3V4LA

Mouse malt1(caspase-ig3 domains) in complex with a irreversible peptidic inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
386
structure length
386
Chain Sequence
GQPLAKDKVALLIGNMSYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDPVQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVTDFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGKPLIAKLDMHRGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/inhibitor
total genus 121
structure length 386
sequence length 386
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
A PF18703 MALT1_Ig MALT1 Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3360 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v4lA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4lA01
3RJMA 2C2ZA 1RWXA 3PCXA 3K7EA 2K7ZA 2QLJA 1M72A 2J31A 4FXOA 5IARA 2J32A 4LSZA 4JR2A 5LUBA 1SC1A 2CNLA 1RWPA 4QUBA 3S70A 1CP3A 3V4LA 1RWOA 3NR2A 3V4OA 3V6LA 2H4YA 4DCJA 3NS7A 1RWNA 3H11B 3R5JA 4QU0A 3EDRA 4QUAA 4AWBA 4N6OA 1RHKA 4N7MA 3KJQA 5IAEA 1NW9B 3R5KA 3V3KA 1K88A 2XZDA 4JJ8A 5LU9A 3R6LA 4HVAA 4NBKA 5IASA 2XYGA 5JFTA 5K20A 4JQYA 1RWWA 5IAGA 3S8EA 5LUAA 3R7BA 4NOKA 2DKOA 2C1EA 3NKFA 2H51A 3H1PA 2CNNA 4N7JA 1PYOA 2HBRA 3EDQA 4I1PA 2WDPA 1K86A 4ZVQA 3GJRA 3H0EA 1GQFA 4JB8A 4PRZA 1SC3A 2CJYA 1I51A 1NMSA 4JR0A 1I4OA 5I9TA 4NOLA 3R6GA 4DCOA 4QUJA 2FUNB 4HQ0A 4NBNA 4EHHA 1JXQA 4D3YA 2C2MA 4EHFA 3E4CA 3H13A 1I4EB 1RWKA 4N6NA 5IC4A 1RE1A 1QTNA 3V55A 2XZTA 4QU9A 5IBRA 5IAJA 4D3ZA 1CVRA 2H65A 2CJXA 3PD0A 4M9RA 3IBCA 3GJSA 1RWMA 2H5IA 4HQRA 4PS0A 3PD1A 4FEAA 4ZVSA 3BIJA 2HBZA 4ZVRA 2FQQA 1RHUA 4QTYA 5IANA 3SIPA 5H0IA 5I9BA 4AW9A 2NN3C 2HBYA 5IABA 2QLFA 2QL9A 5IBPA 1RHQA 3OD5A 2CNOA 3D6HA 1BMQA 2XYPA 2Y0BA 4QUIA 3GJTA 4QUEA 1F9EA 1PAUA 5IAKA 4NBLA 2P2CA 4EHLA 4IEFB 4QUHA 3D6FA 4QUGA 3R7NA 4DCPA 4QULA 4D3XA 4I1RA 1RHJA 3DEKA 3P4UA 4NOJA 5IBCA 3DEJA 4EJFA 3SIRA 3D6MA 3KJNA 1NMEA 4QU5A 2CNKA 4EHDA 2HBQA 2QLBA 4JJEA 4EHNA 3DEIA 1IBCA 4PRYA 4ZVPA 2CDRA 1RHMA 4N5DA 2QL5A 4N6GA 2H5JA 1SHLA 2QL7A 3IBFA 4QU8A 3P45A 1I3OA 4PS1A 1NMQA 1ICEA 4IYRA 4FGUA 2H48A 3V6MA 2J30A 5LU8A 2FP3A 4JR1A 3H11A 3QNWA 3KJFA 4ZVUA 1F1JA 4AWAA 2Y1LA 3R7SA 1RWVA 4QUDA 4EHAA 1KMCA 2H54A 3DEHA 2H4WA 4QTXA 4ZVOA 1SC4A 2XYHA 4EHKA 2AR9A 4NOMA 3ITNA 1RHRA 3UOAB 4ZVTA 2J33A 4FDLA 1QDUA 1QX3A 3GJQA 5IC6A 4JQZA 2C2OA 1SHJA 3UO8B 1GFWA 4JJ7A 2C2KA
chains in the Genus database with same CATH superfamily
3EAFA 2ORBL 3LKQA 4OHVA 1PLKA 3HG0A 3KUCA 2ZCVA 3P52A 1AJ7H 4PTTA 3TQOA 2PN5A 3HCRA 3GDGA 2YXEA 1P77A 5B1AB 2I4TA 5CA1F 4PQEA 4Y6QA 5CS7A 4M8SA 4JJ8A 3F6BX 1KPVB 1JTTA 1Q9KB 1OTHA 3DV2A 2YN5A 5IRCD 1N68A 2F15A 4GP6A 1ES9A 5EU3B 1MVOA 2DHDA 2HJLA 2FRXA 3HDYA 2XTNA 4OLUL 1GTL1 3A4FA 1ASQA 2KLTA 1RABA 2K78A 1L7PA 3HU1A 2Z1KA 2QSCH 4E4RA 1NC4D 3IU3A 3HB1A 3JQDA 4HK4A 4MJ3A 4KN5A 3P9MA 4BKRA 3VO0A 4DEWA 1D5MA 4KK5C 5E2TH 5AVRA 4Y5XC 3W3BA 4G7VH 4L07A 3ZDRA 1E92A 4KNUA 5C3LD 3TYXA 2C9RA 4F5WA 4XPIA 5DD0H 5EHGA 4UEOA 1DUYB 1ADCA 1V6SA 4XXWA 1ZLDA 3EYOB 2WE8A 2EYQA 4Z0NA 3O4IA 2Q5FA 2E4YA 3I9NA 1PEWA 3U1PA 4AQYB 3B5GA 5AB1A 1LPAB 1X8XA 3IEAA 1CQIB 5CTAA 3F85A 2GTIA 5ANME 3ABQB 3AM8A 4XGZA 3FOMB 1RJZA 1YRHA 4AWAA 3T5AA 3LO8A 4M22A 2WN2A 4IW4C 1YNLL 3MLRL 1EXDA 5G4NA 1XJ0A 4Q0XH 1E99A 3ZX1A 1E1CA 5F64A 5SWSA 2WU0A 2RAMA 3KMDA 1KGYE 2C95A 4UOEA 1P2DA 5LAPA 3IKLA 5CDYA 4Z76B 1B2LA 4FEYA 4PYJA 4LGPB 3DKPA 1GSHA 5FUMA 3GF4A 4XARA 4DMFA 4N6QA 1ETZA 4H6PA 4IS6A 3D05A 1OB0A 1WHSB 2DYSB 5DJ0B 1HC7A 2XKBA 3K71B 4JB9H 3G08B 5HCNA 4AP5A 3LQMA 4HYQA 3FYSA 4ZVQA 2C9ZA 3RBSA 2IUUA 3D3VE 1KLUB 3KM0A 3W90A 2XOKA 4NFCA 4OLWH 5IBLC 3S68A 2EQDA 1DKRA 4W5QA 1E9OA 6LDHA 4FLEA 1T3LA 4TRRA 4EMUA 1U0GA 1P0MA 4LL9A 2JVKA 3F7VB 3J7HA 1N2ZA 4U1KA 3WY4A 2ZSFA 3FOAA 2HH0H 2QVFB 1TITA 3ORFA 1NQBA 3GLZA 4GUDA 5L3SB 4TSKA 5JRDS 2BR4A 4Z7VA 3V6ZA 5TQ2A 5IAKA 5DNAA 2J8UF 5AP9A 1HZHL 2WJZB 3K20A 4HIIB 2WRZA 2DHRA 4GSUA 3DEJA 4HNSA 4ZO4A 1HQCA 3UAXA 4WZ6A 1GZ5A 2DZEA 2XLCA 1G21A 1PY9A 3DA0A 5DU7A 2PMEA 4URHA 1WLYA 3HA7A 2O8EA 2XQ0A 2AWOA 4BO6A 2YJLA 1ZPUA 2BFVH 1C9SA 4R4NC 3K8MA 4JLSA 1U6AH 1SQMA 3B3BA 3TX2A 3EZJB 2IV2X 4L0CA 3AM3A 3J8F7 5GADl 2XWSA 4HTAA 5KBNC 1PTJC 4B6GA 4BIKA 1EZUA 2V2WA 2GFQA 4LVCA 3I42A 2BP7B 1NRJB 4E0BA 1BD2B 4QTIL 1T6XA 1HHKA 4HX1A 1WWBX 1Y5RA 3S7TA 5DURB 2JCCF 5DHMC 3NDIA 1CMOA 4CEJA 3LFUA 4DK3A 3Q8BA 2C4HA 3T1OA 3OCUA 2WLMA 2Y1EA 4LHVA 3G6WA 3RVVD 2P5TB 1BGXL 2WFLB 4H8VA 3PDJA 3EOBB 3LNHA 2Y5EA 3L3JB 1N5KA 1QVVA 3HR8A 5IPFA 3CEJA 4V2CB 4GMTL 4ODSH 4K23L 4A2LA 4UDOA 1E3WA 1NXVA 1IU1A 2ICEA 3HHEA 1EXUA 1X38A 2DCMA 1AQ8A 1N2CE 4TROA 1DCMA 2G9UA 4NT6A 2WB2A 3HFFA 5BNTA 4M62L 1JA0A 3KD3A 4H1LA 4B3RB 1IE5A 4JBNA 2O5YH 3IAFA 4MUBA 4C0AC 1AZUA 3RWCB 4QXVA 3MS7A 4LF4B 1FAIH 1JG9A 1YZHA 2N1BA 3UOGA 1H94A 4WKGA 4FDUA 1LH0A 3JXAA 3DB2A 3ARFB 3JWDC 1VLVA 2ECKA 3LVEA 3OHPA 1NLBH 1N6UA 5CLZA 3GGPA 3P0HA 3D39A 3BF8A 3KKNA 3SCZA 1YUHB 4ELKB 4XRRA 1ZA6A 4ZMTA 4MR7A 1WDAA 3OSZA 1U8KA 5J9PA 4QHLA 1C4OA 3BB4A 1QFHA 5CEXA 3U62A 4BFTA 4I3RL 1EDEA 2VNSA 4FCVA 3BQVA 1QEWA 2GCOB 3NP4A 1M6OB 2VC2H 1VGKB 4TXJA 2W9DL 3ZU4A 4K2HA 2PHZA 1AZRA 4GSDH 3ICOA 2FWMX 4NERA 2A73A 1D2EA 3GFUA 2LCQA 3DDFA 3KFLA 4NX0A 3K70C 2PFKA 3V2AR 2FEDD 4N3UA 4PJDA 4NRYA 1PSZA 5FKAB 2DLHA 5GM1A 5L3QB 3BRFA 4C6TA 3GSWA 1F6AB 3SXPA 3MLTA 1FN4B 2VDRL 2G1PA 1LP9A 2GYSA 3WIOA 1XZ8A 2I71A 2GH1A 2CV2A 2X2HA 3CA8A 4YLQT 2VW4A 3A14A 3BKWA 1CUUA 3NHZA 1YQWA 4Y4KA 1A7OL 4OGQC 2VDNL 3GB7B 3WSQL 5I15H 2YJNA 2CO7A 2PGAA 3ZTNL 5BV0A 2K7FA 2V2XA 3VGAB 3WB2A 2ZIZA 2ZYUX 1QSVA 2VOJA 1VCAA 4ELKA 1KSFX 1JPTL 4UINH 4E70A 3NIWA 4KH1A 3DEIA 3M8KA 4O4JF 1NPNA 4FNQA 1I4LD 4YDKH 3BD3A 4Q48A 2FR8C 4PJBB 4ZD6A 4FFBA 1J0KA 4R2LA 2GBUA 1ICIA 1EDYA 1ZEMA 5P21A 3EVNA 1FDUA 3H4HA 2FJPA 4P2AA 1CJVC 3H1FA 1D2PA 3UBGA 2RHCA 1AGCA 1BGXT 5AXAA 2CHQA 2P2YA 4PNPA 4PWYA 4PGDA 4ZK6A 1MWOA 2IWEA 1DDHA 3QJOA 2GBPA 2OX5A 4ACTA 4WA7A 1YYCA 4WGWB 3GLTA 3LS5H 2HTFA 3O3MB 4I1OA 1ECLA 4WFHE 4RD2A 4NOFA 3LTVA 4YDSA 4A8PA 3IUNA 1KFGA 1WCBA 5AVQB 4QTHA 3ARFD 2HLPA 3M33A 4NTZA 4FNAA 4R7NB 2APFA 3WYAA 1XIWA 3RTCA 3A1FA 4M9UA 1AM4D 1GPNA 5D5PA 1A3LL 1A98A 3WLMA 2X9ZA 2BSXA 3HU3A 1F2DA 3UKOA 2BIQA 1VA9A 5AW8B 2LNDA 1I3LA 4KREA 2AEFA 1K5NA 2Z09A 2BZDA 4JP5A 2CL7X 1MVYA 5DHQA 1BHSA 1WB6A 4YRKA 1QRNB 2C00A 4NLLA 1AQNA 1N3NB 2RQ8A 1K85A 4JUTA 3VYWA 1TKRA 5DOVA 1LGVA 1SZNA 3BIBX 1NTRA 4M6ML 3W4JA 4DIFA 1JYFA 4IMLB 3A3NA 3QFJD 4G8EB 4NKDB 4GL4A 3KCWA 2B8EA 3ARYA 4PSAA 4EABA 4HI0E 4Q00A 4PGBA 4NOBA 2I22A 3JQ7B 4BSWB 1NJ1A 1Y33E 5C08D 4H59A 2JGIA 5DQDH 4BUGA 4V11A 5JQGF 1YECH 1K7FB 1J8SA 1E5YA 2CLDX 1PQZB 2YJ5A 3GXIA 3RPKA 5HI5C 5CM2Z 4D4JA 1KIMA 4UNSA 2WQWA 1YRLA 3TGWA 2AYYA 2VF7A 2Q0ZX 4NI3A 4GIBA 5MERB 2OCBA 1YS2X 1HZKA 4Y1AB 4RKWA 4TOIA 5EMJA 1CG9B 4JLBA 3AG3B 3LYHA 1NKRA 1AGEB 1PZGA 1DQYA 5LDGA 4MVBC 2BSED 3LTNC 4HPJB 2WC7A 1XP5A 3KL2A 2C3VA 3ADBA 1X9UA 3OOWA 2R51A 5EHNA 2JG3A 4KV5E 1RS0A 3D0AA 2NT4A 5KC8A 5DVLA 6GPBA 4XCNA 4HEPG 4MQ4A 1CF4A 3G08A 2JIDA 1XJ5A 1UM6L 1FSFA 1CETA 1OM9A 1R3IL 3G9AB 4NFLA 1BIHA 3DX9A 5F7WC 2IGLA 4D3YA 4OTZA 5ABZA 3K09C 1QP7A 4HFNA 1RWKA 1RK7A 2IALB 4YDLC 5EY5B 1OT4A 4Y30A 3O8LA 5E8DH 3U6XA 4RF2A 3W5VA 4PN6A 4WUUE 1U1CA 2C57A 3LQYA 4QEZA 4A7PA 2X9GA 4U6VH 2YOCA 3QR0A 1C3OB 2AW5A 2FZ3A 1DKMA 4UV7L 4TUKH 2CLRA 2W6PA 2DYRB 2NY2B 5CU9A 4AVJA 2O8VA 4OU4A 1IIKA 4I2NA 3SPVA 2BGMA 3ST7A 1IJ9A 1UZ6F 3A0UA 1VSQA 2GN2A 3QORA 5K0ZA 2GK0A 4WBNA 4H0NA 5LP1A 1CUGA 2QE7A 3UZQA 2QDVA 3LKDA 2GCEA 1L3IA 2NXCA 5LP6F 4X85A 4BXVA 3TIDB 3CCFA 2XYHA 4MS3B 4NDZA 3TW8A 1OB5A 4A2QA 5K3FA 3BJLA 1JZIA 3QWRA 1PZBA 2ZCKH 4KN8A 4JFDB 3GMMB 2X6CA 2C9AA 3PU7A 3PDUA 1XCOA 3PEWA 2ZWYA 2CV0A 1HKLL 1KAQA 4U6XA 1V5IA 1S8AA 2IO5A 4NP6A 3BZWA 2QZJA 3H5WA 4G8FA 5TPWH 3EXAA 5DTJA 5EVCA 2J8HA 3O3AB 1JR6A 4RYDA 3DRTB 2IZZA 1JHTB 4YPJA 4AXWB 3AJ7A 3SIWA 3WO4B 1XZJA 2I9TB 3WTTA 1W0YT 1JNLH 4YRPA 4UQLA 3L3GB 1OIWA 2DQ6A 3IU4H 1FRQA 3VJ6B 3LAWA 3OAYK 3C45A 4XC1H 4D26A 1K6QH 2FGJA 4HDRA 4D9KA 3LKZA 2WQVA 2XNSA 5D1XE 3VPGA 2XVXA 2N75A 3LUFA 1O2DA 3AFIA 3Q8CA 3ZI4A 2FF7A 5EEVA 4ZARA 1CEYA 2QVZX 3H4MA 3NFYA 4LRIA 5D3KA 3DMFA 4QBGB 2YOGA 3JATA 3QUZB 3SBDA 3QWQB 1S9KC 2YVKA 2IPNA 3BVVA 1JPJA 4YFDB 3TAUA 4JCOA 4Y2VA 3IMBA 4MWGA 1O7SA 4L8BA 5DRZA 2BFNA 1YNOA 1WNFA 3E1F1 1KJ3H 5GJSH 1UMBB 1WXGA 4X5WA 2DDQH 1IB5A 3EC2A 3IOEA 2BOBA 1IXSB 4NATA 5HJ7A 5JFOA 1DWOA 4F4UA 4RCZA 1J8RA 2ZONA 3APMA 3SDSA 2IP1A 1RUQL 5A6MA 1WO2A 4M5YL 1XKXA 2QBYB 5C1PA 1CQJA 3TO4A 4L4RA 3IR6A 3FCSB 2JKXA 5I6KA 1JDBC 1JDTA 1CD9B 3JWIA 5ADPH 4LF3B 4C4AA 2BZ7A 5GJBA 2X77A 4GOJA 5I9TA 3C8ZA 2JKRM 1NJSA 4UMSA 2X4OB 1KJVA 5DBHX 4C0BA 4LPCA 1FUYB 3QWFA 4YLEA 3AWGA 3BN9C 4PJ8A 2GT1A 5EQJB 1U8OB 3IFSA 1AK2A 3IBCA 2QLMA 4N12A 2FQFA 4FS3A 2F6RA 4H2AA 5D7KE 3E1KA 1EFQA 4BPBA 2CLHB 4Q3KA 3GDBA 2EYSA 3C16C 1KJIA 4FE3A 1KJZA 1E9DA 1HEZB 4EGFA 3D59A 1QFXA 1OZHA 2YZ1A 1CR4A 2KKQA 3DL0A 4JO8A 3GUFA 1KR2A 1VHQA 4JY6A 4U7SA 2APJA 4JAVC 4RGYA 3J7AC 4IY1A 2HX1A 3V1LA 4LLDB 5BVHA 2ZKMX 3MW8A 4YRDA 1HETA 1GM5A 3AWEA 1JWLA 4CN6A 4XMKL 1CQPA 1QP0A 3LHFA 4LSDA 3IDGB 5JO5A 1JZ3A 2XPYA 4COKA 5FTKA 4WIAA 1Y9ZA 3GHEH 5EERA 3P73A 4ZAZA 4DZTA 2PZMA 1URPA 3TR0A 4JR2A 1JFQH 1A3ZA 4M7LH 1YU6A 4KKLC 2X15A 4B95C 3FZGA 2H9YA 1Z7GA 5TDOA 5JU6A 3U7GA 3AJEA 1P9RA 2VTBB 2QSJA 1NQOA 5DM70 3RYCA 1G4AE 3R3HA 2IYXA 5KKCA 3D5TA 5CVTA 3SC6A 1A50B 1DBAH 3ELQA 3E7XA 3UEOA 2CJWA 1SGKA 3BBPA 4F9PA 1X7HA 5AI5A 1PEYA 4Q6WA 4DDVA 3L0IB 4Q58C 3BA6A 1I1AB 3MEQA 3MOSA 1QFSA 4LJRA 4GAJH 4JIMA 4CL3A 5JC1A 3MTGA 2G1AA 2FMHA 3IE0A 5K0LA 7MHTA 1SXHA 2D2EA 2HF8A 4LRXA 1NL0H 3L02A 1QSFB 2EHJA 3CZRA 3U9UA 3ZIAD 1X7QA 3O9WC 3HZ3A 4FZJA 3KDSE 4GI5A 5C53B 5JS8A 2DCUA 3CFBB 1JR4A 4NRXB 2H4FA 4QEGA 4KIWA 5JCJD 3I50H 4QHLB 1C08B 3SDXB 2VCYA 2XPGA 4P5TD 2P9GA 4FFWA 2JKLA 2OXHA 3CXFA 3LDFA 3ZKMC 2AK4B 1NOJA 1LVHA 1Y9EA 4C1NA 2EILB 3GT6A 1X7SA 3BSYA 3VACA 3HE7D 2MOGA 4OV6F 3PX3A 4NQCE 3A6KA 1Q0XL 4GXQA 3BQUB 4AE0A 4OLUH 4PJ8C 3S37H 3PQCA 3VU9B 5DU2A 2R6CA 3ZUGA 1JEYB 4RVUA 4U1JA 3DPUA 3GLGB 1V4VA 3GPLA 3REVA 4DR3B 2C5FA 2OECA 3GEFA 3U40A 3BSGA 1OASA 1S7GA 2BMKA 3DO7B 3ORYA 3OMZA 5HJ5A 5T3ZH 1KV7A 3PXGA 2YMOA 3IBEA 2WZPA 3JQAA 1E5AA 2O7RA 1PJAA 4BFIB 5I6XC 1CE8B 5K01A 3M6WA 2QN2A 1CHNA 4KVNL 4AS3A 3NEOA 2J4WL 5F9OL 1X3SA 5I66B 4I0CC 4WHYH 3VYOA 1ZL2A 4KR6A 2EABA 3H83A 2NY1D 5AAPA 5CB4A 3S4SA 3I39X 3EOBA 1OMOA 5EESA 4KROD 4S2SA 2LUOA 2XY4A 5I76B 1R5IB 4RUKA 2H3NB 3P0VH 4OD1L 2RAUA 1JG6A 1GFIA 5FW7A 3AF2A 4QJ3B 4MAMA 4H2CA 1IGJA 3PDDA 1VERA 4CGTA 2CLMB 1J8MF 1R9MA 5I74C 1W0VB 3WDKA 3QXUA 4NBXB 4RH4A 3VWJB 3SZLA 4MW5A 3S36X 3UAOA 2H16A 3JQ8B 1A4BA 3FFTA 3FKQA 3KWJA 3Q3VA 2YEQA 3DF7A 3IDNA 4D0DA 1L7TH 3C70A 2NDFA 1OAOA 1M42A 2VSMB 5DM4A 3L4TA 4KVCL 3OD1A 4FI6A 4AQ7A 4TRNA 3VPCA 5DHYA 1KDOA 1GYWA 3QU7A 5IC6A 4LMQE 2H1XA 1QKIA 1YVPA 2O3TA 3E15A 3OFNA 2G63A 2WXKA 1ORSA 4DZBA 3EQ6A 1TM2A 5EORH 5G4KB 1A9ZA 1WY5A 1Z63A 3QJRB 4JFFB 1EERB 1B6SA 2BH9A 4KVPA 1EK5A 1OGJA 2WTRB 1KJ8A 4Z0XB 5KS9B 3NHWA 1FMFA 1ZBDA 3S8MA 5M95B 2P8PA 1ND0B 1RJYA 4LTDA 2ESVB 2NV6A 4A15A 4BC0A 4CN8A 3OQ3B 4QDGA 3RU9A 3T0EA 3V7UA 4MQ5A 1GCIA 1D9KC 4U1HB 3G49A 2VHXA 4LGMA 2ZSHA 4L72A 4G36A 4KXZI 1TA0A 2RAPA 1LDBA 1XF3B 5K39B 1ETHA 3QX7A 3BESR 4P23B 3TSZA 1I8LC 2CD0A 3L49A 4YE4L 5DJAB 3VQ2C 4Z4FA 5SY9A 2XDQB 8AT1A 5IUCA 2O8DB 4LNHA 1OD7A 4XBGB 3Q0TA 5LBGA 1DKQA 4FFVA 4YEFA 1FUEA 2FGWH 5DNEA 4R5XA 4WI3A 3ECSA 1QHYA 1T1WA 3UTQB 2GHZA 4KQEA 4MMXA 3RG2A 5DJDA 1BM3L 1PL0A 3RS9A 3VFNA 4DW2H 3I2YX 4FQJL 4S1QH 1US8B 4YFLI 1TB4A 3MJ7A 4MQ7B 1QBKC 3ESPA 5E03A 3EYVB 5T1KD 1EVIA 4RPCA 3MELA 4Z3KA 3BJEA 2AGJL 4PG9A 2I7CA 4K9OA 4PJ5B 1BH2A 3G5ZB 1VXOA 5AZEL 2CDFA 4Q16A 3JQFA 1HDGO 3HMXA 4KK6D 1X19A 2ICWJ 3D34A 4LZOA 5KNBD 2ROXA 1L4KA 2H0FA 2DIBA 2R6DA 4FTVD 4Y4FC 4YAQA 4OXIA 3ESBA 1OKKD 3GMLB 5C0EA 5KSBF 4RKYA 4QUBA 4MZRA 3WGLA 2AR0A 5TH2A 2BN4A 1MKFA 3SE8L 4JLRB 1KDYA 1L6IA 4OM0H 3L3IB 1OO2A 1YEJH 4M9PA 2D62A 3F01A 2UZAA 2GXSA 4AGQA 2X6VA 1L8XA 1TAUA 2XYCA 4XCVA 2WLSA 2IXBA 3DFFA 3T1HB 4H16A 1Z29A 4LRNL 4W82A 3N1QC 5I17B 5FWDA 1FVEA 4ZU3A 4H25A 3KPPB 1ULSA 2JFPA 2Z4QB 4ODXA 2GUOA 3ILVA 5IBLD 5KQLA 4ESKA 3KPQA 2I3GA 3D5QA 4Y6PA 4ZI7B 3QORC 3HIZA 1H85A 5AKRA 2BT4A 1NLBL 3DXZA 2W2NA 3TRDA 4CR7A 1WOYA 4BVAA 1HH6B 3UJ6A 1ABFA 1RQ5A 2PPLA 1P7YA 1YR7A 4UU8A 1D4FA 4G42B 4MA3A 1EB9A 1MB3A 1ESZA 4PPNA 5DMXA 2NY0D 3C5SA 4O58L 3TXXA 2J3LA 2VDWB 3JWNH 4NQDE 4FOPA 2I78A 3WFHB 5LBSA 3KZNA 1UM8A 1OE2A 5A9TA 4KUEA 4CM4B 2CUNA 3KYKH 2EVIA 1QR2A 4KI5F 3HB4X 3MMEB 3FU7A 5EZYA 1CE1H 1Z28A 3WL9A 3VE0B 4P8QA 3D8RA 1T5DX 3C6LD 1KYWA 4C0QC 2CXXA 4JG1H 1D0IA 4RVNA 1VLJA 1GRVA 2P24A 3QMWA 1X1BA 4YHNB 1XF9A 3TQHA 4L1SA 3V5DB 4Y5XB 3CGTA 5LJLA 4QT5A 4ODWA 1MNUL 2JVUA 3E3AA 2Y07H 4R7GA 2M1ZA 3WLRA 4RZSA 3U6RA 4Z7UF 1EWYA 2ITCA 3VR4H 1GPWB 5CCHE 3N41B 1XSEA 4GPZA 4IVRA 1JE1A 3T2QA 2F9MA 3ZV3A 4U1MA 4PP1D 4J1TA 1TRHA 2VDNH 2QRJA 4KKCD 3FTGB 3RFTA 621PA 4XB3A 4PRZA 1MF7A 4QUJA 4FI8A 1JLLB 1SR8A 3HADA 2JEOA 1J12A 2IHKA 4EN3C 3RGVA 1DO0A 4I1YA 1OK0A 4OGWA 4F5YA 2NOAA 3S4YA 4MA1C 4DQDA 1AS2A 1I1AA 3HR6A 1KTVA 2H2SD 5ANMB 1P1BA 3R0QA 2G7ZA 2B69A 3FPEA 4KXFB 1DBRA 3BUYB 5KVEE 5LP6C 5ERWB 1M7IA 3QVSA 1HDCA 3LGXA 5E9NA 1JTPA 5DKFA 5FNVA 3UMCA 4ZOQI 2K3HA 4JO4L 2EP8A 3L4UA 4ZVPA 2W8BA 1BG6A 1Q3HA 5B7FA 3JASA 3BVTA 2P26A 2HFJA 1JGLL 3G5MA 3JD3A 2RHGB 3RVJA 1MAML 1QSEB 4D0BB 2PSJA 1YACA 4KH2A 3CQQA 2ENUA 4MQFB 1S6YA 2DLFL 1XB8A 4NZRL 1CJCA 2IYRA 5H1YA 5TS2A 5BUGA 1C3OA 3GGDA 1GMIA 3OOJA 5BNFA 4F84A 1AKRA 3I75B 3OHXB 1X7WB 2WTXA 3UCXA 3U30C 3WX0A 1U0OC 1MDAA 4Y4FD 4LLWB 3P0EA 3U56A 2J7PD 4W81A 3CINA 3M6FA 3BQNB 1P31A 1EK6A 3MIIA 4R4FL 2HT4D 4ENWA 5KBLA 3K2BA 4J0GA 4MWZA 5ENWB 3GIWA 1PQUA 1PD1A 4UM5A 1TF4A 3GXPA 1VMAA 2GN8A 1P7KB 3QKTA 4AF8A 4Q93A 3IKCB 2XADA 5EZLB 1MHPL 2JCVA 1AIZA 4WCFB 3C14C 1I4EB 4MEJA 1NQUA 1WSDA 5BVJA 3WIDA 3ZDQA 3PWZA 4G37A 4XXDB 1X5FA 2XG4B 1ZI8A 2UVEA 4MJ2A 1PBTA 3MGOA 4QM7A 3UJJL 3KZXA 3X17A 4S3MA 1X1DA 3KSMA 4IXWA 4FWBA 3O81A 2V97A 2ICWA 5EP2A 1RFDL 5ID1A 4GBXC 1XTBA 4O4JB 5A5FA 1GSAA 1W6LA 3K1JA 4I8IA 2BMDA 3OGOE 2OMYB 1KZYC 3LXBA 3OR6B 3AOGA 2H0EA 3ILEA 4CHGA 3ZVMA 2ZG2A 5JDIA 3NM6B 3CDGA 4N0MA 2Z5LA 3L7NA 2C9PA 4RK7A 4R83A 1OWPA 4IIBA 4D9EA 1NC4B 5EPOA 4H4EA 4UAHA 4N65A 2JELL 1GZ7A 1BRMA 4CT4B 4UU9A 4OK6A 1IAIL 4R7DB 1DP0A 2PIAA 2CHZA 3R3ZA 5JD6A 4IU2B 4E5PA 1IQDB 2BSEA 3D4NA 3V4FA 4TLSA 1CPYA 4TPRH 3G68A 4MV6A 3L54A 1NFQA 2Z8YM 4IKOA 5BWMA 1ZGZA 1QBBA 3ZWAA 1DHTA 3VXPA 3PQ8A 4L76A 2O93L 3Q8AA 3EH5B 3QR1A 3O8QA 3RTEA 1GAEO 4HVAA 1YBFA 3O82A 5J4YA 1UYWH 2D1QA 4ZT3A 3TFQA 1CUAA 3H99A 3VTFA 1P4LA 1MRCL 3AVOA 3LZOA 2ZEJA 3LY9A 1K8RA 4OD2A 1B8NA 5TMPA 3VC7A 2ISCA 3VXOA 1IDOA 1OWRM 1N2RB 4JX0A 3QULA 1PZ3A 3DTUB 4G6ML 2NO4A 3KXFB 4ZO9A 2AWNA 2AITA 2QGZA 3ULUC 4XCEB 4JGBA 1TKCA 2J6BA 3R5SA 1VYHA 4G72B 3QE0A 5D2LB 4TZTA 3DD1A 4XTRD 4YBLC 3WTBA 4W9ZA 3GJ4A 3F8SA 3OE1A 1HC1A 2LIPA 5GJTH 2VYCA 3SDYL 1LEIA 4WLNA 6REQB 3Q1SH 1HJBC 4PJFA 1IEQA 2D7NA 4J7RA 5F89A 3T1FA 1KIUA 3QT2A 4ONEA 2QE7D 3A1SA 1LEKB 2N7SA 3R6TA 1Z4PX 2CUZA 2B15A 4KTGA 3RUHA 3WKAA 3OWOA 4NK5A 5MN6A 3PNQA 4KNYA 4EI9A 5L0QC 4YRFA 3QWRD 1RZJH 2Z58A 3C0KA 4QYMA 1IGYA 2IOYA 1ESDA 1YZZA 1XRJA 4NFBA 4U1NA 2WYUA 3PDOB 1X7ZA 2HMUA 1JK8B 1JXAA 5E8NA 3IAPA 3CUTA 2QLVB 1GUAA 1SVZA 3DYIA 1GHFL 2PT7A 4DQOL 3D81A 3ZI7A 4FGKA 4XIFA 1LP9B 3EXHA 4KU1A 3T3DA 2A9AA 1BV8A 4L7QA 3OFKA 4R9UC 4UM7A 4E51A 1NVXQ 2PWGA 3Q2OA 4EF5A 1N77A 4YDJA 1CG6A 2DM2A 5IB5B 4OFIA 5F33A 5DVNA 3DNKA 3IELA 1J8DA 4N9OB 2Z83A 3EEYA 2HRCA 1BHGA 4QX6A 3KJIA 3OM8A 5DEOA 3EYAA 1VGQA 2F8MA 3R9IA 3PUJA 4WNQA 4MR8A 5B1IA 4R41A 4MIEA 2R1YA 5G0SA 1L7IH 4OTXL 4UTXA 4LHZA 1U93B 2EDYA 1YDPB 1JJUA 4FYIA 2BCJQ 2V2XB 3ARBA 3PL6B 3W4IA 2DQSA 5ALHA 2AZDA 3VXRD 2AW3A 1QNZH 3HKFA 3BT0A 3FPFA 5KYVA 3F7PC 2XUWA 2HRPH 5P8WA 1SYVB 4XXWC 1H23A 2QR3A 5AW4B 2VPPA 1JU9A 1XCJA 1V3TA 4ODBD 2H00A 3UMJA 2KLSA 4HUXA 5F2EA 3QUBA 2J73A 1X1AA 2HFGL 3G0GA 4CCYA 4IFIA 3MOBH 3DMTC 3PLAE 1VCOA 5CA1A 3TDKA 2L42A 3VR4D 3UK2A 1MXGA 4PBWD 3G2LA 4AURA 3GNLA 1H69A 4IOMA 3PWJB 1LWRA 1WSBA 3VR6H 4UU1A 4UQ2B 3EJWA 2UX6A 3TO4D 2QPAA 4Z6KA 4H4NA 3U0BA 1CGWA 4JL6A 1FFEA 2VLJA 3HXMA 1E2FA 2AXGA 4IRSC 1H9DA 3T0EC 1SCIA 3QJYA 1A9BA 1R00A 1BEXA 3WQQA 4H1WA 1DUZB 5EWJB 5CGMA 4DHLA 1AD9A 1WAPA 2XI9A 3KTOA 3BP4B 3MRQA 5EZPA 1NW4A 4QFDA 2DQHH 5IR1B 4HEME 4YXKH 1TD1A 4UUNA 3VJKA 2CF5A 4AV4A 1JYXA 4Y1GA 3CQ9A 4HQRA 1BQEA 2Q8BL 3B1UA 1MOPA 3ULUD 1D1QA 1SUCA 1P1VA 1SY6A 1NSTA 2IYNA 1TU2A 4AL8L 1P8JA 3GH1A 4GAGL 1IC5H 4HISA 4K0OA 1M1NB 2O8CB 1JP7A 4W4TA 5PAZA 4EY4A 3TS8A 2IY9A 2GXUA 3TM5A 1KY5A 4PANA 5KVEL 3NH9A 5I24A 1INQB 3AHFA 2P0YA 1PWXA 1XFAA 2ZX6A 3JYNA 1QYWA 3GRYA 1CUZA 5I51A 3SBOA 3FFCE 1Q20A 1UM5L 3SSGA 2Q6IA 5EB9A 1BFVL 1V55B 1HH6A 2ZFUA 2L82A 4LY0A 5D2CA 3HNTL 3S5JA 4H9GA 4GRDA 1B0PA 4BWTA 2JLWA 4FABL 2PXYC 2GUOB 4RQBA 1G94A 2FDBP 2HG5B 1IEHA 3DX7A 2G3NA 4CIWA 5AVVB 4J39A 5F7UA 1MDBA 3U7HB 3OZEA 4DGYL 3SQBB 3R5TA 3FPSA 2VSDA 2B8WA 2KMLA 3CLEH 4AWXA 4AYWA 1GRNA 2HWZL 1XMXA 1U4SA 1KTRL 1HI9A 2Q8AL 2V7QD 3HXPA 1G0OA 3FR8A 4KGJA 3D06A 5DJ0A 3HY4A 4EEZA 4FF9A 4KFRA 1JKFA 1QLHA 1IAMA 1V27A 4PD4K 1H0DA 4WY5A 1KBKA 5KBYA 2WUBH 2IQAB 1HHIA 2DKNA 1W72H 4FFYH 1ZC4A 2KH2B 1HDEA 4P5TA 3DMMA 5DXWA 1KFJB 5AW6A 2QAGC 2WKOF 1ZLYA 3RNKA 2EEDA 2O30A 3RGGA 1V37A 4BB5A 1IXYA 2DF3A 3RYMA 2ZXUA 2OP0A 4GKKB 5EBMB 4X7MA 2BMAA 3SYOA 3EYUL 2IJGX 3UTQA 4BK8A 2OHIA 1TO1E 3QOFA 4EG5A 4GKJB 3UFXB 1FLTX 1QW9A 2KQNA 5GGSB 3CW8X 2OAP1 2NXWA 2RGGA 5KHLB 3BWYA 2HT3C 3WIHL 1YYLL 2B1JA 1R1CA 1IPEA 1DBWA 3RNQB 1CUJA 3FSGD 3HI4A 3IFPB 4M9QA 4XA8A 4Q34A 4DMRA 3VPXA 1KJ2L 1I80A 3VOSA 3ORSA 5ALCL 3N0WA 3KTFA 4FQXB 3HHPA 1HDZA 3JQAD 5DP1A 4Z54A 5F7HA 1NIAA 2CGZA 3A4NA 4URKA 1J5XA 3X11A 5U4QA 4P49A 2E9IA 1I5EA 2XUDA 1CVIA 5F5LA 1BMTA 2VSXA 2CYCA 3MUUA 1Y0LA 5JC8A 1DAKA 1GIAA 3CTPA 2RB5A 4NQSA 1PZXA 2OO5C 3WLOA 5I7VA 4K1XA 4XGKA 4PGEB 2ONJA 3U7FB 1BOGA 3UB4A 5M94B 1LXCA 5DCCA 4Y6LA 2JD2A 3P2EA 1IBLB 2DLEA 3UPRB 4CKCB 1L7TL 2E3VA 3GCGA 4DRZA 1AU9A 4OIFA 3VI3A 3PLYA 1SVNA 3DBVO 3X1MA 3MT0A 5CP8A 4XD7D 1FSGA 9MHTA 1QYVA 5JSZB 4CVZA 2YXBA 1GS8A 2R66A 2VPTA 3W0WD 2CO6A 3HMQA 2LAAA 3WIBA 2IWFA 4NHUB 4B60A 5TARA 3POHA 2W59A 1VIYA 1Y6QA 2RK4A 2V4LA 3EH3B 4BO5A 3DKRA 3N3AC 1A6VH 3L95A 5C0AE 4Y8AA 4Q9BA 4NAHA 3RSHA 5DW0A 1DQRA 4QXOA 5FBRB 4RAVB 4JDEA 1Q22A 1PR6A 4NF2A 2CY0A 1AXTL 3LEVL 3VX0A 2QU7A 3RRJA 4EJ0A 3EVFA 2GEFA 1UB5A 3SY0B 3QQ3B 2DOKA 3GLUA 2AD1A 2BEVA 4XX5A 4MUFA 1Y1UA 3TE6A 2ZJFA 4IHKA 4R0LB 4H44C 3X1ZA 4LLVB 4BCXA 2OPCA 3K1DA 1ZHLB 5AVXA 1N7JA 2UDPA 1OVMA 5DYOA 5LQBL 1IC7L 3MJSA 4ADIA 5FJJA 1IX2A 4WHMA 3TIEB 5DTMA 1BVNP 3JUYA 5EP4A 1QFUL 1NCAL 4HCGA 4CL0A 1K7CA 5D7EA 4N2DA 3W5CA 2BKUA 3RBVA 4P4TA 4GP7A 3VTTA 3IUEA 1M0TA 1IHDA 3D6VA 1Y3DE 4P5EA 3WAKA 1C0PA 3HGQA 5I2IB 4YHPA 1E61A 1PWYE 1CFJA 4FFVD 3I34X 5KG9A 4UUJB 5F7DB 1F51E 4Q12A 2QADB 3ETTA 4OZFB 3GMOA 5HYFA 4TTRA 1RVDA 5DA4A 3H1TA 3H3FA 5E1GA 1J8QA 4EIZC 1VJRA 2WUCH 3TIVA 2ZOLA 3EN0A 2WHEA 2D5BA 3TAXA 2HLHA 5A2GA 4ZTUB 5ELXA 1Q0LA 2X9QA 1E0OB 4REQB 3X3HA 4DLVA 4NRXA 4Z95L 1RM3A 2CBMA 4MAYB 1KEPA 2ZCHL 1M2OB 1YRWA 1CYDA 3QIBA 4N54A 4E3ZA 1QSFA 2I3BA 3WFIA 4UDUB 3WGGA 2KDGA 1QLJA 4IMPA 5AI8A 2P9CA 2WSYB 2VABB 4NBWA 3OZLA 5ERYA 3LNTA 2RH4A 3O9WB 1JF6A 3TWYA 3F2LA 2P4AB 3GY0A 1Q57A 1NBEA 1FVFA 3N6YA 1NSNH 1URLA 3AI3A 1YB1A 7TAAA 3GJRA 3DTTA 2UVFA 4Z6AT 1Z25A 5DLDA 1TNMA 4F8TA 2P5WD 1ULZA 2ADFA 5IESH 3OLDA 3SGJC 1RU9L 4MAFA 4YUWA 5D3QA 1GTNA 4LS3A 3FYDA 1SCKA 1YFKA 4ISCA 2VQ6A 5DQJB 5FYJH 3A1EA 4AGPA 4YZFF 3L6FA 4H3SA 2A6IB 2O0JA 2WIKA 3BAXA 4F5CA 2J5WA 3EYSL 5IN5A 1UK7A 1OAZL 1C3VA 5AVZB 1OYWA 4W99A 4AKOA 3ZCXA 5E9QA 2NY3C 4NQCB 3FWPA 4KKBD 3DCNA 5COBA 3NJIA 1PDKB 3L1OH 3IDFA 3A47A 4D7AA 2Y07L 3Q72A 1UKTA 4BCDA 4QO8A 4D0DB 1M2KA 1P9MC 1UT5A 1JWMA 3OKEB 1P6FA 5C9KA 1JZ6A 5IDXA 1KCSL 3DUFA 3UUEA 1G9NC 3JALB 4L4SA 1I8MB 3DFIA 1VRSA 1BG1A 1RWBA 4PC7A 5AM5A 3A9WA 4I4TA 3DX1A 5K9KB 4HOZA 5HXMA 2XWBF 3M7FB 2VLRA 1RJYB 4ID3A 2VZ9A 5I2IA 1M1NA 1EUZA 4US0R 3VGEA 3W05A 1Q7RA 2XUKA 3Q0EA 2BS8A 3O4VA 5CZXD 1Y5LA 2EZ9A 1BW8A 1J99A 4X4XB 3VDAA 4JL1A 1HINH 5F93C 2AFHE 3ANMA 5IEHA 3AETA 5K05A 4FAAB 3KQKA 4NZRH 4LAQH 1DG1G 3EIWA 5HJ3A 3H4TA 4ZMRA 1YRKA 3QUHA 4Y0NA 4F2MA 3GROA 1KRWA 3CH7A 2WM0A 1XJCA 1YRQA 4B7AA 5ADUS 2BNQA 5H70A 5HVFB 2F2TA 1I1YA 2PCFA 5AW9A 1O6FA 2IQIA 1YONA 2XQBL 4N1EA 2H9AA 3JVUA 5BQ5A 1Z7JA 2JTYA 1W1WA 5DUPL 2ZCJA 1FIGL 3ILQD 2XEDA 2P8MA 4JVLA 1CUFA 4L0YA 5FPSA 3HG5A 4QOHA 1HHHA 4O3FA 2XMPA 5BXFA 2VH5L 5U4XA 3VI3B 4MX7A 3OCJA 4H7IA 2MCMA 5CDFA 3ECUA 3EMBA 4CKQA 3FCYA 3MF4A 2EWMA 2E6QA 5BSEA 4HCRH 2AFVA 1YULA 5KEIA 2EYRA 3BAIA 1EHIA 1J9CT 4WF7A 3MJHA 3I02A 4E22A 2EC8A 1JBJA 1RLTA 5IT4A 4HGMA 2YXDA 3QE2A 3SN6N 4KZCA 2FZ4A 5F2FA 4OJEH 4HT3B 1HOCA 1U30A 4NUGH 4XWGA 2EVHA 2EACA 2AG1A 4UE3S 1JPGA 3SYRA 2AS5M 4O2AB 2A59A 1GNLA 5HUHA 2WY2D 1AHKA 1B0IA 4BEIA 4DWWA 4GYKA 2BVPA 3P3YA 4DUPA 4JX8A 5DLLA 3ZDYB 4BU1A 3S81A 3V2IA 4NJ9L 4M89A 5JUWA 3EHEA 4R9SA 4K9RA 5G02A 3RWFB 4N2GA 1HFWA 4DPAX 2G76A 2PN1A 1GJWA 5DS8B 5BPHA 2PGNA 1S3SA 2OXTA 3M9WA 2DI7A 3HZZA 4KFZC 3AUTA 1SU7A 1IEBB 3RVQA 4TLUA 4DVJA 5K8IA 5FWAA 4TN9A 3H4VA 2W6IA 3PQ6A 3IMVA 2LAGB 4IRSD 2WSSD 1S7TB 3N8GA 4W68A 3FB7A 3K4QA 2RBEA 2NOYA 4RHEA 1LK2B 1JHAA 2QBWA 3C5VA 2W98A 1DC3A 5E6IB 5IYZB 3S96A 1JK9B 2KLRA 1VFBA 2ZVJA 3JV5A 4POZC 1HZLA 3K3PA 1GNQA 1U90A 3QNMA 4PHCA 5KSWB 4Y1AD 3CU1A 4GWLA 2UYYA 3WL3A 3OPMA 5GJTL 3QI9B 3VJRA 5CMLA 1PIGA 3V2HA 6REQA 4GRWF 4EI5A 3CJRA 1BQRA 4Z3FA 5DO2C 2WKGA 4PW4A 4MVJD 5LQJA 3OKCA 5T1DH 1X4ZA 5CA0B 2YCLA 2GM4A 2D03H 2B3TA 2I1WA 1NCUA 5GS0H 2G1JA 5JARA 2NW2A 1H1TA 3HFJA 4MW9A 5AK5A 4TUKL 1SK8A 2WMOB 1KMIY 2R60A 1CPUA 3OWEA 2K4AA 2HA2A 3ME0B 1UQSB 2CRIA 5TQ0H 4PGFA 2YW9A 1YJDC 3MRBB 3QYNA 2BC9A 4K6KA 1CFTA 1G3IA 1P4LB 4KY1L 3TZVC 3S3BB 2H1SA 1QTPA 1YZQA 2OHJA 4GI2A 4L1TA 2YFOA 3A4DA 3GOQA 2VXUH 4JBXA 4RNCA 2EP6A 2OMTA 1MCCA 1ZOPA 2SCUA 1Y9AA 3AFMA 4CSPA 5JQHC 2H54A 5EA2A 3O9ZA 3G0IA 2C5LA 3W6NA 3S6JA 3RKPA 4OJCA 4WU5B 1ZIPA 3TZBA 2F58L 3R19A 4S10A 2VJMB 3JYLA 4S2UA 2PJRA 3T4YB 1F2VA 5DZJA 4RX1A 1YHNA 3UYPB 1AMUA 4MITA 1N5JA 2C2XA 2Z9TA 4MQUA 1YFLA 5TPWL 1CCZA 3RU3A 1LEHA 5A6IA 5BMOA 1FW6A 4S35A 4B9GA 4U6HA 4XVOA 3B1YA 5CVEA 4F60A 4ZMSA 4KWIA 3B34A 2OBLA 3F6RA 4A4DA 1JNYA 4G6JL 4MCYB 4GG8A 3L2MA 2IZ6A 3C2AL 4Q1BA 3G9TA 4OZHF 2Z8VC 2CLVB 3EVBA 1GKUB 3TOZA 1FRGL 1HFJA 2JH3A 4Y2YA 1TJ5A 1J5HA 3V3TA 1WS7A 3EXEA 4D79A 1HQDA 3WFEL 1TZBA 4JYPA 1TVEA 1GZPB 1TUBA 2WYOA 2E7CA 1XC7A 4ZCSA 3DXAB 4NABA 4Q9LA 1FOEB 3DUWA 5I30H 2YRLA 2MWCA 5FX2A 2PQ0A 1KEMH 2ICWB 5CA1B 4X9XA 2XBTA 5JH7B 3K5PA 3U7IA 4MI9A 1ISRA 1BAWA 5FBVB 3SDCD 1SYVA 1HKUA 1IV8A 5F3FA 1I2MA 2CMHA 3N53A 4FTVE 4X99A 4MNTA 3U4BH 5T33H 4O1MA 2WM3A 3HVNA 3ZMNA 4FT2A 5FYJD 4BO8A 5DS8A 2GK6A 3TT3H 4MCIA 2WBJB 3LQ1A 2O1EA 2V98A 4P4KA 4ZOBA 4YSUA 1PW3A 1NMXA 1WF6A 4ZIRB 4GE0A 3GTVA 3SYMA 2FJUA 2OBBA 4RWEA 4N2EA 2BGNA 2PX5A 3UZUA 4FYXA 2HRHA 4J0CA 3THML 5JVDA 1S7QB 3BGWA 1PFQA 1JR3A 5FKPA 5DM60 1F4VA 1IT9H 4HJIA 2FPGB 5ALMA 2BDTA 4GQIA 1P62B 2X1HA 1CC3A 2F8IA 5ANMA 1GGIH 2ZI3A 3CSUA 5GQSA 2J8OA 2Q50A 2KBFA 2PZEA 1DG3A 5J1TB 5LNEA 3NFSH 1S02A 3BA1A 1XGPB 4CM5A 1R0SA 4NHCH 3M6VA 1BQ3A 3SMQA 3GEGA 3O8XD 4ZDJA 3C5ZC 1VHTA 3UWMA 2DQUL 3BP5A 1WY7A 3ICWA 2FSVC 4JFEB 2ERJB 4HH3C 1Q0HA 3O9VA 1E4KA 4KK5D 1E32A 3KPRE 2PZBA 4JNCA 4L2YA 1HK6A 4PQYA 4EA8A 2R44A 1QGUA 3JAWB 3T1FB 5JMPA 1SLWA 4H5SB 1XA4A 1ULUA 5EKSA 2R4RL 5JW3H 1WX1A 3O4OC 2W71A 5JANA 4Y5XA 3O4JA 3EVDA 3O4GA 2C2OA 4Q4DA 2NY6D 4O2EA 2FA9A 2XKKA 3S35X 5D7LE 4XDZA 3GGOA 3QZWB 1I0LA 3A7EA 3Q7QA 3G1TA 4KXCA 1Z9SA 1G66A 4KFTA 3QWHA 4XYBA 1M05A 2P2LA 3ARFC 4ETWA 2NY0C 3D85A 1FVCA 5G4OA 4P82A 1U8CA 3PC8A 3ESQA 4DANA 1KKMA 1T22B 2BSRB 4P84A 1VEOA 5B64A 4MQEA 4P2QD 3OJDA 3HNRA 3OAAD 3WYFA 1FFRA 1ZH4A 3QEQD 4IAOA 2XIBA 1P2CA 3RARA 3SKOB 4BLRA 2AMYA 1G8HA 3BUBA 1YR9A 4HJTA 5SZJA 1V5EA 4RWYL 3FRHA 1R8QA 2L8AA 4E9TA 3EYUH 2P4HX 4KSBA 4Z7NB 4KQJA 4FLOA 2JLPA 3D4PA 2XT1B 2IFFH 4G7QB 1HL5A 1G1AA 4Q05A 3QEKA 5EUOB 1EBPA 3QEGL 1KDRA 3ME0A 3WIHH 3MRIB 3ZY3A 2ZANA 1LQ2A 4QOEA 5E5RB 4NC2B 1NUNB 4UC0A 4H26B 7PAZA 2Z4TA 4QYOB 3D3KA 1PLAA 4PJ7F 4PRPA 4NDAA 4WQOA 1BFOB 2VAMA 3RWIA 3E9YA 1DO2A 4EW6A 2W90A 3WHKA 3ARED 4ZDKA 3AM4A 3L6UA 4XP5L 2BZSA 4QRTB 4NP4L 3H5RA 4P5DA 2J5LC 3PEVA 15C8H 3IQZA 1ENZA 1XAJA 3A22A 3QTLA 1JFTA 4UHDA 2R15A 3OFSA 4R54A 2CLKB 4OSPA 3HI1A 1XCLA 5JBIA 2ZWPA 4ZYKA 3ZDZF 1N8ZA 5D6OA 3BMWA 1MEJA 4MDEA 2YYSA 2FG6C 3DCJA 3IJEB 3MB5A 1W19A 2AN3A 1K9TA 1P1ZA 1K6IA 3PIQA 4MS1A 4TOYH 2NNFA 4H6WA 2YGPA 3WK5A 4OMFG 5HHMD 4DOHB 4RFNC 3WWOA 2VHVA 2YZNA 3GSNA 2BE7A 4PPYA 3WDJA 4IDJH 4OAOA 3H5OA 3SE0A 4IDPA 3WISA 2XTJE 3LEVH 1DC7A 5DTFA 1C9KA 1XT6A 4A27A 4LXTA 2WWWA 3BSZA 4I6GA 2AJXH 4GP4B 4G9FB 4OQ4A 1P18A 3CT4A 1E5ZA 2Z93A 3LX6A 1XMOB 2HYIC 3TWCH 2PZFA 4I3HA 1SDYA 1BW9A 2CXPA 3EZFA 4ZFQA 3BSFA 1P4GA 1IOLA 3GG9A 1R0KA 1V16B 3VWJD 5IZ7A 4YSOA 4QPZA 3IXQA 3KYMB 1ZGBA 3BPLB 1S3GA 3GCZA 5F1OA 2A74B 4TL9A 3P4MB 2GRAA 2GD2A 3ZQXA 4H3VA 1AYOA 1DUYA 3U3XA 3GXMA 4TL5A 1YNTA 1BHQ1 4DQKA 1Y5MA 1F3DH 1QLRB 4B53A 2JAWA 3DHNA 4JRXE 1WIOA 1MFAL 1MY7A 4JGUA 3LXMA 1NVFA 3MXWL 1SMOA 3UV3A 3KR1A 3HYLA 4PRIA 2OSXA 2WNGA 4NQXA 1K8DB 1TQHA 1DBKL 1U0TA 4RDHA 5EU4A 4YE4H 4ICXA 1QI4A 1L5OA 5DHUA 4GEIA 2HN7A 3DYPA 5I1CH 1UZAA 3A24A 2XVLA 5GZ3A 1R4NA 3BAKA 2HXYA 5KPDA 4MA5A 3GBPA 4BH7B 4H7PA 4E13A 1KYXA 4Y9TA 4D96A 2UZ0A 3EBGA 3ZT7A 3HZVB 3EWSA 3V8BA 1MFBH 2XIQA 3DHMA 1TO5A 3DSNA 5AYTA 4D9CA 4R0MA 2F5AL 4DJDC 4HIEA 2EE6A 3UFBA 3WSTA 3V5DA 1XUOA 5AENA 2NQ2C 4UAJA 4QRPA 2TRSB 2OOSA 5F0PB 4HQLA 1G87A 4XCCL 4OM1H 2C1XA 3AREB 2VERN 2VISB 4XP4L 1MCZA 4WPGA 2XA3A 3AF6A 2WB7A 4WENB 5FA8A 1AMYA 4YJFA 2KZBA 5T3ZD 2BO0A 1XDUA 3QUYB 3WIUA 4FL4B 1TVBA 4RGMB 2IL1A 3CLHA 3HKCA 4MDIB 4XIIA 4EI6A 3ZDWA 1QASA 1E62A 1SCBA 2I2CA 3KZOA 2X4IA 2C9CA 4LWOA 3AHEA 3ZE0E 5HJDA 3FVWA 1SB8A 2XX3A 3IOYA 2AIRA 2IDFA 3ALPA 4P2RE 4AYGA 4BP3A 4LLVA 3INGA 2A1UA 1SJHA 4GZLA 3NZHL 4OPMA 5F6IC 2AF4C 2KS6A 2FO4B 1X7QB 1E9OB 3AS3A 4ZCPA 1KZGB 1A96A 2GK7A 4GX0A 1MI5B 1H3PH 1SOSA 3MTQA 2WXRA 2GI4A 1LDPL 4PW3A 1VL8A 2VKXA 1A7RH 1RNLA 5JZ9A 4RK5A 1KK0A 2J3JA 5JPDA 2ZDGA 4II7A 2B7DT 2O2IA 1FJXA 1FH5H 2QQ0A 2K2WA 1N8TA 3R06B 3ECCA 1KIQA 1B3BA 4HTFA 2IHYA 1V4NA 3HN7A 4YS6A 4PYGA 2GZHA 1DRJA 1BQHG 3GN1A 2NW3B 5AOLA 4WN9A 3ZOAA 2QVTA 3HBFA 3L48A 4HQ6A 1A9QA 4Q4IA 2GB2A 4FQXC 1ZC3A 3VHXA 2ROQA 3B2NA 4LZKA 4Z18A 3DE0X 3O6FD 3VW3L 1ICEA 1QB8A 3A3PA 5LCVH 3B7YA 1B4TA 4OFKA 2XB2A 3VMMA 3K9CA 5MGBA 2HRBA 2XT9A 5GRUH 1GUDA 3H7BA 2Y3NA 1CULC 1DQZA 2Z1PA 4PYKA 3AU1A 1L9MA 3BULA 5DWQA 2PWBA 2D74A 4UCQA 4HS8H 4XNDA 2VOTA 4RTNA 4WXYB 2QQEA 4JUFA 1FFCA 5JHLL 4QYOA 3MRCB 3E3OA 1J70A 2EVGA 2ZT8A 3BREA 4GICA 1LDGA 1ZMOA 3D2AA 1AB5A 2WSMA 1YN7B 3H5AA 5BQ7A 5TMDA 4NZJA 2QPFA 1F60A 4GG6A 3ISTA 1E6JL 3NACH 3D2UA 4U3XA 5FFGA 3CRQA 4LSGA 2NGRA 2IHJA 4QLWA 3ARPA 2CDEB 2IANE 1UOQA 4B3CA 3D3WA 3FDFA 1C1XB 1MCPL 2VDML 1GOFA 1NCDH 5T3YA 4C7KA 4FD0A 5KOHA 5AK6A 1V6AA 2GJRA 2HQRA 2OB1A 2B1OA 4LLQB 3SDCB 1PFKA 3A36A 1ELOA 2I7VA 4D3CH 5IB4A 4GSQA 3EMKA 4QASA 3Q5YA 1SBTA 4JO4H 5DUPH 1LE5A 3ELWA 3GRUA 4LRSB 3BGVA 2IVFA 4IBYA 3OU2A 1DVXA 2WUDA 1T04B 3S2IA 4Y9EA 2CUHA 3BMOA 2V9RA 1U81A 1HDYA 5JZSA 3K8ZA 1TVBB 1BQ5A 1E3QA 3OZTA 4F92B 2BGUA 3IAM1 3T15A 5CG2A 1RJCA 4CLRB 2FWNA 4BNYA 5HHTA 3EBAA 3VYRB 4HCRL 3RFRA 1KYZA 3BRWD 4NMWA 1J2RA 3DIFB 3MR9B 4G8JA 4YHIB 1UM9B 5IZ4A 4ERXA 3ARXA 4ZS6D 1SJEB 3OR7B 2AKRB 3BAZA 3OA2A 2FUKA 2V37A 2DH3A 2OL3A 3L3KA 3AGWA 4PZLA 1Z82A 5WRFA 3TX6A 2SICE 5DULA 1PLCA 1YJDL 3POCA 1R5IA 1FTNA 2BDEA 3NZSA 3LVFO 3I2IA 2XBMA 5K8CA 3VAEA 5LMNB 3EHBD 1GDHA 2DHCA 1MHPH 5I1KH 3ZCUA 1T34A 3BTOA 1DEAA 2BHRA 4GT7A 1EIBA 2ZQYA 4KB5A 3C9NB 3TOVA 5JBNA 1H6CA 1I6KA 1ZVVA 3VI4A 4XDGA 1NBVL 5E3JA 4DMHA 4A5SA 1ACYH 5K6AC 2NX2A 3RUGA 3GEHA 5A5DA 2XMGA 1ZUNB 5HYJA 1HL9A 1OWNA 3HHSB 4D46A 5FWYB 1M3IA 1EJOL 4QAWA 4LQDA 4ZVKA 3PQYB 2ENJA 5E7FA 5T1LD 4DO4A 4ENRA 3M1LA 4KFUA 2DFVA 5F8QC 4QO1A 3AI1A 5EO0B 3MPCA 3FU9A 1MGPA 1BPLB 3DSNB 3V4RA 5LNK1 3NJXA 4DWJA 3ABZA 4IF6A 5IW1A 2XZOA 4G1CA 3U7JA 4PJAE 3KE9A 4DPRA 1AN0A 3V52H 4PGEA 2F7PA 1SIWA 1E3TA 4UT6H 4JW3A 3K8QA 5BR8B 3O73A 4M7ZB 4UILL 1I1HA 3S4SG 1FNDA 1T9HA 3LT0A 4LSZA 2VHCA 3L4YA 4S1SH 3S70A 3IV6A 4IKIA 4L5YA 2PP7A 1VSBA 1A9OA 1JJVA 1OLXB 3D18B 4AEIH 1QVWA 4J03A 3GIDA 2EW1A 4PHFA 3I6GB 2KQMA 2JIOA 2E2WA 2X2UA 5D7LD 3F9RA 1V41E 1N18A 2BP3A 4YV0A 4I5FA 4LSTH 5B7EA 2GKSA 1Q74A 1F2QA 3ZU3A 2EYSB 4XB7A 5TDOB 2NV2B 4LQLA 4UHJA 5FA3A 1R50A 4EDHA 4GBJA 4RNDB 5E0KB 3KKEA 2AG0A 2VLBA 2GA9A 4X0KA 4QXPA 4GF5A 3DHJA 3EXHB 1ZCFA 3MRDB 5EMKA 4MGHA 4WY8A 3OB0H 3RX7A 2BP0B 3K1YA 3FRUB 1BAGA 3HZHA 3V5KB 3AY2A 4N9QA 1JXGA 4YQZA 3KL0A 7REQA 2ZWOA 1TRKA 1KB5H 3FKUS 1FBTA 4KMQA 3LC2O 5F7EL 1JIKA 1GGCH 4ZXBD 2Q0HA 2EU8A 1IUNA 3GP8A 5J7CC 1WCIA 3MBEB 5IJZA 5EBLB 4CUCA 4HLZG 2ZUBA 3P4OB 3GJEA 5TXGA 3WIAA 3DUSA 4HC1L 1OM3L 3T4XA 3MJVA 4A8TA 1IG3A 2HKHL 3ZD8A 5AW5B 4GPAA 3BSWA 4BQEA 4G6JH 1SEPA 2VO5A 3SG0A 2HRDA 2BELA 5K1JA 1XU7A 3QUCA 2RD2A 1DQVA 3QCVH 4DMKA 4JCWA 3IKMB 4NCNA 4ZRNA 2HNKA 1J0HA 4UDTA 2HY7A 3HB3B 1I7ZA 1TZHA 4EJSC 4NN5B 1OAKH 3ZJYA 2AK1H 2NO1A 2VYNA 2FHCA 1UJCA 5JXEA 3N39C 3ZWNA 3LZFL 2YARA 1ORTA 3KDMA 5C31A 4DJEC 4Z78A 3ROGA 3K6DA 5IJCC 1NBWB 1U2CA 1L9XA 5C6WH 2PWPA 4F6LA 1IB6A 4XMTA 1OTTD 2F54E 4BFUA 5CJ2A 1DJZA 3QJUB 1GITA 2JLQA 4DG9A 5CYPA 2ZYGA 3IXTB 3BHNA 3U0WH 3TX4A 1TQVA 4H4CA 4DGIL 4TVOA 4CNQA 4TX1A 2I8LA 1CIPA 3WP1B 3VPHA 2BHNA 4MSWB 4FSHA 4JQSA 2XB4A 3CLUC 2AL7A 3RJDA 3BISA 1TJHL 1QNZL 4NU8X 3JZYA 3HS0B 1C4WA 5D5MB 5IFAL 3BDIA 3YASA 4Z7JA 2OULB 5DLEA 2BVTA 4HUQB 5DLML 4AUUA 5F44A 3CIQA 3A0RB 3OPZL 4I88A 2Q4RA 4D74A 5EEUA 4JO1L 4HKXA 2MNJB 2CKNA 1UXWB 2DTML 1ZT1B 4G6AC 2ZTSA 3I6KA 3TOXA 2YV4A 1FVDB 1TLTA 1JR2A 2WOBA 3MV01 4PYIA 3U3ZA 5EJ7A 4HPYL 3VYSB 2JJ2A 5TVKA 4RC9A 2HTLC 4KO3S 4B4KA 1Z0ZA 3RYTC 3ABMB 3D1MC 4M48H 1NW9B 3FXIC 2C07A 3MRGB 5KNCD 5JR1L 5LZ7A 1LD9A 4A8JC 5C0CA 1FLNA 2DYPA 4PJAF 3PNSA 4I4TF 1YNSA 2ZP1A 5F7JA 4K5PA 2DQHL 1G5GA 1DJMA 1FNSA 4I18B 1H3XA 1G2PA 4OL0A 5KX5A 4QKTA 3W2GA 2F8SA 1H2RS 1P2SA 4K87A 2VPQA 2XWCA 3LQAL 1FL5B 2NP7A 1NN0A 5H3CA 2ZSJA 3B9QA 3AYXB 3PC3A 3DRTA 2QPOA 3CPLB 4BZYA 1HNYA 2NUAB 2BBSA 5IROC 3I6QA 1RQXA 1OV6A 4E15A 3EFDH 2NZIA 4FYVA 3L5XH 1KEVA 1Q77A 2XN9D 5C09D 3MV9B 1F0LA 1W8DA 1A9PA 4FYJA 3GJ6A 1NEUA 2FZLA 5MENA 1OSNA 3UPAA 1JT9A 4DG8A 1ZK4A 2RK3A 4FPXA 2HG0A 5LWYL 1BREA 5CJQH 4NRZB 4INZA 3GPBA 1XTIA 3AY7A 1LYQA 2Y5TA 1GARA 2YK1L 2R751 3HE6C 3Q8MA 3PXXA 1KJWA 2WJWA 4M7KH 4YRRA 4U1NB 4APXA 4LJ9A 5JECA 4V0SA 4MB0A 1ORQA 3L1KA 3ML9A 2ZJ2A 4Z77A 2Z3VA 2Z5GA 3MWEB 1HEIA 2R6GA 2W2LD 3PRJA 2EAUA 3R5JA 1RTTA 5TVGA 5ABPA 4J29A 4LGSB 2ZBDA 2DXIA 4HPOL 5FR3A 1WS6A 2ZKXA 1TEYA 4ALNA 3WRXA 1DJQA 4PCTA 1T6ZA 1AF7A 3EXFB 3BKCL 1U1IA 5HI4D 4L3EA 1N6QH 2D8AA 4KXVA 4A8HA 1K68A 3IRZA 1TZJA 3WVNA 2NY7H 3QEQA 1MAAA 3AX6A 3RKDC 1G9TA 2EAEA 1DDOA 3NNNA 3PDWA 2CO3A 1EXVA 1RAFA 4P2OD 3HUEA 4ASUD 1EEYB 3HCAA 1AS7A 1KT2B 2X1MA 1SNYA 1VA4A 4ELDA 4ZMAT 4X65B 1XMVA 5LWHA 5HHPB 2FMUA 3GKWH 3QPWA 4P99A 4W5JA 1S01A 3H3XA 3AITA 4I1RA 1GGEA 4OFYA 3L7DA 1O9ZA 5BMVB 1P1HA 4OMUA 4AMKL 1EX0A 3MYYA 2MT9A 5AW9B 1J9RA 2FN4A 3ZN2A 4G5HA 2OMZA 3I5XA 3COOA 2A67A 2NTVA 3O8QB 5DGIA 4C89A 4WU7A 3JSAA 2IYWA 1G16A 2HCBA 4XZUA 3V0JA 5C8ZA 4ABWA 3CFUA 2V7EA 2AE1A 3FUXA 2QNIA 1KKUA 2ZR7A 3LU1A 3WHIA 2OMTB 2IV8A 3OXSB 1JDJA 2FW8A 5DT1H 3N87A 1EMTH 1VF5C 2X1VA 1G0YR 1JI3A 4IKJA 1U8IA 1ZICA 4OA8A 3PCXA 4KLRA 4DL9A 3C7KA 2IQ9H 1ZRUA 4GEGA 2RKOA 3WC4A 4L27A 4NYIQ 3EW9A 4IIQB 3FHQA 4I5BB 2O0MA 4ADGA 5HGHA 4XHJC 2IAMA 2G77B 2WWGA 4ODXB 4GQAA 4X93A 5F23A 1OREA 3W3AA 3BMOB 3ECBA 3C5CA 2REBA 1BNCA 5J2UF 2HJRA 5IJAA 4M7JL 5D1ZB 3L0CA 3TC9A 3KPRA 2XMCA 1U42A 5J63A 3UJAA 1U3JA 4Z7AA 2O26U 2W93A 4E36A 1V7ML 1ORIA 2ZWAA 2BNRB 4LZWA 5JW6A 2B2CA 2V0CA 3WDHA 2XACC 4I87A 2CXRA 3QWOA 5KQMA 4B50A 2X42A 4BWUA 4X2UA 1YB6A 3GBML 1JNHA 4AGOA 4X90A 1OCRB 4RX4D 4CDHA 3W7BA 3C60B 1AD0A 1JHLH 1PJ3A 2WQ7A 3ULSA 4ER5A 3GZKA 1DC5A 4C58B 3CM0A 1K3UB 4FI3F 4FTVB 4YP7A 5EN2A 4KITB 2G9VA 2WBXA 1FUIA 1Y1PA 5B2EA 5ID1B 3FHJA 4W7HA 1UJ3C 1HDRA 1WD5A 2DOCA 3ZKSD 1U3CA 3VFUB 3LQ4A 2OYRA 4LECA 3RFZC 4IM7A 2OYPA 3NIGB 4B5LA 2QG6A 1SF5A 1RPZA 1P3Y1 3A6EA 4CMCA 3CUEF 1C12B 5DX1A 2NLJB 2YL2A 3I62A 1CYEA 1RHRA 1UBLS 1BGVA 3MXWH 1FUNA 2YKLL 4ZW7A 4ZFNA 5JMTA 4F8NA 4X6DB 3DTXB 5D2NA 3MT9A 3KPSB 3QXGA 3MNVA 4X41A 4XVCA 5J1TC 4ZAGA 1SQGA 4M1DL 3AWDA 2Y9PB 1PK9A 3GGSA 1MCNA 1VC2A 1P69B 2Q5IA 3GRAA 2O4EA 1YVUA 4PRID 3EASA 4QBHA 1RHFA 2TSBA 2QTRA 4FW9A 1C5CH 3SKJH 3UYRH 3WXVL 4YI5A 3UTDA 1ZHOA 3KUDA 1KO7A 1NZFA 2ZTVA 5DHFA 4IWNA 3D09A 4HQ0A 3L9YA 2XODA 4H31A 4XEHA 1WUNT 1ZCBA 2YJGA 3EJ6A 4R5MA 3IUJA 1OIXA 1Z39A 1MRZA 5JHBA 4L8CA 4ZS7H 5C86A 1UC8A 1BX0A 4U3SA 3TZQA 1U2GA 3JASB 4U3HA 3OQNA 5TQ2H 4OQDA 4F3NA 4YXWA 1WEKA 3GYGA 1A5TA 1TJGL 1XZLA 2C9QA 5DK2B 3SHVA 2ZVQX 3HCWA 4P93A 1DXYA 3O38A 3TA3C 2HLEB 2DH6A 2NZYA 2XWJA 5D7LB 2ZX9A 4L5BA 1M2VA 5IHPA 1P6QA 2VPZA 1BCRB 4U1LA 2IYVA 4LWQA 3KH4A 5FUYA 4G0WA 2FBRA 3UTSD 3W9EB 4YI3A 4KKQA 1ISPA 3L01A 2AI3A 2YPLE 4DK5A 2AVFA 2P2ZA 5FECA 3M2TA 4KGLA 3DM5A 4HZIA 1YMMD 5PNTA 1XGUB 3WKCA 3RF6A 3VKVA 3MTEA 1RFGE 3K8LA 3D0KA 2NTEA 2J12B 1G7IB 1E2KA 4TMWA 1G8GA 5D96B 3T3OA 3FRIA 4FXOA 2F19H 1SVBA 3IH5A 4U8GA 2KJQA 1X9LA 4J3OH 2AG5A 1BQHA 2K70A 1N5RA 4K6OA 3DB1A 2GM9A 4L0PB 2CVFA 1K5DA 1A4JA 3ORJA 4AIIA 3M1CA 3VFRB 1RIFA 1UXGA 1ZRHA 3T3MB 3R8CA 1S96A 4NNPL 4UARA 1AKJD 3QDAA 3KQNA 4O33A 3OSKA 1IUKA 4FHZA 1HM5A 5FXCH 1UEXC 2IOMA 3PL5A 4UHCA 2GB4A 4WFGD 1VYVA 4XWGH 3H42B 4HNQA 5CHEA 2VGLM 1XTZA 1W72A 3C6QA 2OK7A 4ND3A 5FYJL 2N7AA 3DV6A 2I7OA 1N70A 3VFTA 4OLHA 2IU4A 3OZ9H 2VLRB 1R0WA 5CINL 1ESNA 4UBNA 3VU9A 3K1ZA 4CKXA 4J3NA 1LLQA 3GR6A 4PGHA 2DSNA 5B8CB 3QRWA 5J23A 4HS8L 3CIOA 1W0WA 3R3SA 4U49A 5BW6B 2VYRE 1R4XA 2H0PA 3I0ZA 2HJGA 3P20A 4KIUA 2P5WB 1GZHB 4H7DA 3SLGA 2Z30A 3L5IA 4LEOA 1T0HB 3R6WA 1KO4A 1O89A 3W9DB 3ZHBA 4Q2ZB 4KVGA 4OVUA 2EDCA 5E4IA 4P07A 3WLKX 1E6JH 3NACL 5LGKA 1CR9L 3VSTA 3QMPA 3PP4L 5G4LA 4L57A 2IV3A 4WN3A 3FOBA 3JQAB 4JDUA 2IWGA 3TLCA 4LCWE 1NATA 4OIIL 1ZY9A 1UWVA 3F6EX 1BOGB 1OZAA 4E7PA 2AHOA 4DVGA 1KNOA 3ZV7A 2PUQT 5HHVH 4EL0A 5JAIA 1OP5K 1X8JA 1T0UA 1D6MA 3PL6C 2GGSA 4MTLA 2O06A 3C98A 5LXGL 2FEPA 1FK8A 3O03A 1PZAA 5HR5A 5K7SA 4J28A 3MLPA 3TAHA 1J9EA 5KMGA 4ACPA 1S7SA 4UT7H 2DQCL 1NF9A 2WMDA 3IP3A 4IIJF 1G98A 3QXDA 5I9QC 3L8HA 4JDVA 3P9IA 3DDSA 1ONPA 3QIAA 4KDCA 2CHDA 1V7NL 4LXHA 4OD0A 3AXLA 4G9FE 3A8TA 4E2FA 2WF6A 4G70B 4FXKB 4OSUL 4JRYE 3K9QO 3ZCSA 4FR0A 4U1RA 1JDPA 3W8DA 1JALA 4JVSB 3PG5A 1QO3B 2H32B 1XD8A 3MLEA 3VR5D 3MNZA 4ZTPH 3WGVA 1Q5PA 2W42A 4HT1L 4YAOA 1B41A 2EFJA 5ESDA 1FZOA 3GSXB 4WZBE 4M43H 4CUKA 2FLMA 5IJWA 3UAJC 4G9BA 4V0NA 4AMGA 5BV2P 4XWOA 1R24B 4UPDA 2XGGA 1ILWA 4LDRA 3LNGA 2BINA 4N8VA 2O8FA 4PRAA 3ODGA 4OY9A 4P5SA 3PJNA 2EVFA 5FLXA 2WGXA 4LASH 1W36C 3UCEA 1MABB 3PXCX 4EYSA 5D55A 3IDIA 5TQ0B 4OF7A 1BU8A 3UIZA 2QJWA 4LY6A 1UD8A 1BXXA 3UTTE 1QB7A 1YAHA 5F7DA 4ODHH 1CS0B 4FQLL 1B0WA 3VPFA 1EJOH 1AQYA 4UEQA 1HX0A 2AQ3A 2B83A 3JZFA 3NCWA 1TT5A 5LA6F 1ZIDA 2VJPA 4B75A 2WXIA 4NUGL 3GTTA 4M0KA 4AG3A 2Z8XA 3WS3B 4F2ME 3RVUC 1QK4A 2E4AA 5L7YA 2VZSA 4UBOA 2O7SA 4HXEB 1YDEA 1N6KA 3IDGA 3V0HA 1P45A 3BSZH 4FINA 4NWUH 3FRPA 5CR9A 2B5IB 2PMBA 3QP3A 3FCEA 5IK3B 5EE9A 3MJEA 4MD5A 4LJAA 4PJEE 4ICWA 5AKSA 4UT6L 4PINA 3U7WL 2VZEA 5DV9A 3P71T 4L8GA 5EE1A 1SCNE 2VPWA 3L95B 4X6CA 4PP2B 1EJ6A 2ZIXB 5JI2E 4AK2A 2Y8EA 3S48A 2VRBA 3NJLA 3QMMA 1Q1BA 3S1SA 1YXMA 5FYLE 3TDNA 1A97A 3G02A 2NZWA 3ZRCC 2P9RA 3OX2A 3OICA 1PLGL 1IJBA 2CMRL 2PGXA 1Z68A 2P5ED 2ODHA 3ARUA 2V3WA 2I5YH 1RKQA 3ZZQA 2HAEA 2H6PB 1R6BX 5DT9A 2VERA 2K8MA 4HHWA 3TP4A 2BFPA 1XT5A 3TKLA 2H59A 5FA6A 3H1AA 1TIPA 4PBTA 1BHJA 3LHDA 2I76A 1WZAA 5D7LA 3VFSB 3KIPA 3SGEH 2FIRT 2VLKA 1GKYA 1LVUA 2P9QA 3DUUB 3E35A 1NE7A 1EESA 3VM7A 2ISSD 4PJXB 5CSGA 1BZ7B 4EM6A 5DBEX 1KGWA 1Y82A 2H31A 3P0RA 4G8FB 4MR8B 1Y0LB 4HYYA 3QJZA 1S9XA 1XGUA 3RSZA 2DH5A 4L4VD 3PNMA 1WG3A 1XVAA 5F7EH 1VSVA 1WT5A 3IQDB 1BC5A 3QDGA 1AGNA 1SPDA 4PSKA 2ODQA 4MHSA 3LIPA 1E6KA 1Z36A 1X9GA 3QA3E 3TJHD 3WS7A 4CZ2A 4JP8A 3L43A 2FOLA 1DANU 1THZA 5LYJB 1E60A 2Q5LA 4IXDA 2WO2B 2BGJA 4X6YA 4B6JA 1RKXA 5FWXB 5KTMA 5FPTA 4B9YA 1XO1A 3ON5A 4TLDA 3WE6A 3RZCC 1PX3A 4CCAA 1X39A 4DKEL 4JM4L 1UXLA 2JEYA 2EC5A 5C7YA 4LYYA 4B17A 1M10A 3F8UB 3N2ZB 5HGBB 4XWAA 1NUUA 1P2GA 4R2KA 5EO1B 4A63A 4FB4A 3IPBA 1ESCA 2WSIA 3U6KA 5CD5D 3HJNA 2YD3A 3GJFH 5K03A 4IWYA 3CSYB 1HESA 1RXLA 3INYA 2AS0A 5ICUA 3LDAA 4ORGB 1W0KA 4NESA 3DTNA 3WL4A 1HIMH 5GZNA 4EB8A 5JOPE 3VX1A 1SO8A 1YCHA 3CBJB 4B0MB 1JNXX 3W9SA 2V0NA 4CQNA 5FKJA 1SA0A 4HPXB 4WGVB 4QATA 1NQ5A 2QLYA 4QPDA 2RJ3A 2PH5A 2ZB4A 1O03A 3K8YA 3NKLA 4C4SA 5L2KA 3UHFA 3IUMA 3I01M 2H2AA 5AWNH 3F71A 5A7FA 1OTUC 1DSFL 2QZPA 4AI6A 4C4OA 2LQRA 5T4BA 2F9BT 3CCHA 3GI1A 4WUKH 3V0EA 2J8UA 3MRSA 4D9RE 4FKZA 4C4BA 3VFOB 1T83C 3DWTA 3A67H 4ZVSA 4ND7A 1TLKA 3WJJC 3RFUA 3RS7A 2YQZA 1O94D 4U7GA 3MX0B 4YDIH 1KL7A 3FI9A 4W5NA 4BKLA 1DAOA 4O2LA 4RS4A 2R8BA 2JCWA 3CFJA 4XNXH 3PPIA 2AJYL 3G1UA 4IH4A 2VDNB 3AONB 4B8YA 4JRFA 1NN3A 1SU8A 2EWWA 3KD4A 1YCGA 3THOA 1L4GA 1DQLL 2PJUA 2O9JA 2WXPA 3HA5A 5J57B 3KWVA 2DWSA 1LY1A 3NA9H 1SG6A 2FDXA 4QXMA 4OV5B 2PUDA 3BMNB 3QNZB 3UO1L 5F35A 4YIHA 5I71C 2GITB 2JFBA 2NY3D 4RGVA 1UBFA 1NAMH 4NUPA 3EVZA 3P30L 3TBVA 4J1NA 1ZIXA 3T95A 1NJ9A 4P06A 1BX3A 4DVBB 1IE4A 5E0QA 4JJKA 2YD8A 3ZGOA 3ARBD 1O6SB 4GRLC 3LQAH 2AXPA 2MOQA 2JIXB 2AYXA 2GVNA 1KJJA 3CLTD 1X9HA 5EZ6B 1A71A 3MOGA 1PZCA 4KXMA 5F7BA 2H06A 3L7IA 3TO2A 1RMFH 2NUPB 4M1CC 1IT9L 3FB8B 3QIUC 2AQKA 5CP7B 2G4LA 4YJDA 1DU4A 4JFZL 5KVFL 1Q14A 5BRZE 1FNNA 2AXGB 1FP4B 1Z7YA 3CPEA 4BQOA 3WLJA 1A4UA 4DSZA 2HTLD 4P9HC 4XN8A 4CVXB 4A38A 4XTCS 2JKZA 1N6VA 2P43B 5DC4B 1UANA 1D5RA 3QF4A 1AOXA 1P29A 1JW9B 2VZTA 3A1NA 2BGRA 5MHTA 3QZWA 2I60L 1K8ZB 1E2LA 2YXWA 5GS0C 5DVKA 1RACA 3IBFA 4G82A 2B39A 3LDBB 4X20A 4KHTL 5ETUA 3SNHA 3BGAA 2Y1VA 4TULL 3B6ZA 1KI4A 4LHYA 3HC2A 4PUBL 1NBME 5KTEH 4MWOA 5EPMA 1C50A 4CG3A 1QHHA 3D1LA 1MCEA 3O8XB 2PQMA 4V1DE 1O6CA 3LMKA 3MV7E 1HEHC 1NN1A 1F0PA 1WZUA 2VR8A 1O0SA 4MCJA 4YSQA 2PW2B 2VJ0A 3WXWH 3IXAB 2DQDL 1DBJL 3SCMD 2EUXA 3AG4B 1YPZB 2WC1A 4WUVA 2OX5B 2JBWA 3U46B 1ZLVH 1JP5A 3BIXA 1AP2A 2OM5A 3NCMA 5GS3A 3CHSA 1TK2A 3QVTA 3I45A 2BCKB 1VACA 1TZIA 5DEGA 2UZXB 5MENE 4R3SA 4XTRC 3WENA 2JL1A 1ZN2A 4Y2GA 1RAIA 5TV2A 3R20A 2CXGA 3RVSA 1EHAA 5DRYA 5HSGA 4R90H 1UWXH 1GAJA 3B2EA 1YJ5A 2DZDA 1NXWA 2LV8A 4L2IB 4G1MB 5AKHA 5ECYA 3EZGA 4LVOC 4WUUA 3R0ZA 4AWJC 1WULS 2HJFB 3ZWXA 2NU7B 1BZOA 5E2VL 1IFHL 4XPBH 3WHXB 1GGYA 4XVTH 3QCUH 1ZNXA 2PRKA 4FBLA 3RPIB 4LU5H 2IQ9L 3UJHA 2ZBEA 2RHRA 1G20E 1QC5B 1B43A 3LEXB 1PS3A 3MLSH 4Y19E 3V79C 5BR7A 4QDXA 1ZGLA 1RPQA 3HHMA 4RMIA 2ZIGA 4EG0A 3E22A 3K2UH 1Q1QA 4TVSa 1SBZA 1VADA 4XP5H 2H3XC 1HHHB 3L82B 3U9LA 2ZZNA 2YJ3A 4WNYA 3SO3C 4TQPA 3HDHA 4QBIA 4KQ4H 3S5ZA 5JOQA 4JI7B 2FJ0A 2JB6B 3DMMD 3SHOA 3VXQA 5F1KA 1I85A 3CNNA 3LSOB 4IBUA 2F54B 1KA9H 1IZ9A 3TPFA 3NPZB 3C4QA 2IBTA 3IETB 1SN0A 3LHAA 1N2GA 4I1PA 1YGYA 4OI7A 3WRWA 2HFFA 2J59A 3OM3B 2BFCB 1N6PA 3C5SB 1OLLA 1II4E 2CRYA 3IR5A 4WVRA 3VXOB 1KNQA 3KS0H 1Y1RA 5IGXH 5TQJA 3CB2A 3CWQA 3I23A 3CHXA 4KEAA 4WOCA 3QIWD 4QT5B 3B3AA 1PGNA 3C4JA 4KE7A 3HXLA 1NZJA 5ETUB 4HLQB 2V58A 3W2DH 4J0JA 3I8OA 4QUEA 1K98A 4BE7B 2W6NA 2FLVA 3VD0A 1TQ4A 4FK8A 4WDRA 4EJ1C 1P7BA 4NICA 2IT1A 1H2FA 1NAMA 4DR1B 4YR9A 4ZEOA 1I5RA 1C3JA 4G0OA 4GI1A 2ZXWB 4INJA 4O9HH 3CRMA 2BH0A 2PMCA 2CUAA 5J89A 3MWLA 5LMCA 3KAQA 5AI0A 4NAQA 4BHTA 1IKNA 5CBPB 2HW8A 2OZLA 1UWCA 1D3CA 1SUEA 2H0QA 1FZKB 4J4PA 4MGYR 1ADQA 4K9DA 3MLYL 4QXWA 4OLYH 2L7UA 5DHVB 2Y9RT 2NY2C 4FCWA 1AQDA 2MQ0A 4HNUA 4D25A 5THKA 4I4LA 1HQRB 3RS2A 2PX6A 4IXTA 4S2EA 4ZS7L 4ENPA 4DCQA 4NQCA 1GQOA 4PG5A 1DAPA 2ZYTX 2N0KA 3QI9A 4I50F 5C08E 3PV6A 1B16A 3WJLC 2FPPB 2E6JA 5JORA 1JQJC 1TD9A 1V3KA 5KU1A 1TJGH 1JDNA 5HVHB 1CJKC 3ZTYA 1H1LA 2F3RA 3WMFA 4H1VA 1PLJA 3ZQKA 2K2QB 1KZQA 4OBWA 2JGDA 1MFBL 3EGWA 2FEKA 1B1CA 4ZFFB 1RHUA 2FPMA 4OMDA 4Q9KA 1IAKA 3X1KA 2MQ3A 2P1ZA 4B97A 3AU1B 1S7SB 3I3EA 3CKMA 2Q3ZA 2VCOA 3CS3A 5IU6A 2QGNA 4LSQL 3F7YB 5ESVB 3GU3A 2HIHA 3UTSA 3UB2A 3BICA 3IRCA 1QIDA 1A6TA 3IE1A 4WNSA 1ZD8A 3B2DC 2K8QA 3DV4A 3AT0A 2XJ4A 5ITSA 2P3QA 1PZSA 1OZUA 4Z4GA 1N10A 4XPIB 5JDSA 1G9NL 4ZQIA 2A0WA 3CQFA 4I5GA 1AMXA 1TETH 2GQ0A 2WVGA 4MAYA 2QHRL 1FSKB 2JXMB 1J20A 1E1RA 3IOMA 5IEJA 1WHSA 2Z3FA 1GNVA 1AMOA 1AZLA 4CGYA 2X23A 4RBPK 4B35A 1YBAA 1F48A 1UEIA 4BEJA 3JWPA 3Q6FA 4KZPA 3TECE 4O2AA 3CU5A 4GT0A 5D1XC 5DMGD 2P9EA 2C1PB 1EFUA 2EZTA 4G5YA 3GZOA 3REWA 1TKWB 3DX2A 3NSFA 4XSHA 3LNDA 1VKNA 3MUY1 1AGFA 3O4LE 2DIAA 1MIEL 5SWSD 5F9JA 3GMPB 4X1OA 2FFBA 3IAS1 4CL2A 4FMCF 1HMYA 1J5CA 1BOOA 4HUJA 4K6HA 4DA6A 2BEUB 3R4DA 4B9ZA 1EZSA 4WESB 8MHTA 5GSVB 1OZ0A 2XZQL 1KTCA 3MTJA 2HT2D 1SUFA 1RC0A 4NSKB 1RIVH 1YG9A 3DW3X 4KSCA 4ZWNA 2FX3A 1ENPA 1ZVYA 5KTYA 1IBRA 2X53A 1JT2A 1VLXA 4DGSA