6A 1W48A 1F6BA 5FUVA 1G1MA 4X8OA 1CBUA 3G0HA 4NPHA 3EW9A 3T1TA 1Q0UA 2GWHA 4PQYA 4JKYA 3U44A 4M0LA 4DSTA 1N6HA 1SXJB 4HATA 3H84A 2ZU6A 2BBOA 2IYTA 2UVQA 2QMEA 2RAPA 4OI1A 4H1VA 1N6OA 1Q12A 3W8NA 2KBEA 3PUZA 2ZE7A 1T3HA 3TH5A 2B6HA 1KAOA 2V7QD 5EE3A 1GG2A 4BLOA 4EJSA 2DFKB 4Q4HA 3UG6A 3C5CA 1KI3A 4JZKA 2IS4A 1ZAKA 3NVAA 3I62A 2GEDA 1L4UA 3C15C 5HCNA 2PEYA 3RS5A 1Z6AA 3R8FA 2R62A 2FEMA 1R8SA 3TJZA 1KK3A 4C4PA 1UJ2A 2GVDC 4Z54A 2QL6A 3WRYC 4ZV4A 1HE8B 4XH9B 1E1QA 1T5IA 2J45A 3K9LA 4M9ZA 4OQLA 1OIVA 4AG5A 2AK2A 1XCPA 2WWHA 1U98A 2Y8EA 4PC2A 3OZXA 1NY5A 3CONA 3MAAC 3ZYCA 3RC8A 2JA1A 1W4RA 3TRFA 2J7PA 4LPKA 2FA9A 4IW3B 3QEJA 1PUJA 1IY2A 2VLIA 1H8EA 1P9RA 3ZZ0A 1KO5A 2ZRMA 4PSVA 4QHYA 4L15A 4XJXA 4XTCS 3GQBA 4II7A 5TMPA 2Z6VA 1F5NA 1IN5A 1E2JA 3N5CA 4C0HA 1IONA 3EXAA 5JFGA 4US0R 2XTMA 3OE7D 2J0SA 2J1LA 2JEOA 4ARZB 3A36A 2GBLA 3UPUA 4BEBA 1U8YA 4YXWA 4C30A 5LPNA 1G8FA 1DEKA 2QSZA 3Q85A 2NZJA 3B7GA 4NYMR 2V1UA 5FBVB 1XZPA 5F98A 1VIAA 2H7VA 2WOJA 1NBMD 4Z8YA 1ZIPA 3CIOA 3QSYA 2REOA 4EFNA 4I4LA 4IVPA 2BIFA 3SU8A 3X1YA 2G88A 3KFXA 1G3IA 4BQSA 2ODWA 2ZRNA 1G6HA 4EPVA 3THXB 4AIIA 5JWHA 2AWOA 3T15A 3WY9A 4JVLA 2ZYVX 6Q21A 5K8IA 3DM5A 1RW4A 2TMKA 2OSBA 4LGMA 5DYGA 3E70C 4LYJA 2CHGA 4Y0VA 2R6GA 5EUMA 3DDCA 3MWLA 4R2HA 4V0NA 2ZVPX 2D06A 4WOPA 4KCGA 4MITA 4P4SA 5E7JA 3B2EA 3ASZA 3RAPR 1KK2A 3OIWA 5FTNA 2CK3D 1FMLA 1I4TD 4RFSB 3P1JA 4NU0A 3GLGA 2Q6TA 2NGRA 5LB4A 1NG1A 2NO1A 4ZIRB 5H70A 2FFQA 3U5ZB 2IS1A 1TQ4A 2QT0A 1I2MA 1E99A 1CJMA 1VYVA 2IEYA 2ZYWX 3E5HA 3BWDD 4RD3A 1QBKC 1GWNA 3LVQE 4GP6A 3VHXA 4Q7KA 1KAGA 3U3MA 1SXJD 1XCGB 3KXKA 3CW2A 4HZUA 1DG1G 4QGAA 1D6JA 1P6XA 4G1UC 3IO3A 2VHTA 1E3MA 5J5CA 4JLBA 2W2TA 4ERNA 3IIMA 4ZO4A 2FU5C 3SJBA 4JL5A 3MMPA 1VECA 3W5JA 1ZU4A 521PA 4PO8A 1FQJA 4JLAA 2GNOA 2ZRJA 2JGNA 5CDFE 1XP8A 3N2IA 1FTSA 1SHKA 3FGNA 3P4YA 5FOTA 2R6FA 1CJKC 1NY6A 1XXHB 1SXJA 2FFBA 3WYFA 1GTVA 1N6LA 1W0KD 5KPJA 3GLIE 4Q1BA 1XEXA 1F2TA 4QFMA 1XTKA 1G8PA 1RIFA 2WPDA 4IJMA 3LLUA 1XDBA 4XWOA 3NHBA 4B3CA 2O52A 4ESHA 2K5UA 3B1WA 5C2JB 1ZIOA 2WJIA 4OQNA 4TQUS 5D3MA 3RS7A 4BWYA 3B5JA 3ZDQA 2R6CA 3AUXA 4LV5B 1GSIA 3ZZTA 1NKSA 2C77A 5J4VA 2DWOA 1G7TA 3IPYA 2VP6A 1W4CA 5HE8A 4B43A 1CRQA 2GF0A 3TE6A 1TEVA 1HYQA 2H92A 1J2JA 1WBBA 3TKLA 4JVMA 1J90A 5BWMA 2PLFA 4C0JA 1CRPA 1XFAA 4HLUA 2QTFA 3PR1A 4MRNA 1G8GA 3KJHA 3THOA 1G5TA 1CJVC 3EZ6A 1MABB 4FMDF 1RZ3A 5FOXA 2JLRA 1C1YA 4JJZA 2PMDA 5JJLA 2AN9A 1FQKA 3PEVA 4PZYA 2O8CB 3GJXC 2RGNC 3AVUA 2GXQA 2PH1A 1FNMA 3KTAB 3PIRA 2KE5A 4LC1A 1HUQA 2ECKA 1OXXK 2ODEA 4NBSA 1EESA 5CK5A 4IVRA 1ZJ6A 2VH5R 4MDEA 1ZMXA 1Z07A 3AF1A 3G82C 1Z0FA 2XNDD 2FNAA 4A92A 4BUJA 3U60B 2O8EB 3REFA 3GLGE 4MRSA 4UNPA 3U3RA 4XD7A 5FTJA 5J4LA 4Y0AA 4LCBA 4G5GA 1DO2A 1NL3A 5K8UA 1R5NA 4P4SB 1E9AA 3ONWA 4XTRA 1KHTA 2OHFA 2IL1A 2D2EA 2ZSAA 3BRWD 1J8MF 1HTWA 4C2UA 3ZIAD 3TVTA 3T1VA 2VP0A 5HPYB 1W5TA 2GTPA 5HZKA 1N3BA 3FKSA 4JVSB 1R6BX 4QNRA 2V8OA 2ZI7A 4G0NA 5FBLB 3TVDA 2ZSFA 3QBTA 3AF4A 3EASA 4C0BA 4AKIA 2PX0A 1VCIA 3NEJA 4BE7B 1KKLA 1NVXQ 5E3HA 2VEDA 1N25A 2JLQA 2IYXA 2XAUA 2CL6X 3GCGA 3O47A 1BIFA 3QF4A 2JJ1A 4PC3A 1NN0A 1BKDR 2WSSA 1T91A 4HUQB 3W6PA 3EZ2A 2WJYA 3TUZC 2FG5A 2ZXUA 2G0TA 4PPQA 4GZLA 2WKPA 4DLZA 4LV8B 2HJVA 1TQ2A 3MWKA 1PUIA 4KVAA 3BAFA 4Z8XA 2O8BA 2ODNA 3KZ1E 4QHSA 3FFAA 221PA 4JIMA 2WJVA 4KITB 1DAFA 1D9XA 2XSZA 1A4RA 4DSUA 1E6CA 2Q3HA 4N3NA 4US2R 4A2QA 2GILA 2WJGA 4UNQA 3KXIA 4FINA 1RYHA 4G5OA 2GZDA 1HT1E 1HEIA 1MO5A 3ASYA 2BV3A 2OCBA 5FI1B 1Q22A 2HXSA 2KSQA 4W5JA 3EZFA 4BLTA 4EPTA 5L3SB 5CJ2A 4KBGA 2ATVA 4I99A 2VIIA 1SVIA 1JQLB 1LV7A 5F2EA 1KI7A 1VPLA 3UMFA 1ZM2A 3GJ6A 3R20A 4PANA 4LJ7A 1VYTA 2HCJB 2KWIA 1N0WA 2FZLA 4KLNA 2VHCA 1EXMA 4TTRA 4PHHA 2PJZA 5CLQA 1XCMA 1OXTA 1P7CA 5A4JA 4WW0A 4F4IA 4PO9A 5KOYA 1J8YF 4ZKDA 1XB2A 2NG1A 1CS4C 1N6RA 1QZXA 4XVQA 1A1VA 2HEIA 1U0JA 2FSIA 2C99A 3IHLA 3LBNA 4TTPA 3OIUA 3O8RA 4DLTA 4AI6A 2QRNA 4PHGA 2CJWB 1A7JA 5FBWB 5G41A 2JLZA 2R9VA 1G291 2JIZA 3LW8A 3WP1B 4A1FA 1YZTA 3CRVA 4UXJA 1GRRA 1KJZA 4M53A 4B2LA 1D9ZA 2WWWA 3SNHA 2QRZA 3E1SA 4MGIR 1FW6A 1AQUA 2OLKA 2WWXA 4QXAA 2GXUA 1II8B 2IYSA 2IUTA 4KU4A 4D0LB 2W83A 3B85A 5C18A 4E07A 4Q7JB 1XMSA 5JCZA 2G3YA 3A1VA 1XTSA 5FUYA 3FMOB 4IVQA 2JCSA 4HAVA 1LF5A 1GDDA 3F8TA 1IOZA 2FSGA 4EPYA 5JEDA 1GP2A 3TSOA 2OILA 2GJ8A 3WRXC 2WM9B 5HKKA 2W6JA 2VP9A 1KJYA 5TY0A 2V55B 3KB1A 3EIEA 3THYA 4A8JB 3CO5A 3LDAA 3GLFA 4LJ8A 1E2MA 3SN6A 1R8QA 3OEEA 2F55A 4KXFB 4JMPA 1QHIA 2CK3A 1T8UA 1TMKA 3AGPA 4R7ZA 4L5BA 5HTKA 5GJBA 3U44B 3OEHD 4O0MA 5H1YA 5JCPA 3C8UA 1ZBDA 1MO4A 3QKRA 1TF7A 3QKTA 3RYTC 3DL0A 1DAEA 3SZRA 2KBFA 3SI7A 4ACBA 3VX3A 1GAJA 2ZSDA 3A37A 4TLDA 1UEJA 1P61B 1VCMA 1R5BA 1G5RA 4ABYA 3U4QA 1KY3A 1YKSA 2AD1A 4LY6A 1NBME 2ZRFA 4J0QA 4TTQA 3ADBA 2PEZA 1J7KA 4LJ5A 1ANKA 4OL0A 3PITA 1J70A 4X8HA 2P6NA 4NTZA 4JJKA 4YLGA 4D26A 1US8A 3IBYA 2F9MA 3KQLA 1N5JA 4Q66C 4FI3C 3W90A 1P2TA 4DZZA 2ZUDA 3GJ0A 4HSEA 3CPJB 4QHTA 1KMQA 2ZI5A 3EPKA 4A36A 3FE2A 1ZNZA 2A30A 2FSFA 3GEIA 1P3JA 2IHBA 4HB4A 3AVPA 4N0EA 421PA 3NXSA 4MYCA 2B21A 2UKDA 1P62B 4M4SA 1TU3A 1WF3A 4HUQA 2A9KA 1W7AA 2QP4A 2YNMA 2XOKA 4E22A 2V1XA 2A2ZA 3AEZA 2C2HA 2NO6A 2OAP1 2GEUA 1KO7A 2GZHA 3LA6A 5FUWA 3RS0A 4G5QA 3QENA 4JYCA 1ONBA 2ZS7A 3VKHA 1E2QA 5UKDA 1X1SA 3VR6A 3ETLA 1SKYB 2XEXA 4RCYA 3K9HA 3OF5A 3UG7A 3LX5A 5IHPA 4ZIRA 2ZRLA 1NRJB 1CR1A 1TQDA 1ZM9A 2QTVB 1JEDA 1EGAA 5DN6D 1HQCA 5DO9A 2C9YA 4NCIA 1TF2A 4OHZA 4JT4A 3EC2A 1N6KA 4A0HA 2IX3A 5DHAA 5GVSA 4F7WA 2ZI4A 1TTTA 4BLQA 4YMSA 1SVWA 1P72A 4Q00A 2JAQA 1TPZA 3NDBB 1U8ZA 3C14C 1S96A 3GLHB 3AV0B 2GEVA 2WSSD 3EWSA 2AK3A 1GL6A 1XPRA 4JKIA 1YZUA 4PXAA 3W9YA 4GOXA 1WMSA 1XEFA 2F1IA 2OUKA 1G17A 3BD9A 3QOFA 1CF4A 3QKRB 4M2LA 4OYHA 1IN6A 1OT3A 1AN0A 2VL7A 4RD1A 5E7IA 5GVRA 4QOSA 3L82B 4BGDA 5IF9A 1M8PA 3QVVA 4M1MA 1II9A 4L9WA 4XIGS 3AVVA 3VR4A 3AVOA 3BFXA 4FMBB 5GADl 2WWIA 3HYRA 3A8TA 3BGWA 4JSTA 3S1AB 2QPOA 4BRUA 4PQFA 2IF0A 5KNCA 1I2DA 2HYIC 4C9BA 4G3XA 3ZIAA 1Y63A 2FEOA 2ZQ5A 3ZVMA 3DKVA 2XNSA 3CBQA 5DI3A 5BXQC 4NP6A 4Q1CA 1U9IA 5EE1A 3DEFA 3OAAA 2LKDA 3VR5A 4GP7A 3QG1A 2F3TA 3TIFA 4A9AA 2F7SA 4NCNA 4XOIA 4L16A 2MSEB 4OK5A 2P3SA 1FX0A 1NSFA 1COWA 2ZJAA 3B1XA 3CLVA 2G83A 4KFRA 4B75A 5EP4A 2ZJ2A 3NBZC 3L0PA 4B33A 5KSOA 4Z1MD 3PQCA 5E7MA 4AWXA 3PUVA 1GL9B 2VHQA 3W34A 4PR0A 5FOSA 4UJ3A 1U99A 4LJYA 4DBLC 3THYB 4MUAA 1AZSC 3DHWC 2YC2C 4URVR 3DM9B 3SR0A 1LTQA 1IAQA 1VG8A 1YR9A 2QQ0A 4UXIA 3H1TA 2CCGA 4M9SA 2ZRBA 4RZ2A 3QBVA 3TAHA 5IK2D 4HB2A 4ZI2A 3P26A 4HDOB 2J87A 1RYFA 3FHCB 3RS3A 3HDTA 2DFNA 2VSOA 3SOPA 1XNJA 1GKUB 1XXHA 1S0UA 3SDZA 3BH6A 1E9RA 1KSJA 4E5UA 2VF7A 3NDPA 2BBWA 4DB2A 1E69A 5KTYA 4YDSA 4DDVA 2PX3A 3EPHA 1Z0JA 1NN1A 1SKQA 3ZS9A 4TLAA 4W5HA 121PA 5D3MB 5CM8B 2X2EA 2IW3A 3TK1A 1U94A 4TMTA 3X1ZA 1XTRA 3HU2A 3U6KA 1HE1C 4EPXA 4A15A 4M1YA 2AXNA 4DCVA 1Z3IX 4FCTA 1W0JA 1E2HA 3SYLA 5FL3A 1WE2A 2CL7X 1I4LD 2ZTSA 3PEYA 3DMDA 1KDOA 4JL8A 3FKQA 4NZYA 4P32A 3T1OA 1JJVA 4M1SA 4D6PA 1EG7A 3PV0A 3LBIA 3SEAA 4BFUA 2H18A 4HAZA 2AWNA 4DCTA 2J0VA 1RJ9A 3RABA 2J3EA 3CKLA 5SZHB 3EX7C 1N5IA 1NI3A 2EU8A 1KI2A 1Z08A 3GJ7A 4QGFA 5FFMA 5TB5A 3TW8B 5JHGB 5JI2E 1ZUNB 3U6BA 3K70D 4KAXA 2W58A 4PHFA 2ZRGA 4UXHA 1UF9A 4OK3A 3TR0A 1H8HD 4P4TA 4B2PA 2ZR7A 1KDPA 4ZCLA 1DARA 2LKCA 2CLSA 4LSGA 5LB2A 4QBGB 4Z1MA 1Q1QA 1OSNA 3SBEA 4PO1A 3B1ZA 2R65A 1U8AA 3VKWA 3THWA 1IQPA 3RWOA 1XPUA 2F9LA 3B9PA 5FH9A 2OG2A 4PTLA 1NVWQ 4Q7LA 5KDLA 2QPTA 3X1DA 1XRJA 4AG6A 4MGYR 2ZU0C 3I8XA 3GLIB 3I1FA 1JALA 2AFIE 1U90A 2ZROA 1R2QA 1KI8A 3JZMA 4WZBE 4FD2A 4TMKA 1DO0A 1XEWX 3HJNA 3OHMA 1X8KA 4LWZA 4B3DA 1E0KA 3CRW1 4B34A 3OEED 2YHSA 1RRCA 5JSZA 5BN5A 4HLDA 3OEHA 4TMZA 1G3QA 3U7EB 4GSYA 3VAAA 5KO2A 4UQOA 1MRNA 1ZM7A 3LQQA 5AUNB 3AB3A 4WBSA 3U2QA 4RD0A 1OB2A 4QBHA 1KSHA 3AP3A 2IWRA 4AYXA 4BFWA 1DAKA 3NC1C 3GLHA 4LV6A 3C7KA 1N5KA 821PA 3I5YA 3TUIC 1GIAA 4DCSA 5B57C 1WCV1 2NTYC 2FV8A 5AWFC 1Z0AA 4RFSA 4LJAA 2A5GA 3GEEA 3AH8A 4TSFD 4U5XA 3KB2A 2BM1A 5KHOC 3AVYA 2J0UB 4WXPA 4DXAA 2QMHA 1YR8A 4TLEA 2WKQA 2D7DA 3NBYC 3AF2A 3L2OB 4YXWD 1E79D 5CIQA 2OFOA 3IEUA 3KKPA 2HLDD 2QSYA 1DAMA 1XTQA 3K0SA 2RHMA 2B7CA 5JHHB 2DY1A 5FTKA 2BCGY 5H8WA 1NIJA 1IM2A 3SYKA 2IC5A 1LNZA 3K0FB 2EFEB 2HF9A 5EP3A 4G01B 2GJ9A 2GXSA 4DUGD 1XF9A 1MO6A 5BN4A 4HAWA 4AD8A 4C0KA 2J0UA 2GCOA 1DAGA 1UKYA 2FPKA 5CDFA 3ECCA 4I1VA 4M9QA 2BOVA 2ZRDA 2ZYUX 5DE3A 1JECA 3FMPB 1LS6A 2DBYA 4EJSC 1SHZA 3FHTA 1B23P 1M1YE 4H1UA 5CYOA 3KQUA 3Q8XB 2XZPA 3C16C 3MJRA 4KV9A 4AYWA 4KSBA 4BZXA 5K8LA 3QPUA 3W8RA 3ZVRA 1NP6A 5KSZA 2QGNA 3K70B 3X1WA 2GK7A 1XJ0A 1PZNA 2AFHE 4W5WA 4OI0A 4FN5A 2NZ8A 1QRAA 2CLDX 5BN3A 4NYMQ 3EZ9A 4CDGA 1W36B 2OXCA 1GL7A 4DCNA 2ONJA 2RGGA 1R4AA 2J0QA 1N5LA 1CJTC 3W6OA 2Q21A 1UKEA 2XTZA 4BRWA 1IY0A 5JECA 1DELA 2WSMA 4PAMA 3RRZA 2P2LA 4EFLA 3BB4A 3CR7A 3NHAA 1US8B 4N0DA 3PFIA 2QGZA 1SKYE 4QBIA 1E2FA 4BLRA 1HH4A 2QPAA 1WA5A 2ZM5A 1YZKA 1E1RD 1UKZA 3FFBA 4MYHA 3QF7A 1UBGA 1L8QA 1JAIA 1GFIA 3B1VA 2PLRA 1Y3AA 5F3WB 5C4MA 1WP9A 5EZ5A 4TL9A 3FVQA 1LF0A 2O0HA 3B78A 4S35A 1GNPA 5L3QA 4LX0A 3RRMA 2IXGA 4GMXA 2PT7A 4YC7A 4O2RA 2MMGA 1NVVR 4BFTA 2HLDA 2RGNA 1AKYA 1G7RA 3RNLA 5CYPA 1S9DA 3CPEA 2WJHA 4A6PA 2CHQA 1ETUA 1AS2A 1Z6TA 2OXRA 4LK2A 1EX6A 4UNSA 1Q1ZA 1Q57A 2NO0A 2H16A 3B9QA 1OXUA 5EUQB 4AKEA 5KPDA 2R6DA 2Z0MA 3QKUA 1HQYE 2GXAA 2QE7D 1HURA 4RY2A 5L8VA 4PX9A 1QDEA 4MDFA 3ZH9B 3HPRA 2QUZA 1FPMA 5G3ZA 2ERXA 3A4LA 1DOAA 1E2GA 2NIPA 4R9UC 1E32A 5JS7A 2UZIR 1VIYA 3HYTA 4JSYA 2QI9C 1OH7A 4DDWA 1G16A 3EIQA 4URYR 5L3QB 2C96A 3CRMA 4LHXA 5A0FA 3UKDA 2ORWA 4HYYA 5FPTA 4CRWB 2KB0A 2C9OA 2NPIA 4PSAA 5EXTA 2GESA 4LBYA 5HR5A 1NLZA 2ZSBA 1AGPA 1A82A 4WXRA 3M4YA 3WBKA 1JXOA 5F9HA 1NJGA 2AR7A 4DDUA 4JLKA 4TT3D 4FCVA 4JLVA 4FMCF 3BB3A 3EA0A 3W3ZB 1GRNA 1GUAA 1NF3A 3FPAA 3P32A 1XZQA 3Q7PA 4R98A 1T9HA 4XSGA 1E2DA 3RDPA 1JPNA 1GZSA 1TUIA 4BFZA 4NYJR 5FBQB 2XZOA 2FJUA 4JLMA 1H8ED 3THXA 4HI0E 5J4YA 3QXXA 3M6AA 3DMNA 4GL2A 3D3QA 2FGKA 2W2XA 4FWIB 1BH2A 3R7WB 1R10A 4EIWA 2ZREA 1H65A 3WMFA 1OE0A 1W49A 4GI7A 1BMFA 1E2PA 4QC2A 1P73A 2ZJ8A 3AP1A 4B47A 5KU1A 2CCJA 5JBQA 5DYIA 1IXZA 5EE5B 1HT2E 1Z8FA 2ZVQX 2HCBA 2FOLA 4UNNA 5AJWA 2QQEA 4Q03A 2P6UA 3WHKA 4A82A 1P4SA 2JJ1D 5EP1A 1N0UA 2QAGA 4JLJA 2V6IA 5JLJA 2RGCA 4PAOA 3MJHA 4B44A 1AK2A 1ZD9A 4F4CA 2AKAB 4NDZA 5B58C 2XXAA 1GITA 2YOFA 2ATXA 3IHWA 3KFVA 2JLUA 1CKEA 3CWZA 2BBTA 2IA5A 2ZIAA 2XSZD 1NMZA 4XSHA 2JJ2A 4IEEA 4PPGA 2BJVA 3G5UA 2GRJA 3IUYA 3CH5A 4BLSA 1T5LA 1GRQA 1TEXA 2IYVA 1LY1A 3DPUA 1UDWA 3QJYA 3RSOA 4DLRA 1T8TA 1W2HA 1U9IC 3H0KA 3RRNA 2J46A 4HB0A 4O2LA 1XU4A 2VP5A 1Z6XA 3O8BA 1KYIA 2ZRIA 2ZRHA 1AGRA 4XWAA 1PLKA 2A7QA 2FZ4A 4DHEA 2QROA 1FNNA 3K9NA 2ZRAA 3NBXX 1L2TA 1LB1B 1Q1EA 2JJ2D 3VNUA 1Z06A 4IDQA 4A4DA 1SVSA 2RMKA 5EXXA 3VMFA 2SHKA 5JRZA 1WBDA 1IN8A 3H4MA 4UJ5A 1YZLA 4QRHA 1OYYA 3OIYA 4AKHA 5DISB 2AKYA 2VQSA 3WNBA 2EQBA 3ADDA 2KI5A 1TL7C 1NMXA 5TARA 2JJ8A 2IUUA 721PA 4L9SA 1OV4A 1OIWA 3AKYA 4OI4A 4CZ2A 2ZJ5A 4BFSA 1NG9A 3QVUA 4BPBA 3SQXA 1JNYA 4DRZA 2NO9A 1SVLA 2I3BA 3L0SA 4KJZA 4ZKEA 1K6MA 3L43A 1UBFA 3ZVNA 1UPTA 3U4QB 1LFDB 4KSCA 2QAGC 1MABA 1ELOA 4GBMA 2GA8A 1A5TA 3T61A 4DLUA 3PVSA 3Q72A 4RSGA 1W36C 2JLSA 1YU9A 2EFDB 1XD2B 1Z2AA 3RLFA 3TNFA 1YRAA 3IDQA 3NKVA 4OJQA 4Q21A 3AQ4A 5CB6A 1Z47A 4DUGA 1SXJC 2GKSA 4QNMA 3K1JA 2PT5A 2O8DA 3OFNA 4OQXA 1ZUIA 2FFHA 5DLQC 3KJGA 3O8CA 4DCUA 4FW9A 3LH5A 1IBRA 1NN5A 2MSDB 2OFXA 4HB3A 1QVRA 2Q9BA 2C03A 3C41J 1TAGA 5LBIA 2GCNA 3R9XA 2D62A 4DVGA 4DT1A 3ZD7A 4I81A 4RZUA 4IHQA 4LHZA 3VQTA 2PJRA 4CF7A 2X19A 4B73A 1Z63A 3AM1A 4URUR 5AR1A 4TN1A 1RRPA 3PUXA 3T06B 4DC9A 1KO1A 1YZNA 1YZGA 3ZQJA 3MWJA 4C3ZA 3A4NA 4I1SA 3UMRA 1RRFA 2W6ID 3MWYW 1D5CA 3QIAA 1MO3A 4ZDIA 1IJEA 4BFYA 5J47A 2X8AA 4ZDWA 3BE4A 5KDDA 4Q18A 2BWJA 2OBMA 4NL4H 2RH5A 3I4LA 4YMWA 3CF2A 3KJIA 4LJ6A 3AUYA 4AK9A 3EZ7A 3U3JA 5FPSA 4ZDJA 1KI6A 2AXPA 2QBYB 3NBFA 1EWRA 1KMHB 4GT1A 1S2MA 4A0FA 2GHIA 3ND8A 4TMVA 1NMYA 4LJ9A 3L0IB 1E1RA 4EAQA 5JEEA 1XEWY 1XXHE 1ZP6A 3AGQA 3EAQA 4MYTA 3AKEA 1AA9A 2GCOB 4M22A 4FXPA 2OO7A 3B8HA 2EWVA 4MGZR 5FL7D 5FPHA 4BFVA 3THWB 3UWOA 3DVLA 3LY5A 3SHFA 3HU3A 3PEUA 3KQKA 4TT3A 4QM7A 4BEJA 3EPJA 4RZ3A 1TU4A 2AHOA 3A4MA 5DGXA 2WHXA 4QL3A 4IOKA 2QNRA 3VR1A 2ZAMA 3BK7A 5FR2A 4Q01A 3SJZA 2J9RA 4D25A 1O87A 3I8SA 3SC3A 1OHHD 3IGFA 4YMUA 4GPTA 4ASUA 4URWR 1W4BA 2ODBA 5KUTA 3V4RA 2BMEA 4O25A 4DLVA 2ZUBA 2DR3A 3DZDA 1M7HA 4RCZA 2JLXA 1YR7A 3B60A 1XJQA 3TW4A 3VNVA 1KDTA 3NC0C 1E9FA 4ZCMA 1E0AA 2LWIA 3W5IA 2O8FA 4HLQB 2UZ3A 2VHUA 1E2IA 1FUKA 3IILA 2Z4SA 4U00A 5G3YA 4JLNA 4TMWA 4R71A 2OE2A 1TX4B 2B8TA 4YDHB 3CF6R 1G19A 3CNOA 3AVWA 2A5FA 1R5OA 3EG5A 3MGCA 4V0MA 3ZLJA 3BH7A 2O0JA 2VTKA 1OB5A 3GLHE 4JBXA 4E09A 5AK0A 3FYHA 1VG1A 1IY1A 1F2UA 1IHUA 5KSPA 1M7BA 4YMVA 1ESMA 4KVGA 4P31A 5E4FA 1OH8A 3ZVLA 1JB1A 1FP7A 3U3OA 3KL4A 2ZI3A 4B6EA 1ODFA 2HT6A 4BZQA 4HUTA 1CULC 3FKSD 4URXR 5JMTA 3EARA 4LUCA 1KJWA 1D2MA 2GJSA 1CIPA 3MUFA 1PV4A 4C7OB 2BVNA 1R0XA 3BC1A 4JT2A 2GJKA 4Q9LA 3AP2A 3KUCA 5TDHA 4MQBA 1G8YA 2O8FB 2BEJA 1N0VC 3IIKA 2G9NA 1CR0A 4US1R 3BBPA 1KMHA 2XZLA 4Q19A 1L7VC 3K0AA 4L4UA 4D0NA 2Q9CA 3B82A 5EZ6B 1KNQA 1RVDA 1W1WA 2QA5A 2Z5FA 3NH9A 5M04A 2REBA 4KI0A 1E1QD 4B32A 4Q4LA 4RD4A 1BMFD 4HAUA 2I1QA 3SJCA 1SVKA 4GMDA 2CBZA 1Z29A 2ZR9A 2ZS9A 1VCNA 4B3BA 2B7BA 1ZM4A 1G8HA 3WMGA 1CEEA 1LS1A 5KSYA 4XD7D 4OHWA 3PEWA 4DIDA 1FP6A 5KNDA 1WRBA 3K0AB 1L4YA 3IEVA 1GVNB 2BJWA 3K09C 1CJUC 1KGDA 3IPXA 1J99A 2WWGA 2E1RA 2CXXA 3TLXA 3WNCA 3B13B 2H8KA 3LO5A 3PJRA 4X8LA 5DIFA 1P60A 2QP9X 4P4UA 2X77A 3RSLA 1P5ZB 1NLYA 1QHSA 2ZYTX 2ZE6A 1X6VA 1YZQA 3LD9A 3Q9LA 2BMFA 1RJ9B 2V9PA 1OFIA 2YJTD 5IK2A 1AIPA 1HY3A 3SHWA 3GP8A 3W6NA 3T35A 3NIBA 1OFUX 2O8DB 1G4AE 4Q1EA 1XD2A 2O5VA 3GFPA 2BCJQ 1NN3A 4MRRA 4QBFA 1II8A 2OAQ1 4B71A 3TBKA 4DLYA 4PSKA 4HZIA 2Q3MA 4A8JC 2BMDA 3VR3A 4XVRA 1P2SA 1UBEA 1FTNA 1NLFA 1X1RA 2FE4A 4UKDA 4D4MA 2OCPA 1VG9B 4W9MC 4GOKA 1Z22A 2GBLC 2JIZD 3R8CA 3WMEA 4JLOA 3RVBA 1EFHA 1ESNA 4D4JA 3NEYA 2QMUA 4KO8A 4I1UA 5FOWA 1M2OB 2D7CA 5D3QA 3A1SA 4EQ6B 4XWKA 2LCFA 3PG5A 1G9XA 3UK6A 1Z5ZA 5FPKA 2XGJA 1OH5A 2H17A 1ZD8A 4JLPA 4OKSA 2ZSEA 2ZRKA 3UMSA 3D6TB 3LNCA 2QT1A 4AKGA 3LXXA 3IQXA 3KQNA 1ZRHA 3CPHA 4MUBA 2CE2X 5FOVA 2ASEA 1IXRC 3SFVA 3MLEA 2N46A 2BEKA 2OESA 4HEJA 1WQ1R 3SE0A 3SFZA 3T5GA 2JDID 1QHXA 5FUXA 4ACAA 1GM5A 3HP1A 1PLLA 5L3SA 3PUYA 4PPNA 4IDPA 4NYIQ 2QM8A 5DI3B 3TQFA 4DSOA 5HCIA 4CEHA 1JPJA 4FCWA 5BQ5A 4F91B 3A6PC 1A2BA 4OBEA 1G3RA 5EXPA 5SZKB 1S1CA 1MV5A 4IOLA 4NONA 3KJEA 4DLXA 2F43B 4MGKR 2IXEA 2RGBA 1N2CE 2MMCA 1K8RA
chains in the Genus database with same CATH superfamily
4LJLA 5FWXA 3QMMA 4FHCA 2O4CA 5C1BA 4OYLA 3IP3A 4Q1FA 1C3LA 3VR5H 3VU9A 1ADYA 1R00A 4LMRA 1T4GA 3IVMA 1S01A 3NFRA 4MLCA 1TUBB 4XRRA 1EIZA 1H05A 3OY2A 5FL7A 5H81A 2DGDA 4CF5A 3WE7A 1XPJA 3NVKI 5DX0A 2C3PA 2C31A 3NTUA 4YJFA 3WDSA 2P78A 3J81k 3FJOA 3U48A 4LI0A 5JV5A 3H83A 2RHRA 4G0YA 1I6MA 4M1KA 4XUCA 3FLEA 3O2NA 5KB3A 3CZQA 4KXQA 2HLNA 2O14A 1C0EA 4F2WA 4TS3A 4G4IA 2IOFA 1ZLXA 4H9GA 4C0WA 1VSTA 2AZDA 5KEIA 4HBZA 5LNK6 1R9JA 3IMKA 4XM2A 1LRKA 4J0IA 1RZVA 2RG1A 1A8PA 3PFKA 3FMIA 2HJGA 3VNAA 3GT7A 1UOQA 4FYYA 2B4TO 3MJSA 4A91A 4Z2AA 3F6RA 5DYYA 4R6WA 3VUFA 3ANSA 4HNQA 2FGJA 3RO7A 4YREA 5EWJA 1EXDA 4YQYA 3DXYA 3JYHA 3M4NA 5DSZA 4OB8A 2PM8A 4X61A 1YHNA 4IIUA 3VSDA 4W8OA 4ZI3A 1A8IA 2X9NA 4EHAA 2XQFA 1S1MA 3MT0A 2FSVC 4FYMA 2BFAA 2RH4A 4ZA2A 3MG9A 3U61B 3K73O 2LP4Y 1FW8A 3KJFA 1JRLA 3L46A 1JSRA 2RBGA 2H5JA 2HZ7A 3L8ZA 3P9NA 2VYFA 5G4KB 4MTLA 2GLUA 3TAUA 1WZ2A 3I34X 1DSSG 3BPSA 4CTKA 2XE7A 4R1QA 2X8BA 2ORYA 4K81B 1TVEA 3AJRA 2ZIUB 1XQ1A 1AS3A 3EA5A 3I3OA 4TLCA 3WLQA 1V2HE 3PGA1 3U16A 4Q34A 2NZUG 3AHFA 5D5HA 3DOEA 5TR9A 1C9YA 1RMYA 2RGDA 1DZIA 2XX3A 3IDFA 3QVWA 4ND7A 1T6YA 4YJ3F 4CV3A 3U39A 5GJWC 5AIBA 5IABA 1YJBA 2ISCA 1FRVA 1Z0DA 2G72A 3MWFA 1HQKA 2IPNA 4DUPA 1G38A 2HT1A 3SJAA 1OKKA 3WIDA 4CIAA 2EFGA 3I5UA 2OO3A 3LWNA 2IDZA 1MGOA 1TF5A 2IQIA 4RXMA 2J5XA 3GNLA 3KLMX 3M70A 1TUEA 2Q41A 4MRPA 4IGEA 4MX8A 5K3EA 4M3NA 2R8ZA 2C0CA 3GG2A 4CLDA 2CSXA 1G4HA 1XFDA 5L4LA 2YW9A 4DR5B 1M73E 1O97D 5K0LA 2I6GA 3AOEA 5JSZB 1A4UA 2WZQA 3QGMA 1ZU5A 4MVXA 4H60A 3JTMA 4ZJYA 5AVYA 5IDWA 4CBVA 2OCXA 1RKXA 2X5KO 1JJBA 3FR7A 4N03A 4WCFB 4JI1B 2PUFA 3NWJA 3KB6A 1MBZA 2E55A 3GPDG 4Q6WA 5EJMA 1WB5A 1UZMA 2ZTMA 2SKCA 4KO3S 3AVQA 1CP2A 4X84A 2P27A 3BJIC 1KKMA 1U2GC 1AXEA 1E5QA 1ULHA 4M21A 4XE5A 1S2DA 1ETHA 4ZO6A 4ZJPA 1ICEA 5B5SA 5HTOA 3WBFA 1ITZA 4KDCA 5AJYA 4C0AC 5CP8A 5FA6A 2IYZA 5LD2B 4M8IA 5LWHA 4B4VA 3GFOA 1FXWF 2OM2A 2ZS8A 1DKOA 5HG0A 5B2ZA 2J5BA 2FFAA 2EF1A 1G20A 1U6IA 1XL1A 2XUAA 3I01M 3K15A 2ZBQA 5F77A 4KFUA 3I6QA 1AHIA 2B8WA 1R9GA 2BLLA 4B8WA 3L49A 1MVNA 1EFAA 1WCIB 4QUDA 5JS6A 3B5IA 2I4IA 4H7KA 3LO8A 4F93B 4DFDA 4YAOA 5LFAA 2MSLA 1FXUA 4ENSA 4BQNA 4JZYA 1COWD 1BGWA 5FFNA 3TUJC 3WMWA 5BUSA 2BEVB 3H4TA 3I72A 4GRAA 2WWVD 3DR5A 3QKSA 1IUNA 3FNHA 2WAXA 4GNKA 2EBUA 3OU7A 3R0JA 1HEUA 2OMEA 3H6KA 2IBTA 1I1HA 1Y8AA 5BSKA 2VHYA 3NH6A 4EB6A 1Z4JA 3RK0A 3WSTA 3QPDA 4QX6A 3GVIA 2W42A 2WG1A 3LQ1A 3IUMA 1DADA 4W9NC 1F06A 4V39A 4I1IA 5DYTA 3RUIA 4F3KA 6CHYA 3I3SR 3NNSA 2H5IA 4II3A 4TKLA 1W59A 1KSGA 1YBAA 2E4WA 4H7HA 3CF4A 1X7XA 2B35A 2FPPB 2YY5A 4IJQA 4RD6A 4EGCB 1Z5PA 5CBPB 1P0QA 1XX6A 2B78A 3A7EA 2GCIA 1UK9A 1G3MA 2PJUA 4IAOA 3D3WB 1QFZA 3SEZA 5LIPA 5AI6A 4ESVA 3VU3A 4KO4S 2JIMA 1S3SA 1E7MA 1U0EA 1H8HA 3H4IA 1J9ZA 2QB5A 4EDHA 4TKVA 3L02A 1PP4A 3B89A 4HC4A 1AQYA 4AMUA 2GYWA 1XXLA 3ITNA 3N0XA 5CVTA 1V3TA 4BCDA 4J7XA 5G4KA 4BAZA 5KNCD 2BFBB 4ZVLA 4IXTA 2VHJA 4WHMA 2P9EA 4IS2A 3TLZA 4CMEC 4HVTA 2PKXA 2PCLA 4TMYA 1FX0B 1GG9A 3E22A 3A6HA 1U8FO 2P5SA 2VDPB 4MWOA 1PWZA 5KHLB 5M7EA 3DR3A 4JJAA 2FQ1A 4PC6A 1C50A 3UJHA 3VR6H 1V4VA 2GDJA 1SC6A 1C3EA 2Q5IA 2NO7A 2X7JA 2WU1A 1EJ2A 1OWLA 1SBZA 3DT6A 1RBZA 3EN0A 4IKPA 4KPUB 1GY8A 3EH2A 4BATA 1W0JD 2FQQA 4EVQA 4BN0A 1OY1A 1PQPA 5AM1A 5JS2A 4CMHA 7GPBA 3PR2B 1JEEA 4UTXA 4H2DA 1E89A 1YS7A 2X5NA 3K4PA 4DNXA 1DC3A 4XDGA 3V7WA 1M66A 1CLUA 2JD2A 3ZWCA 2SBTA 1WPGA 4IR7A 3QXCA 4ZVVA 3Q9UA 1BVYF 4ZVKA 5BMOA 3CVWA 2H57A 2NSDA 3CM0A 5EHGA 1AM4D 4QPPA 4DDHA 4R9VA 1EB9A 2JIRA 3NHLA 2WWFA 2AQHA 2J4FA 1D4FA 1SRRA 1UXHA 3RROA 2I9KA 2HF8A 1ACLA 1X0XA 2FN3A 2B83A 2H52A 3DO5A 2ZE8A 4KQWA 1VIMA 3F6PA 2GPJA 5ECYA 1LQ2A 4CV2A 2RHGB 1LXCA 4BQEA 4BECA 1SN7A 3RYFB 2XRMA 4AMYA 1IIBA 1M74A 2XKJE 3D6HA 1SIOA 3C8MA 2O57A 4QYXA 8LDHA 4YO8A 3PQDA 2IEZA 3R7FA 1EH5A 2QUIA 1WB4A 4CM9D 3WGZA 3D4OA 5T4BA 1Z3CA 5DRYA 2PBRA 4UTVA 1E79A 4YONB 1P9OA 5CT6A 4EI2A 4RC9A 5FPQA 1MT3A 1A5ZA 3QEBZ 3G8BA 3BQ9A 2G71A 2HV8A 3TLMA 1D8TA 1VRWA 4BBZA 4UEJA 4NMMA 3A1CA 2FW7A 4KDRA 1KK0A 1IOVA 2CVHA 3NOXA 4JI3B 3GFVA 4E5DA 3GMSA 4OMDA 5IANA 2P11A 4AYTA 4CIDA 4EJSB 5JWOA 3LT5A 1DBSA 3EVZA 3D6FA 4IOMA 4I9FA 5TVKA 2ZRCA 1Y82A 1DG3A 5EI5A 1KH1A 3NG1A 4KXUA 1ZH6A 1J9GA 1JKJA 3CCBA 3D2BA 1E2NA 2VAWA 2I1WA 4GBGA 4Q9KA 4QYSA 4I1YA 2O4UX 3RFFA 1XTJA 1M2HA 3LFHA 1R3UA 2JZCA 1Z13A 3A27A 3OQIB 3BTUA 3RCBA 3CUEF 4M8KA 4TRMA 1DCMA 1UK6A 2JAWA 3HVRA 1AG9A 4IFBA 2CD9A 5CJPA 2I54A 3D8RA 3TQCA 5KYWB 3FCEA 3QKIA 5JNVA 5CIYA 2OUIA 4H27A 3TLKA 3CSSA 4PLHA 1RKBA 5K0NA 4ZO7A 2CUTA 2X5OA 4RAQA 4WZAA 2GPWA 2GCPA 4WZ6A 1RM3A 1VLMA 4JUBA 2X9LA 1YQTA 1ISIA 3I8OA 4YBZA 3SK0A 5KREA 2NUTB 5BSTA 1TM7E 3LT1A 3UWDA 4DSNA 4Z7JA 5E1OA 1QZ3A 2CNNA 2FF7A 1RMTA 2GJ4A 2WQZA 3KZCA 2EJVA 4IRXA 3MLAA 3ZE0B 3Q12A 4D43A 4EL5A 2CZCA 1PEKE 3P2YA 3EJ6A 2YJ3A 2VZ9A 4HZGA 4CM4A 2XMPA 4P7GA 4P6VF 4OGWA 1A69A 2WU8A 4D9GA 1NBIA 3AEUA 4D56A 2P1ZA 2WMNB 3BMOB 4LE0A 5T4FA 4GKKB 3HPQA 3HKDA 2OCAA 2XV1A 3AILA 3LQRA 1T35A 2B98A 3EXIA 3M1AA 4I4TB 1MAUA 1Z2EA 4NOMA 1XRMA 1ESZA 3AI3A 3B7WA 4JIGA 2PD3A 3NWEA 5ICGA 3UHAA 4YCJA 2Y0PA 3CX8A 4HDQB 4YWJA 4DBVO 1KRHA 5JAHA 1IJKA 1UM8A 2F3PA 4DMMA 1GKYA 1SAYA 4JBLA 5IJXA 3M2TA 1PDOA 2OK8A 4OY3A 4TTTS 3KSUA 1XJWA 4AJ1A 2UU9B 3MFYA 2F8LA 1H5QA 3FSRA 2HBQA 3FCYA 4P5EA 3F97A 2YNMD 3ORFA 1GGJA 1GNVA 4ZK6A 4YBRA 5CW1A 1PZMA 2C4KA 4Q1DA 4CEIB 4TPKA 2ZBGA 3GV0A 3K32A 1GPAA 1CXZA 1SMKA 1UP4A 4DWWA 4I9HA 2R7LA 3KZKA 1NOKA 3H7IA 5J4KA 2OL4A 1L8LA 4MMYB 1FQOA 2CCKA 5D3KA 1WKVA 3P2IA 2PT9A 1WXDA 3OOYA 1QYXA 2R84A 2YWFA 3UGQA 4LF9B 3H2HA 4YA6A 4C20A 4C7OA 2C0QA 4RMJA 4CCYB 3L7NA 5HDBB 3BJRA 4IV5A 3X1XA 5DKFA 2C4HA 1DRJA 4IKEA 1VZ2A 4HBGA 3A3OA 4YJGB 4POAA 1IN7A 1J22A 1B93A 3UFXA 3T1YB 2Q62A 3RUEA 1E6LA 4ECAA 5FB3A 3GIDA 4L6CA 4N5DA 5FF9A 3VR2A 5JY1A 1JU9A 1WUYA 5IZ4A 1L6RA 3H9UA 3R2JA 4LK3A 2QG6A 4A8JA 3JVUA 3P2KA 3NTXA 4I55A 4COOA 4WECA 2D1SA 2C4NA 4RSHA 3GZTB 3W78A 5C46F 1BYIA 3IKLA 2CJPA 3QOXA 2GAIA 1FFCA 3AL3A 1R0BA 4DEXA 4EGQA 5CH8A 3TQQA 2OFWA 3O38A 3O8OB 3T7DA 2WHPA 3G89A 3IO5A 3AERA 3K0CC 1VKRA 4ND5A 4WV3A 1GZVA 5HFNA 3OZGA 3SMVA 5DX1A 5F64A 1QDUA 4P7BA 3ZW9A 4UPEA 5H80A 2QAGB 2IS6A 3KTAA 2Q2OA 2YY6A 1U80A 4EAAA 1P1FA 2ZI6A 6REQB 1P31A 2EBFX 3DEZA 5ANRB 5E8RA 4UE3S 5BRAA 1RD4A 1PFKA 1KK1A 4UCQA 5FYDA 5CCXA 3F3YA 1P6UA 1R7RA 1TCBA 2H0RA 3KALA 1FL9A 3G1TA 2DFVA 1I3KA 3VPCA 1I5EA 4RVUA 2BISA 3SZOA 1MR3F 4DB4A 2PVSA 1DFGA 2OSVA 2KHZA 3BRSA 1UFQA 3QF4B 1J2EA 4CHTA 2RHDA 2V54A 5JAIA 1MD9A 3AT1A 1J0XO 3R41A 4G0OA 1FMJA 1HSOA 1DQPA 4Y6PA 3C24A 1QS0A 5FYQA 1L4MA 3CZ4A 4OHVA 1DV2A 3E3OA 1JVBA 3TYXA 2C5BA 5I3CA 1TJYA 1FA9A 5SICE 3DOJA 5JNTA 2BFCA 1Q0LA 2WIAA 3Q9NA 1NDQA 3W3AA 5THXA 1X38A 2X0JA 4LKRA 4R1MA 1ISFA 3IJPA 2PL3A 4WY5A 1OCEA 2BDTA 4WQMA 5BURA 2QW1A 4RORA 4N3AA 3CEAA 1NXWA 1NLUA 2QM7A 3AUKA 3CPSA 4G1EB 4K1LA 5EXSA 3SBDA 4MR8B 2OXIA 4DJDC 3WGHA 3WICA 3HVUA 4YUAA 1V11B 4KP7A 3X1MA 1TGYA 3FI9A 5EIFA 4J2HA 1TT7A 4DIOA 3D7NA 4RDHA 4E12A 4EFDA 3M7IA 2JGLA 3PCRB 1KMNA 4ETNA 4JYBA 1U4OA 3FXAA 4G2TA 2CKMA 5KYKA 4YRMA 1OR8A 1W44A 3J81A 3GH1A 1V7QA 4YMTA 2UZAA 1R4NA 1E1NA 1Y80A 1Z83A 3K2QA 3KYDA 1UBCA 3M8KA 2JFZA 3ZQKA 3W5CA 4BLPA 1JLRA 1KSFX 3MMSA 3MXTA 4B5LA 1KEPA 3I5MA 4QOGA 1NTOA 2D74A 2H59A 5IEJA 2G40A 3FZEA 4MB6A 3VBCA 2GVZC 2G5GX 2JCYA 3AYZB 3JQBA 3KUDA 4YH1A 3TAXA 3WK8A 3QI2A 2DBQA 5BSFA 4BUZA 4YJKA 1XBTA 4CR6A 2B25A 3BEOA 3UC9A 1WMAA 1F4PA 1H4VB 4HLCA 5AI8A 4WN9A 3WKCA 1WZNA 4EEZA 1EFRD 4GPZA 1LBHA 1CY4A 3ND9A 4KNWA 4BASA 4EVRA 2WWRA 1F2TB 4BJ5A 4YS6A 5BNZA 4W1QA 3HYNA 2XF2A 4GI2A 1N6PA 2PMBA 4R7TA 1UDXA 5D5QA 3H5TA 2NXJA 1T1JA 1U2QA 4TMXA 2NAFA 3OHPA 1QTRA 2F00A 4URZR 5EVJA 5IVHA 4N8EA 3PGLA 5LXTA 2VDRB 1PWEA 1F48A 2FMKA 3ID6C 1Z28A 2B92A 1O96B 4XFDA 4ALKA 3M6IA 5FEUA 4MV0A 4QGGA 1CNEA 3UFXB 1R5JA 3BMCB 3OLQA 3E9DA 1WUKS 1DHRA 3DCJA 1NVUQ 5ITWA 4R2IA 1ZC3A 2ZI9A 4ALJA 2WOOA 2J41A 1N2CA 3N8NA 1F8GA 4D2IA 1E2BA 1EFRA 4G6ZA 4J4BA 3K2EA 3HRHA 1K8YB 3N2EA 5EKTA 4KXYA 2A1TR 1SCBA 3PXAA 4WZBB 5GV7A 1UBKS 1YI1A 2V6GA 6YASA 3G2KA 2RJOA 3U4MA 4AJKA 3X44A 4YRRA 3ZDXB 3GJ8A 2EW1A 4C29A 1ZOIA 1TIBA 4YT4A 3R40A 2WA2A 1PL6A 1LC0A 1ZZGA 4RPIA 3FM9A 1MIOB 3P20A 2JI7A 4JK3A 4DIUA 4QJ3A 1OXSC 3P5SA 5IVPA 1DS6A 2C98A 4IIDA 3CZ9A 2MYTA 2UZ0A 2MT9A 2WV9A 2XJ9A 5JU6A 3LF1A 3OT1A 5FDFA 3WKEA 3MVEA 3FMVA 4CW7A 1DBRA 3ZWNA 2X0DA 4PGFA 2GAOA 5BVGA 1B26A 4B80A 2OHXA 4BJHB 1W9HA 5FA8A 3GAZA 1OXVA 3WKBA 3F7NA 3PXBA 2J7PD 1XZAA 1X0VA 4JBWA 2Q3LA 2CDBA 1SG0A 4M0MA 3GVPA 5IJ0A 2DWQA 4HEHA 1V3VA 3C3WA 4PQGA 3CHYA 4BMOB 3L05A 1QG4A 2GS9A 1AUPA 1FU4A 3KZOA 2YIDA 5TF4A 1ADFA 2YWEA 1BWRA 4IWXA 1GTL1 5LYYA 5U4QA 3T3EA 5LQMA 3QI7A 2C3YA 3AR6A 2JGKA 4M7RA 5E2IA 2PRJA 1ENZA 1Z35A 2VWHA 3KT0A 1Y5MA 2QRLA 1H6AA 1E5XA 4NKRA 1C0KA 3I2HA 4MA5A 2DLDA 4Y2RA 3NCTA 5F52A 2QORA 3MWEA 1PE0A 2D4HA 3KKKA 5CM9C 4EUEA 4CIXA 1GCOA 4CMKA 4CMAA 1ZVQA 1SUEA 4H4EA 5ALEA 4BX9A 1KRWA 4MKFA 4BN4A 3LK6A 1B8PA 1K6JA 3AF0A 3T9CA 1NXOA 5EWMB 5AVSA 2YV2A 1UXOA 5LQRA 2ID7A 3KD3A 1XZHA 2YVUA 3ZGYA 4KRGA 1GFZA 4QXQA 4U02A 3Q8MA 2C54A 1XGKA 3OBIA 4N4AA 2GZAA 4MI6A 4BNNA 4B3GA 3WGOA 2X4GA 1PYOA 2VA9A 3W7AA 4X6UA 2EYQA 1IBMB 1N6NA 1FFHA 4MH0R 3C70A 3CNNA 1MKYA 1VDMA 1JFFA 4KPGA 1JQ3A 3CISA 4Z4HA 1X9GA 3DDUA 4CQMA 5SYNA 4JJFA 3TRHA 4J76A 2C7QA 4Q02A 5ES3A 4URFA 1KI6B 1SGWA 1X7YA 1E77A 2VDNB 3ADOA 4ZPXA 3KLPX 4TXHA 5AQEA 3VU9B 4BJ6A 4CI0B 2PRYA 1X7GA 3T5MA 4DIMA 3BIFA 4V0OA 3OAAD 1T25A 3JQDA 5AXCA 3CVOA 1XI2A 3RYHB 3AG5A 3RAEC 3JQ9A 2W6IA 3LBHA 1RWMA 1RP1A 1HXHA 3IULA 3TMKA 2L0XA 3WNDA 4L78A 4MWZA 4TQ9A 1MV8A 5KBYA 3EC1A 3KKMA 5A6SA 4F4FA 3LQFA 4LPSA 4R1PA 1E3QA 2G06A 2UV8A 1CY2A 3K35A 2PL5A 3I05A 4GBED 1EX7A 5FHRA 3V1NA 3U80A 2EKBA 3E3LA 5DP2A 4S05A 3F6SA 4CDMA 2NU6A 1NX6A 1NOIA 3HB1A 2W4QA 1SBNE 2Z8ZA 1OUMA 2CVFA 3CEMA 1TT5A 1DDIA 4OUKX 3VISA 3CSDA 3DD5A 3RVOA 3D5QA 3ESYA 2AFRA 3VR2D 4XWYA 3GLIA 2IIPA 3DH0A 3HU1A 3OO1A 2ILVA 3DFMA 4F06A 3W79A 1KRXA 2J09A 1GNQA 4GPAA 4B17A 2Y1EA 4D57A 4D9IA 1Y7PA 2IYAA 3KOYA 4Z7OB 1AGNA 1TQ8A 1K75A 4ZO9A 3THSA 1NIPA 3CLTD 2QU8A 1JR3A 3JZDA 3JQEA 4H4CA 1CVLA 3JCZA 4PC7A 5C53B 3FTFA 1Z4QA 2PX4A 1QHHA 1B6RA 2W22A 3Q3JB 2IPXA 2QUAA 3KAPA 3RF7A 2H4ZA 5KTTA 3LRPA 4ILKA 1XZDA 1NURA 5KYNA 2VTEA 1G5PA 3T12A 5K3BA 4RH0A 3BS4A 3M9LA 4NFLA 1AE1A 4BMCA 1CB7A 4UASA 4NH0A 5CK4A 1WZIA 3EDMA 4PC1A 3KVVA 5IDVA 1XC7A 2BBSA 4MZDA 4G4SO 4LXXA 1HETA 1FFYA 3AFIA 4M88A 5LCXA 3C5HA 1GSAA 1VC2A 3AOGA 3QEAZ 5ALMA 4EB8A 2ZJZA 3GJYA 1YV9A 2IRWA 3LPNA 3U7QB 2NYAA 5DLDA 5GONA 3RWMB 4NBNA 2NQTA 3L4BC 3MCWA 2E87A 3JQGB 2C2MA 1GSHA 2JVJA 4RHUA 5CA1B 4D1YA 4E6PA 1D04A 4W9RA 5D00A 2N1BA 3G9UA 2YRXA 5DLYA 1T2FA 4Q4AA 4M1TA 2PS0A 1W48A 1F6BA 3VO8A 4BJ1A 1HOTA 3KSBC 1Z33A 4G2NA 5F9MA 4RF5A 4I2NA 3T1TA 4PQYA 4JKYA 3U44A 4DSTA 3IXLA 4HATA 2VJBA 1SBYA 1ZVVA 2GERA 3OZAA 2PQ6A 1R6AA 1IWPB 5JXJA 2I62A 2QMEA 1PIWA 1IC6A 2RAPA 1RJDA 4PZCA 4OI1A 3V7UA 4OMCA 3DMHA 3JATA 4H3KB 1N6OA 3UAYA 4CLXA 3B36A 2QUJA 3CB2A 2LCIA 3LNTA 3G88A 3MPUA 4B7CA 5JZSA 2QUHA 3ESXA 2B6HA 2D5LA 5EWJB 4QGBA 4AWBA 1V8ZA 2DFKB 4DILA 4MV1A 4WY2A 4D74A 1JZQA 1G5FA 1L4UA 4BNTA 4MULA 4OU5A 3ZCUA 2I65A 2ZOSA 4MDHA 3UHOA 1QFJA 5BP7A 2CJFA 3R8FA 4OM7A 3DE1X 2BR4A 4QU0A 1OFUA 4Z0HO 1S4MA 4AJJA 1EVQA 6REQA 4ZOLF 2BZGA 5AHRA 2FSPA 2HQSA 4JHXA 4N5HX 1MXFA 3EQ8A 4XH9B 1E1QA 3K9LA 2DCMA 4M9ZA 3L6EA 4OQYA 1ZIXA 4AG5A 4EVIA 3E8SA 3RHZA 1D1QA 4PPYA 2B30A 2MR5A 4EATA 1WXFA 2WWHA 1CD5A 2NQ8A 4PC2A 5IP5A 5C8VA 1A2OA 4YCAA 3MAAC 3ZYCA 5K3DA 2BFNA 5CGZA 2WT4A 2BEWA 1P91A 4ZVOA 2NPOA 4DA9A 2JI4A 4E2YA 1H8EA 1P9RA 1U1FA 2VWPA 3ZZ0A 4PSVA 4GKAA 4I9UA 2C7GA 1D07A 4XJXA 3GQBA 1P2BA 1ZXBA 4MDYA 2QVGA 3C43A 3DP9A 3O4FA 5DWQA 1JXAA 3AW9A 3C97A 4WY8A 3OLYA 2XRZA 4KNYA 3KSMA 3NALA 4NV1A 3EXAA 2ZSUA 4CF3A 2J0SA 4BAUA 3JTEA 5ESXA 4MCHA 1PJ4A 1W1UA 1XTBA 3GJRA 5I9TA 5FJIA 2J1LA 1ND5A 5AHWA 2ZT8A 5I7VA 3LGSA 4XGRA 1TJPB 3A36A 2ORED 4W82A 3AERB 2ZUEA 2HIAA 3OZBA 3OTQA 4W1SA 3IEPA 4G81A 2QSZA 4XXHA 3BILA 3FKJA 2C42A 1TKCA 2A4MA 1M54A 7MDHA 4OYRA 2P41A 5INTA 5F98A 2AOXA 2HK9A 4YWHA 4R1LA 4Z8YA 1MG5A 3D0QA 2JH8A 4I4LA 4ND4A 2BIFA 4ALLA 3W0LB 2E4XA 3PUIA 1JEYB 3EHDA 2ODWA 1MXHA 3LUCA 1G6HA 1QB7A 2AIRA 2VSNA 1X1AA 1VE5A 1T9KA 1TLTA 2JEZA 2BUAA 2XRFA 5K8IA 3UCEA 5DM70 5LP1A 1H4QA 1V8DA 2OFPA 1RW4A 4EI7A 4OQ4A 3AR3A 1DJQA 4AX8A 5KOHA 5MFPA 4HVCA 5LLTA 1MQSA 1P8JA 1EA7A 1QYCA 3E70C 2W2KB 2GR9A 4LYJA 3TZCA 2P6PA 1R0KA 1VYHA 2WUGA 2YHIA 3JD0A 1T2DA 4WOPA 3P9QA 2XUHA 4KCGA 5CCBA 4JQSA 1WY7A 4RMNA 4D99A 2L19A 2W8ZA 3RAPR 2CLIB 1TFRA 1T15A 3TW8A 1FMLA 2EFYA 1I4TD 3MWDB 1RWPA 4RFSB 4XUGB 3PGKA 5I4BA 1NXXA 4NU0A 2JJYA 2XBUA 5HGJA 1KDVA 2R7MA 3JYOA 1IY8A 5FI3A 2A9QA 3H8WA 4IQ4A 5H70A 5HIKA 2IS1A 1PTKA 4MR9B 4KRXA 3NHFA 2QT0A 1SCIA 1VYVA 1CJMA 1ISGA 2XHEA 2DX7A 2HRDA 1A98A 2DBRA 2QGFA 4OLFA 3FGZA 3U26A 4RM2A 2HWYA 1GWNA 4GP6A 2JJQA 4F4HA 3PI6A 3A2LA 5BSVA 1TIPA 3T7SA 3TL3A 1M1YA 3MAJA 4RIGA 4WNYA 1EDOA 3TQOA 1UPBA 3T7TA 3U3MA 2OQRA 1XCGB 1DTEA 2B3DA 3GUZA 4HZUA 1IIRA 1Y48E 3WO1A 4QGAA 2XMSA 2FJ0A 2EX1A 3SEQA 4QXOA 4MEJA 5HIIA 4A2CA 1RZRA 3RT9A 3TAHA 4U1RA 4G1UC 3NRCA 3M4XA 1NRXA 5J5CA 1R6VA 2W2OA 3IIMA 1NPTO 2CUKA 4WK2B 5TJ9A 3SJBA 1LK5A 3MMPA 1VECA 4G09A 4PNZA 1ZU4A 4DIBA 4XR9A 1A77A 1FLNA 4MW2A 1YNOA 1SU6A 5EWLA 1WHSA 2JGNA 2ICAA 2NZ2A 1XP8A 4MW0A 2D54A 3MGKA 5LLDA 3L7IA 3FGNA 3FZQA 4ZVMA 2Z3VA 1SXJA 1T8YA 2FFBA 3WYFA 1W0KD 3GLIE 1KE1A 4IQGA 2Q7OE 4J0CA 4QFMA 3K5PA 1XTKA 1G8PA 3HBFA 4Y2VA 3CIFA 3LLUA 1XDBA 4XB1A 1M1YB 1W0CA 1E63A 3VNSA 3H9GA 1KOLA 1UOOA 4OQNA 3U9LA 2PU5A 5DSTA 1HO3A 5I5GA 2W6QA 5D3MA 2B4KA 2RI1A 3B5JA 4LV5B 3ZZTA 3WLHA 4D9NA 1DZ3A 2RKWA 3MMXA 5BV2P 3CN7A 4ZVNA 4YLEA 3IDSA 4GZ3A 4J9UE 2ZWOA 2B0CA 2JFNA 5ALNA 2I55A 3CXUA 3PNSA 3EIXA 1HYQA 1KKUA 2AYYA 1J2JA 2GK4A 3F98A 3LQ4A 5EMJA 4JVMA 5C31A 1RCTE 4U7GA 4XIIA 4HNUA 5JH7B 3JQAB 3NV7A 4JXXA 3K9BA 1XFAA 4ARVA 2QTFA 5ARDA 5IASA 1G8GA 2M1XA 1HRKA 4DV0B 1KH3A 2O2HA 4MGEA 4B1FA 1MABB 4Y98A 1C1YA 3HUDA 1Z25A 4XB6B 3ZHTA 3FRHA 3GAMA 1KEKA 2O8CB 4MCIA 1JFVA 2PVCA 2RGNC 2EGHA 1ZN2A 2PGDA 3SBOA 1ZKMA 4MV3A 1OXXK 1MB4A 2ODEA 3OJXA 4NBSA 1EE9A 4H16A 3AM3A 3WAJA 4IVRA 5A71A 1ZJ6A 2VH5R 5K3SA 4DR1B 1QOZA 4J7CA 1Z07A 3VHRA 2ECFA 3G82C 3SPXA 1SKAA 3VH2A 1Z0FA 2FNAA 4ND8B 3U60B 1RLMA 1RHRA 2GN0A 2VQ3A 4MRSA 3LKBA 1DBQA 2IZ0A 5C34B 2YQ5A 5FTJA 1BDMA 3HCBA 4Y0AA 2JHAA 4GH5A 5CB0A 1IL0A 1EGVB 2OCKA 1DO2A 1NL3A 1FBTA 2QMZA 4N0QA 4YP9A 1J97A 3CLTC 1E9AA 5TQ0B 4DA4A 3TLEA 3DZHA 4W7IA 5H3LA 1RM0A 2D2EA 5DBFA 3SIXA 3I1YA 1J8MF 5K1ZA 3CEJA 4N18A 2YBDA 5HHTA 1I7SB 3T1VA 1AB6A 1Z5NA 4G1FA 5KYUB 3QUTA 3D4IA 4KTVE 1TC1A 3EXEA 3K6SB 4JEIA 5HZKA 3OZWA 4JVSB 4RZHA 1O54A 4F6RA 4QDKA 3ESAA 2PQMA 2ABWA 3KPJA 1JP7A 2P62A 3PXUA 3JZIA 5BOSB 3W4IA 1GCUA 1LWNA 4ZMRA 1JEYA 3TZEA 2PSEA 1YFZA 4NS4A 2VEDA 1XHLA 2NVUA 3WL8A 1QR2A 3OMWA 3S81A 3GCGA 4TUYF 1BIFA 3QF4A 4IUBS 3CX4A 3L7MA 4K8RB 1KIFA 5JAUA 4HUQB 2FMUA 3LDHA 4L57A 3W6PA 2WJYA 3OO0A 3TUZC 2Q6IA 2ZXUA 4GZLA 1WNFA 4C4SA 3GLKA 2PKQO 2HJVA 4NMLA 1TQ2A 2BEUB 4TT8A 2ZSKA 4JBIA 3HGQA 4NXMB 3GZNB 1BJRE 3DV2A 1EHYA 2ODNA 4QHSA 2B4YA 3WB9A 4ZOLB 4F9GA 3K1YA 5E9QA 4TRNA 5ER6A 2PBZA 4B7ZA 4KITB 1D9XA 2DERA 4K2AA 2WE7A 1A4RA 4C21A 1GAXA 1EM6A 1T5BA 1S8AA 3KHKA 2CYAA 3NXKA 3SX4A 4EEXA 3F2IA 2CZQA 3ZCTA 1DC4A 3DEHA 1U8UA 4G5OA 2R96A 4HNHA 1FYFA 3W1EA 1E3JA 1XRRA 1Z5WA 2BRUA 4K28A 1YZ3A 4M6WB 3IT2A 5JNSA 2H9YA 5FI1B 1Q22A 1GD1O 2EDAA 4W5JA 3EZFA 2OPBA 2HA3A 5CJ2A 5ENDA 2HNBA 3DL7A 2PWZA 3P9XA 5IUNC 1BNCA 2Z2JA 2CJXA 3KWMA 1GCIA 1MG0A 4W1PA 3NBKA 4YT5A 1ZM2A 2IZ5A 2WYVA 3GJ6A 5C32A 4WJZA 4KHPB 4QOJA 4UATA 3U37A 1RFGE 1PCXA 1VYTA 2CLHB 5FO1A 1HL3A 1V16A 2Q6VA 3CUVA 2AB0A 4KLNA 4ZAGA 3WQRA 5C8YB 5I6DA 4L8VA 1M1ZA 1FLVA 1G8JA 1TZ2A 1WSAA 4HCJA 4TTRA 1YJ8A 1W8DA 5CLQA 3HEMA 1XCMA 3WAKA 3NWPA 3DWEX 2ISSD 3HLKA 4GYWA 1BX0A 4RTPA 4EGFA 1TB4A 1KP9A 1A1VA 3QOWA 4U6QA 1U0JA 2SCUA 1BFDA 1WO8A 3OIUA 3W2EA 5JTTA 2Y3IA 4Z4FA 2X86A 1I6LA 5DWVA 3FPJA 2Y27A 4PXSA 4AI6A 4JB3A 4PHGA 5FBWB 1T0IA 2WDPA 1JYEA 5IC5A 3RBVA 3PXEA 1XRQA 3WP1B 1XHEA 4A1FA 4RGVA 1YZTA 4PU0A 3UCFA 3HXMA 3UAZA 4UXJA 3L4JA 4UEOA 3WLNA 1J9EA 4ETWA 4JP1A 2HOQA 4M53A 4B2LA 2WWWA 5K4GA 4DJJA 1U7XA 3HO8A 4NBUA 4Q16A 4FU0A 1ZITA 4QXAA 4UUQA 1GTJ1 3JQ8A 1II8B 2IYSA 4AZWA 2QS9A 2W83A 3B85A 2ZIXB 2WA1A 3ECAA 2XVXA 1JG3A 1XMSA 2QQ5A 2YZGA 3A1VA 3TVYA 3WIBA 4KDFA 1JSZA 3CZCA 1XZKA 1SQ6A 2VT3A 3FMOB 2JCSA 2R7AA 4KQHA 1LF5A 3ZE9A 1GDDA 3F8TA 4YJHB 1IOZA 2FSGA 2QXYA 4PFKA 1R4MB 2D1FA 3A1FA 3IJRA 1ORTA 2IYOA 2V7EA 3L01A 3WRXC 2WM9B 2ODQA 3HSKA 4HD8A 5K5EA 5IT9A 2VP9A 7YASA 3AEQB 1ZFNA 1PJ8A 2V55B 1V1MA 3ES9A 1JQBA 3IUEA 3QUQA 4LECA 4U7HA 1G2IA 4LXYA 4GI3A 4NNPA 4WCDA 1YUNA 3N2ZB 4RH1A 3IUBA 2AA3A 5CT5A 3SSOA 4BFCA 4CQJA 1QWSA 2QQFA 4A26A 5J58A 1E2MA 1JKFA 1ZJ4A 1X1DA 3HL0A 2NV0A 3OEEA 5LSAA 1KZ9A 1QHIA 2VRBA 2CK3A 3GDOA 1T8UA 3GEPA 4R7ZA 2XCLA 4KQJA 2QXTA 5HTKA 5U9CA 2XGGA 2H2DA 2R87A 4XQ9A 1T8RA 1NUAA 1MO4A 3N8KA 1D7OA 5TQVA 3WHIA 1TF7A 1SC9A 5G1NA 4WLVA 4YJ2B 1GQQA 1KBOA 2PZBA 3SZRA 1AKWA 4F4UA 1Z82A 4YALA 3VX3A 1GAJA 1Y8CA 4TLDA 2VJPA 4XWTA 1GHTA 5KQMA 2VG8A 1PV2A 3F3MA 4L07A 4BWFB 2CFTA 4D8VA 1F0PA 1KY3A 3V1MA 1YKSA 5F7OA 1NBME 4E14A 3HTXA 4LJ5A 2FWAA 4FSDA 4B87A 1FEZA 4QQ8A 3T9AA 2X3UA 3PITA 1J70A 3KQWA 4EY7A 1OI2A 4UOZA 3I2GA 1RC0A 4MSUA 4OM8A 4AZTA 4BMSA 5ALQA 2XKKA 3HB7A 2IVFA 1N5JA 2FZVA 4J4TA 4Q66C 3W90A 1KIAA 1RCUA 1QQBA 3PJGA 1PD1A 2IIBA 1XVTA 2ZUDA 2VEOA 2ZWMA 1M2JA 4HSEA 1EHCA 1RQGA 4QHTA 2ZI5A 3L77A 4GGOA 1L3BA 3N8HA 5BNWA 5CFQA 1Z7WA 4CKEB 2VCEA 2FWIA 1NT4A 4M49A 3VBEA 3LK7A 2ZBUA 1ISRA 4MYCA 1WD7A 2ZYHA 3A70A 1P62B 4C06A 1WP4A 3IAUA 2YNMA 4B4UA 2Z3ZA 4ES6A 4IYJA 2XB8A 2OAP1 3G2OA 2PRSA 2AOWA 4HHEA 4N3CA 1T6BY 4DA7A 5ILOA 5HQ3B 1ONBA 4F9EA 3WB0A 1DJMA 2EZUA 1X1SA 4RA9A 3VR6A 5DT9A 4DC0A 3P5BA 4DLLA 3S99A 4LDPA 3K9HA 3UN1A 3QEMA 4R6XA 4ZIRA 2Q45