3V7UA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with mta
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
264
structure length
261
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable inorganic polyphosphate/ATP-NAD kinase 1
publication title Screening and In Situ Synthesis Using Crystals of a NAD Kinase Lead to a Potent Antistaphylococcal Compound.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 75
structure length 261
sequence length 264
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 3v7uA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3v7uA01
2BONA 1U0RA 1Y3IA 3V7WA 3V7YA 5EJIA 3VZCA 5EJFA 2I2AA 3V8PA 1Z0UA 3V7UA 2I2BA 3PFNA 2AN1A 3V8NA 5DHTA 2JGRA 1U0TA 4HAOA 1YT5A 4L02A 2I2CA 4V24A 5DHRA 5EJHA 2I2DA 4WERA 5DHPA 3V8MA 5DHQA 2I29A 5DHUA 5EJGA 1SUWA 3V80A 3T5PA 2I1WA 3AFOA 4WRRA 5DHSA 2QVLA 2I2FA 1Z0SA 3V8QA 4DY6A 3VZDA 3S40A 1Z0ZA 3V8RA 3VZBA 2P1RA 2QV7A 1Y3HA 2Q5FA
chains in the Genus database with same CATH superfamily
5BWCA 4LMBA 3GY0A 3NIDB 2PSDA 3B7WA 4W5TA 1DKLA 2BKUA 1P4JA 3WIEA 1VMIA 2QGNA 4FJ1A 3TWOA 3WIBA 1RZ3A 3BWMA 1FP4B 2QL7A 1I24A 5BWNA 5FWXB 2WMOB 4HAUA 2QTVA 4M8LA 1KHUA 2ZRBA 3WWPA 4NE7A 1VCHA 1YR1A 3DMGA 5CYPA 4AUNA 2JD1A 2LW7A 2B61A 3CS3A 4BPBA 4J1TC 1JEQB 4HNUA 1CS0A 1M0TA 2WFLB 4MROA 4C3VA 4AMBA 1HORA 3NTRA 1KOJA 3WKAA 3IUYA 1JLKA 2JAUA 3GT0A 2ZPUA 2ZYRA 2P6NA 4Y6PA 5HBGA 3DCNA 1QP0A 2FN3A 5ALLA 1VKRA 2BRFA 1BW9B 3RV3A 4UJ3A 4HRVA 3I37X 5EFOA 3NBUA 1L6IA 3NFRA 4LY6A 1UJ2A 4F38A 5D2CA 5JPIA 5ULLA 4YMLA 5LQUA 2O1EA 1GGVA 3QWHA 5EMHA 2FPXA 3QEMA 1D0IA 3SD7A 1CY7A 1Q11A 3GUZA 4BMYA 1F7UA 1PHRA 1I7PA 1IDOA 1BMFD 1FSSA 3RTDA 4OQEA 1ZL0A 1QWTA 2FNAA 3IQGX 3RWMB 3PBKA 2W9XA 1FDOA 2BJVA 4JGBA 1JDTA 4JUBA 4EYKA 3N8NA 2BW0A 1N6KA 3DNMA 1W8IA 3VZBA 2VOEA 4JU8A 4RH3A 3DP9A 4MINA 4B40A 1NVMB 4DQVA 4F1WA 1QRSA 3C0KA 1P2BA 1RYFA 1NYLA 1RQNA 3B2NA 1WS6A 3BF7A 4G65A 4QHTA 4R1PA 4RIEA 1M76A 3CRZA 4ZAXA 3OT1A 4EUHA 2ZXFA 5BN5A 1KDYA 2OFWA 5LMUB 3M5DA 1ZHHA 3LC1O 5ALFA 4MYHA 1CG6A 1CUWA 2D2FA 4HAOA 4X94A 5H83A 3W7VA 4URUR 4HADA 2PZFA 3HYTA 3WIVA 2IYYA 3A9RA 2I7CA 5SY4A 2H29A 4PFQA 5EJGA 1XP8A 1A2QA 1DC5A 3R5JA 4H6PA 2HA4A 3NBXX 4WQMA 1MLDA 4IEIA 1V7PC 4TS1A 3ZXXA 3I6UA 2L17A 1PZGA 2BJHA 3KQPA 1HXHA 4NESA 1L4UA 1XZAA 3C3EA 4N9QA 2ZAIA 1U8FO 3OA2A 5KYXB 3CPSA 2FZVA 2LDBA 1PGJA 2B1JA 2W37A 1U8YA 3HXPA 4FEGA 2V7PA 4PZDA 3ZE9A 4C6TA 4NK5A 3MWEB 4R8VA 4NCJA 4MUMA 3TQRA 2GOYA 3DEIA 3ND8A 4CM4A 4RZ2A 5JAZA 1SQ5A 3GBPA 1T2VA 4V3BA 1X94A 1P1HA 2FF4A 3X2SA 3DDNA 1FNBA 4FGKA 4ITUA 1WG8A 3IDOA 5C9ZA 1DKOA 1VKOA 1GUFA 1T0JB 4FGSA 4R8RA 5BNFA 4CM7A 1VDMA 2VJKA 1QC5B 2R7KA 2ZU0C 2QN8A 2ZRAA 3VQTA 3GP5A 2VXCA 1BNCA 2B78A 2YVQA 5BRNA 3QKRB 4C7JA 1Z0SA 3SG0A 4Q66C 2G25A 4MR9A 3E1SA 2I3GA 4OL0A 4UXJA 2BHSA 1OX5A 4URHA 4P31A 2H2AA 1V1MB 2RJOA 4YAFA 2GESA 3OHMA 3G5UA 1Z6AA 3V8EA 3TNYA 4DQDA 4BHTA 1JU4A 1Y33E 4C2BA 2ZZNA 2AMFA 4NFHA 4URYR 1EX9A 1L7VC 1FFBA 3AILA 4JQCA 1DAMA 2ZTUA 4FMCF 3Q8KA 3AVQA 4MW9A 3WNZA 2G9UA 2BFBB 1Z68A 3BUSA 2HQRA 1KSHA 2VR1A 3MSXA 4IGIA 1Z35A 1AHIA 4JNKA 2XMQA 4Q18A 4LDNA 4RY0A 3USCS 5JCOC 4ZWNA 3TYXA 5EHZA 3SOZA 4D80A 3KKQA 3BIXA 4Q34A 3VVBA 1JFFA 1U3CA 1N2XA 1Y1SA 3KZ1E 4EZEA 3EVBA 3UMMA 3Q1KA 1NJ6A 2HDWA 3EZ7A 4IVQA 1IC6A 4UEQA 5B58C 1XU9A 3L6BA 4MYDA 5A4AA 5FTWA 4WZBA 3RJ9A 4YCSA 5HF5A 2G36A 5TQVA 1RXIA 3UMZA 2PFSA 3EK2A 4K05A 1DEVA 3B82A 1VGQA 2FGKA 3GHYA 2IU4A 4JKOA 3SSMA 4DJ5X 4CV1A 4ML3A 1L8QA 3HR8A 4PPFA 4U6NA 5ICFA 3IEMA 2GZSA 3CLSD 1Y80A 1E99A 2GKGA 4HAIA 1JFSA 1EX1A 4GPD1 5IH3A 3ETGA 1GQQA 3ISTA 5J2UA 5G0WA 1XEXB 1ST3A 3OO1A 3QLEA 3A58B 4W4TA 1OFVA 1UC8A 5EKUA 1X13A 3ZE7A 4DJDC 3R09A 1HMYA 2WV7A 1ES9A 1E8NA 4DCTA 4U2CA 4RWZA 2GVNA 3NUQA 2HSEA 4IHJF 4O2BA 4RLQA 3FDFA 1E5QA 3I62A 4FM9A 1G9SA 2FPUA 2NUPB 3REQA 5E6RB 2JGLA 2JIDA 1DE0A 1KZ1A 5FD8A 1BX1A 1FYVA 1ISSA 1S3IA 3TE6A 4CIAA 3UBTA 2I71A 2OQIA 5ENVA 2NWQA 1Z6YA 3HDGA 4M9UA 3QG5A 2I29A 3EBPA 4B80A 3UPTA 3I4FA 1G21E 1C0PA 5JQGF 5JNVA 4UDXX 2JG3A 2P62A 5CEJA 1TC2A 1PT9A 2OXFA 3S8YA 1A27A 3I0ZA 3MJDA 2W2TA 1GPUA 1R00A 5GGXA 2BCJQ 1WCIA 4PIPA 2R2GA 2PX4A 2HLPA 3IEVA 1ODIA 4K3VA 1Q0HA 4B9AA 5A5GA 1YULA 2WTXA 4DANA 3BTSA 2QQ5A 1XFAA 3BORA 4EH1A 1CUVA 5EJIA 2RH4A 2WF8A 1U2QA 3KVVA 5AVKA 1NBMD 3IQHX 2QUIA 2F8TA 4S1TA 3D8NA 4FIDA 4RSGA 4B4DA 3ZW7A 5BORA 4PAQA 5JASA 3BL5A 2GYVA 4HEA1 2O7NA 2CHFA 3ZIAA 3ZOZA 1W581 3HMKA 5AOVA 5I9TA 3L9XA 2D5LA 5FDFA 4P7JA 4N4AA 3VO2A 3QLUC 5DMHA 2AOTB 3PEFA 3W1EA 2GETA 2BJWA 4O2AF 1WV3A 1AKUA 4JI3B 1N6LA 1PZFA 1V5FA 2BLLA 3CCFA 3HCRA 4K0RA 4JBNA 2I87A 1CR1A 2B5WA 4QOEA 1BHSA 4EB8A 3OUTA 5HIAA 3V2HA 1FRNA 4FSDA 1HK7A 3OIFA 4LXIA 3N2KA 1C0LA 1P5RA 4S1WA 5JLJA 2AB0A 2DUUA 1L5QA 2VUIB 3HBNA 1XEWX 2QX4A 4RVNA 3WGOA 4ALNA 3EGCA 3LBFA 5DI3B 4W5RA 4E3ZA 1BX3A 4MW2A 4HX9A 1NQXA 4MW1A 3ZE0B 1ZITA 2PSEA 2R4UA 4C3UA 2HTEA 5L6MB 4XQ0A 2I6SA 2QENA 1WXFA 2GZRA 2JZNA 3K5PA 4A6EA 4PTLA 1O03A 2G5TA 3GLKA 3QPCA 2I78A 3GCWA 5H0IA 4AZ0A 1DTWB 2ES4A 4IZOA 3U3MA 1G6GA 1UQRA 4FVTA 5JZVA 4IV5A 3D31A 5UKDA 1UBMS 1QBKC 5DVZA 4IZ6A 1UXGA 1YJ8A 4NDZA 1CQIA 3THWA 1YL7A 3FTPA 3DLPX 2QPTA 1V43A 4K6MA 3DUFB 1DXYA 4M3NA 2R66A 3UYKA 4NJMA 2CMDA 3ZOKA 2R97A 2QT1A 1Y3DE 3D1JA 1X19A 1MPTA 5DBHX 1H69A 2FK7A 4F9EA 5EHXA 1WUIS 2NO7A 3PHIA 4DWWA 1O97D 4LKOA 3WLAA 2ZJZA 3WMGA 1Y8QA 3CEMA 3B1ZA 1ODKA 3ILSA 3T5BA 1N5RA 1O94C 2M6RA 1OA0A 2R1TA 5TNXA 3AKCA 2R1VA 2VP2A 2YRXA 3C5HA 4I81A 1TAGA 5EN4A 5TQ0B 3ZCQA 1HNXB 3WWEA 4JOBA 4B7AA 2R8OA 3BH6A 3WL5A 1KPGA 1TM1E 1S6YA 2GMWA 1OC4A 1UFQA 2IHUA 4M89A 5ILQA 3H9CA 4OJNA 3O5AA 4U2GA 4G67A 3AESA 4TTJA 1EFVB 3GHHA 4PBTA 3ECSA 4FZ5A 4JZKA 2BFEB 2H7XA 3FWZA 4L78A 3VJLA 4TXLA 4I3HA 1IG3A 3GC6A 3FSEA 2GEJA 2ODWA 4DY4A 1BN7A 1U7XA 5EWMB 4B17A 4K2AA 1ORDA 4L8FA 4CTKA 3KJHA 4ONEA 2ZIWB 3CH4B 2R0QC 1GYQA 1EP9A 1NVFA 4KWTA 2XUAA 2EEPA 4I0WB 5B7PA 2D7DA 2J32A 5LWQA 1ISJA 1W29A 4CQMA 4S3MA 1Y3AA 3S2FA 1H1LB 3BILA 1G8MA 4OSOA 3WLHA 1UDXA 2P4EA 4R2XA 4RQAA 5FTLA 5KSYA 1I3LA 2C00A 2HMWA 2JIOA 2P6UA 2ILTA 1SBNE 4U5QA 3TTTA 1HGXA 4ETWA 2NZXA 2C2BA 3FGNA 4PO1A 1WF3A 2O1WA 1V7CA 2OZLB 4XLLA 4DLZA 1MOZA 3A6JA 5C1DA 1IHUA 3LA6A 4G5YA 1YC5A 3ONDA 3WKCA 3SNKA 2ZROA 2QZSA 4ZT5A 5ITSA 3NO4A 4MDYA 2PKRA 2FJPA 5E6SB 4D9MA 3ILYA 4NG4A 4OOFA 2Z56A 1PKEA 2GB4A 3GQBA 5AM5A 1Q7TA 1L1QA 4ZCLA 1FIUA 1G3QA 1KS2A 4G23A 3S68A 3BHJA 3GFSA 2NUAB 3ENQA 4LXHA 4LBYA 3F4BA 2IYRA 1K8ZB 4WGGA 4Q0MA 1DQRA 1N9GB 2V7GA 4MUKA 4MX8A 4ZV4A 1BIFA 1KYYA 4K8RB 4US2R 2HF7A 2WHYA 2NQ2C 3KC2A 2A5JA 5CH8A 5FUVA 2BISA 1BVRA 2GZ3A 3MFYA 1SQ6A 4RFVA 1F6DA 1ZD5A 5AJTA 3VTAA 4BTVA 4DRXA 1ULTA 1EYZA 2Q3FA 1EJ6A 1QOZA 3HV0A 5FQOA 1YV9A 2CFCA 4J07A 3WSWA 1XZ8A 5EZSA 3SJCA 4JBGA 3OWXA 3FNFA 4BUZA 1SOWA 4QXPA 1XTVA 4BYMA 4FCVA 2AJ8A 4BUJA 3HKBB 1P62B 1XCGB 3FCEA 4CT0A 5FOXA 1Z33A 3EXG2 3KZCA 4TXMA 1IZ0A 5HKKA 3OF3A 2HQOA 3GRFA 4C4ZA 2AZXA 4JR2A 4DB2A 1YF3A 2W42A 1R15A 3MJ4A 1BMDA 1GIAA 4FXOA 1SY7A 3VOAA 2YW2A 4CGYA 4J6EA 2ZREA 3EARA 4RDCA 3NCHA 4JQYA 1KQOA 2UAGA 4OX9Y 1G3RA 1WX1A 1ODFA 2VZ8A 4JVNA 4YEDA 4D3SA 1APBA 3FVQA 1W76A 1DRJA 2K5UA 2JFNA 1Z3CA 1IBLB 3OUUA 2HHHB 4L4ZA 3QVJA 2H3EA 1EE2A 3B78A 5I7WA 4XJTA 4BNGA 4ARCA 1XRJA 3EPLA 2IZ5A 1KAHA 2QRVB 1K0UA 4NXNB 3KM0A 1E96A 3WB1A 5FOTA 1JR2A 1DUIA 1W5FA 1IG0A 3E9DA 1U9IC 4JOCA 4XE5A 3QUTA 4P0QB 1JHXA 4L75A 1JLLB 3HCAA 4G2NA 4X71A 3IP1A 3A1UA 3R44A 1BD4A 4Q3BA 4XOIA 2AJBA 4M1ZA 4XXHA 4OLBA 1KEEA 2XCQA 3FIUA 1JG7A 3QUAA 4BTLA 1AMUA 1CDDA 2HBZA 3LUKA 1BHO1 3QE2A 4YO7A 1U0RA 2HBYA 3LSYA 5K51A 4C78A 2ZIFA 4OJTA 3HG7A 4R8KA 5JXJA 2HWXA 3LDHA 3AR7A 1KETA 4K9KA 4KXVA 4S04A 2PUFA 1R5OA 1KYWA 3OZTA 4N48A 4E08A 4GHWA 2XMZA 4KRXA 4Q5IA 3K7EA 5E1DA 4D9BA 3JPYA 2WAAA 5DKFA 3QU9A 3NHWA 1PYDA 4HX5A 4KN8A 2ZUBA 1L5FA 4BC0A 2HV8A 1VJGA 4FNGA 3T9EA 4AO8A 3LBHA 3TUZC 5IC6A 2IPMA 4JVMA 3ODPA 4EMTA 3T8YA 4D8TA 1JJFA 3E9QA 4Q02A 3CKYA 3EPPA 3O3CA 3GCGA 4YAGA 2GCNA 4QECA 3ANSA 1KMMA 4OI0A 5CM8B 2VYVA 2C1EA 3DV9A 4D9EA 1QHHA 1MB2A 1AXEA 1KH1A 4K9NA 3B7PA 4KUHA 2VNHA 4YUZA 1JKJB 5P21A 4MW6A 1FQJA 1RAIA 2AFRA 6YASA 1SA0A 2NO1A 4LDRA 3VA7A 1GGJA 5GIPE 4TS3A 1HMPA 2DUNA 1OWOA 2H1VA 4QBGB 1SIWA 2PR2A 1DEKA 2GM3A 4R9SA 1H0RA 1YR3A 4KJZA 5IEBA 3O0DA 1Q6ZA 5CH5A 5GM1A 3DVQX 1GQOA 2PS9A 4I55B 3NTUA 3UFBA 1C30A 3OEYA 2PMCA 5KCZA 2ZBFA 2OXIA 1UBRS 2XVZA 1Z8DA 2DLDA 3E8SA 3HCWA 2OR3A 1Q7BA 3U81A 1GPJA 3NYWA 3ESCA 4MB6A 5DBOA 1EMDA 2VZEA 3UB2A 3PI7A 3BXZA 4PYRA 4QWMA 3UTCA 1MG0A 2JGIA 3P26A 4YI3A 1OV4A 3Q7EA 4PRKA 4YJ2B 1DEOA 2B2NA 1JQJC 1KP9A 5L51A 4ZVSA 2QNBA 2PX2A 4YT2A 1CJTC 1LPMA 3E3OA 4JIGA 5FI3A 2FQWA 2XWSA 4X00A 2DFNA 1BVHA 1K89A 3R5TA 4MIOA 3THYB 1RBZA 1SHJA 5CTJA 4L9AA 1O5OA 4R1UA 3QKWA 4BOYA 5DTMA 3PXAA 1WW8A 1KI9A 1ZC3A 4MVJH 4YPFA 4MQLA 2IS6A 3N2KB 1V11B 3ZBQA 2BF4A 5SZHB 3UH1A 2C82A 2WF7A 1PTJA 5AJUA 1CIJA 3OQ6A 3RGWS 3B60A 2P5YA 2VK2A 4PANA 1ULAA 4IVRA 4ZJPA 3IA2A 2P91A 3B9QA 3A9SA 3ONEA 4D0RA 3GNLA 3PL1A 3QVTA 4EYGA 2BBOA 2QTCA 1SMKA 2KLHA 3CUUA 3M34A 2IIVA 3AEXA 3O7MA 1X70A 4HQFA 3T5CA 1O58A 3D3JA 3R9KA 5KNCA 2QR5A 5ANRB 1F2TA 4M8IA 3OZFA 4ZCQA 2ST1A 3DCYA 2Q4DA 3UYLA 5C53B 2ZWOA 2Z5FA 1CR0A 5T4EA 3TGLA 2G1LA 2YZGA 2D5CA 3K1JA 4ZVOA 5L8VA 1CDEA 2BHNA 2W8ZA 3T3DA 3V80A 5CB8A 4KGZA 2JD0A 4WY5A 2ZZMA 4EDHA 4YUWA 2K2WA 3IBCA 4NR0A 5IM4A 2WZBA 5CCDA 2FPKA 1U7HA 4QM7A 3NHMA 2O8VA 2C59A 1QOPB 1CFZA 1I3OA 1KQNA 4BP9A 4ZZ0A 1K9VF 4A1FA 2PRZA 3VOTA 1Q0LA 1JIJA 3SK0A 5M34A 1FVOA 3LT1A 1WMDA 3QP9A 2BYTA 3RREA 3I9KA 4Q4AB 3U13A 4DSNA 1SHTX 3AVVA 2O2EA 3VFDA 2QE6A 3LCMA 4R54A 5D3MA 1U1FA 4M4SA 2YIDA 3NHYA 2XV1A 5KQSA 3T1HB 3A9CA 1YJAA 3Q11A 5K3OA 1E3IA 4KLRA 3WLLA 3LGSA 1IVSA 4OXXA 1KZGB 2VSFA 3HX1A 2EKQA 4EG8A 1B4DA 5F2NA 4X65B 5F21A 1XF1A 3LRTA 5DX0A 2ERXA 3V48A 1IUNA 2DY0A 4RPHA 1R88A 1UMDB 3MF4A 1D8TA 3MPUA 5ENZA 1EFCA 1C3LA 4LC1A 2E0IA 3IV6A 4M99A 3RRBA 3NH9A 4F6RA 1Z5VA 1IRXA 3GMJA 3AM5A 1TFRA 1AZLA 2Z3WA 3AHFA 4DLBA 3MVEA 5LBIA 3UV7A 3E18A 4G07A 3ADBA 3HEAA 3UN1A 2R7NA 1IAVA 4HMOA 5DM4A 1GPNA 5A6VA 5JATA 1LGYA 4PYKA 5LMZA 4NYIR 3UO8B 1PW5A 5E2IA 5IJ9B 4UHJA 1T5HX 1KWGA 1KNXA 1NY6A 3WLNA 2FLKA 3RM3A 4C6SA 5JCZA 3A32A 3JRNA 3L0PA 3X2EA 1MF7A 1S8AA 1CXZA 3OP1A 2FSVA 2LCIA 3G7NA 4K46A 1EUCA 5I7AA 5TR9A 3DL0A 4GXTA 4IJQA 4M37A 5BOVA 3R7DA 2W6MA 5EYPA 3WNVA 4EVRA 3K1ZA 1YR8A 3D43A 1SXHA 2W00A 4PC2A 2FMFA 3MS7A 4O2AA 5CNJA 4TS9A 2F3SA 2Q3CA 1WNFA 4JKIA 5G0TA 5CA0A 3WFIA 4DSAA 1DGQA 4PO9A 4JLDA 5KJEA 3RS0A 1U2TA 2HSJA 4MQEB 2VO1A 4A8JA 5FLYA 2RH8A 2G6BA 4DVJA 1VSVA 1ZIPA 4RIFA 4MYTA 1I4WA 2J0UA 1DZIA 2G5CA 3KUCA 5IDWA 5A0FA 3PP8A 3B6ZA 4BVGA 1CRWG 5BWOA 3COPA 4F06A 4DIEA 3HA3A 1MH9A 2V74B 1ACJA 3STHA 1JFTA 1L7DA 2PV0A 4HB4A 4DV2B 4I2VA 1NT4A 5B12A 1E60A 3ABZA 4I5FA 4AJPA 4E09A 1HNZB 5FR2A 4X7BA 5DYIA 1GU7A 3P9IA 1M9NA 3R74A 4B4VA 3LFUA 4F5ZA 3DTVD 3TZEA 1A5BB 1Z4LA 3AHGA 4NJEB 3IJRA 1OXSC 3QV2A 1KMQA 2F67A 4GLOA 2VPWA 1M5TA 3P9CA 4XI9A 1VXRA 1QX4A 4DLRA 3HY6A 5BUZA 5L3VA 1TAUA 3JD1A 1IMJA 2IDMA 4L50A 2R5WA 4Y7DA 2BEWB 2QR2A 1EVZA 1UZUA 2C7QA 3QSGA 3ADDA 4TKMA 2Y4OA 3FOBA 4K88A 1EGQA 2IV2X 1KQFA 3THWB 3W3ZB 4KQ1A 1P3Y1 3BRQA 2HPAA 4G1VA 1FL9A 1FBNA 5HMMA 3BERA 4UW9A 2I1WA 1RYEA 3HU2A 3T7SA 1Z2AA 1SEPA 1PWEA 1IN5A 1T24A 4RHTA 3JQGB 3VNBA 1GGMA 3K4PA 1DBIA 1S3FA 4MI9A 5EUMA 5DXJA 5EIEA 1LLUA 3UIEA 1T2UA 2C2MA 2PGOA 5D6OA 3ZJTA 4Q4JB 3IUEA 3X43A 1V1JA 2VRCD 4I19A 2ZJFA 2I6XA 4O2LA 3LXUX 1QH0A 4U7PB 2CUZA 1QOQB 4MHSA 4YCDA 1JQ5A 4KAFA 4UM8B 1L4KA 2GWHA 2I7VA 1YZTA 2Z8XA 5JUWA 5A4JA 3ME5A 1MABA 1Q77A 1ZNZA 2ZI6A 4G86A 3N8HA 5KTOA 4ZJYA 1ZGCA 2BKLA 5AJZA 1EFVA 1NULA 2GEFA 2JIPA 1PJ2A 2RHOA 7MDHA 3WGNA 3W2FA 1NJSA 3WGKA 2FEZA 3RIHA 4ZEVA 3K9HA 1C0IA 4PLPA 5JDIC 3TLGA 4HNAB 4F5YA 1KVQA 4JEIA 3DL2A 5KSWB 1NG1A 1RADA 2ZWVA 5TQ0A 1V9CA 3UG7A 3HHEA 2Z09A 4JI5B 3Q3EA 1K7CA 1DXOA 1D4AA 4KXMA 5EE3A 5J5AA 3WYNA 2VTBB 1W1UA 4BJHB 4IDNA 1WCIB 2L2QA 3PQDA 1NQOA 1WL8A 1LDYA 4NY1A 3GEBA 1L7BA 3H1FA 1MO4A 2XE4A 3IEXA 1TL7C 2V6IA 1SPXA 5ERXA 1NUAA 3H3XA 1B14A 2PT5A 4L07A 2VK1A 1DJOA 5IXYA 1KP2A 2X19A 3HNPA 4Z9YA 1ECLA 3A4TA 3V1KA 4KL8S 4PPNA 1W2WB 5KNCH 2AG6A 4IDCA 2GLXA 1XZIA 3LWDA 4G24A 4MVJP 3H65A 5EPUA 4XB2A 3TRKA 5EIXA 3EIQA 4QUAA 4TT3A 5SYAA 1ENPA 1P75A 4FFMA 4MTLA 2BKVA 4D9NA 2ZSHA 5H5JA 1J4OA 3PFNA 1EVYA 5F73A 2MCFA 1K08A 3U62A 3V8BA 2OHJA 3UT5B 3I52A 4HF7A 1LX7A 3JQ7A 3B9PA 1U8CB 2AQIA 3G88A 3GEMA 3Q15C 3H2JA 4H0CA 1TJYA 4KXQA 1I2CA 2DY1A 2WWHA 5ELLA 3HCOA 1M83A 2C0PA 1YJ5C 2EQAA 4QFBA 1E3WB 3I6IA 1CIVA 1ZHOA 2Q9AA 1DAIA 1GZSA 5F5LA 4S35A 4LTDA 4WKBA 4B8ZA 4CM8B 4F85A 2VDMB 3DD5A 1B0UA 2GF0A 4PFSA 5CCXA 1DJQA 5LA6A 3ZVMA 1R8XA 1HYQA 2JJ8A 1X39A 3IKLA 4YAEA 1OX4B 4D41A 3BGIA 3ZU4A 3N76A 4XUEA 4TLAA 2F6RA 5JSKA 4R2KA 1AKEA 1P61B 2QM3A 4QOGA 4UREA 16PKA 2PYDA 3A6FA 3A2NA 3MSCA 3QF7A 4UUOA 2BIFA 5BNZA 4F45A 1KDPA 1YU9A 3AL0C 4ZOLB 1K8XB 1E2GA 3IXQA 3KOYA 4FGWA 4KOAA 4Y7CA 1YJXA 5KHOC 1R0CA 1U2DC 2IH2A 1MVNA 1WD5A 2FFHA 2O06A 1EFHA 3BEDA 3CR3C 1VCIA 3D9QX 1KFBB 2IPLA 4IRXA 4N3BA 3RIYA 4HDNA 2UVPA 5TPWA 3KU1A 4J0EA 3T15A 2IUEA 2VSYA 1UM9A 4YY3B 3THSA 5IAAA 3GLFE 5DH9A 2LUOA 4BN0A 3OO0A 4MV6A 1IM8A 1J2JA 4MS1B 3CONA 2XGJA 1M7BA 2OOSA 4NCAA 1PJRA 3AW8A 1E1KA 2H4HA 3K9WA 1Z18A 4KPFC 1LC3A 2BDEA 5LYYA 2IHYA 5MGNA 4YP1A 2I4NA 1KFCB 3Q9LA 3KV3O 3X1WA 4B43A 2R7AA 3IP6A 4BFCA 3CR7A 5IKPA 4V03A 1G6OA 1TTQB 2OZLA 2EATA 2ZS7A 2JBWA 4WXEA 4WRRA 3RANA 3OAAA 4C0XA 1NNI1 3W2IA 2FWNA 2QMQA 3OHSX 1RP7A 4NABA 3C70A 2P7IA 1YGSA 1WV0A 4HDQB 4P5PA 3F9CA 1IY9A 3LLMA 3MPOA 4ESOA 4WFQA 2ZAYA 5JSZB 1JTFA 3DDZX 2XPCA 4Q7EA 4UBJA 5JWOA 3EUWA 2FOXA 1J24A 4HFNA 1LLCA 2OCYC 3K1TA 2FWMX 3ZXSA 5AKGA 2WTUA 5MDHA 2Z6VA 1I7LA 3FI0A 5AVTA 2OCBA 3PT5A 4MCIA 3ADOA 4HWOA 2VEDA 3K8OE 3I76A 3ZIAD 4B3MB 2GZHA 2HEIA 3RARA 5HM6A 1NVKA 3GRYA 3DBLA 3EPRA 1ICEA 5LA6F 1NNEA 3O2NA 4AS1A 1V35A 1L4EA 4MYCA 2VJQA 4OHCA 3STYA 3AP2A 1H9CA 3MW8A 1NP6A 3AR4A 3VAYA 2OESA 3AU9A 2XNDA 3U1VA 1TEXA 2C94A 3VRHA 4FEEA 1LNZA 5BXYA 1JHYA 2Q8PA 4P3KA 4AZVA 2SKEA 2J0SA 4Q9LA 3HBAA 1R66A 4IIBA 1L3IA 3GH1A 3RYIB 2BVNA 4V2UA 2WWVD 4DBZA 5IKMA 5AT1A 4OI1A 1XRPA 3EDRA 4ON9A 3C7AA 4OL9A 4YREA 3FNHA 2OCAA 2UVQA 3LK6A 4IBOA 4UTOA 1W36C 1N5MA 3WJ7A 3WB0A 1PJCA 3QPAA 4UVEA 1X1BA 3IHWA 3PNVA 3GJTA 3JQFA 3LUHA 3PQ3A 4EECA 4Q1DA 4YQZA 2IHNA 2A94A 2PKYX 4Q9HA 3AKYA 2NVWA 3T95A 1GRVA 3FCYA 3GFGA 5FXMA 3TLJA 2A9OA 2DT5A 1BX0A 1NVVR 5LDGA 4I9GA 5IPFA 3I5XA 3F71A 5A03A 4R2MA 1G0OA 1TM5E 2RB5A 2ODQA 3GWZA 4RHCA 1V2HE 3W79A 3U4AA 2VNIA 5C8DA 2RGYA 4QLAA 5JVDF 1XAHA 3ZVLA 3ASUA 2F8LA 3CH7A 4PLTA 4JX8A 5FPKA 2N75A 5FOVA 3E0XA 3JAKA 1ZP6A 5KNCD 3BTUA 3PQ5A 2YXLA 3PD1A 4KQJA 1IBKB 2QD4A 4CKWB 4O4HB 1WHTA 3PFKA 2QM0A 4ZYVA 1O6BA 2BLNA 2J8ZA 3BJMA 4I5EA 4RTPA 1QIIA 1NQTA 1Z5WA 221PA 2YWHA 1GN8A 1K4KA 2H4JA 3PA6A 4C30A 3J81k 1M0SA 3V46A 5EJ9A 2JFPA 2XQJA 1MAUA 2IU6A 2PWZA 3NU1A 5KOHA 2JFVA 1B73A 2VP3A 1UK6A 4TMYA 4P4GA 4YALA 2MSWA 2O59A 4O4IA 1NMSA 4UUPA 2ID7A 1JR3E 3SHQA 2VJNA 1U3FA 4UXIA 5KEIA 3H5NA 5IXJA 3G8YA 3BB1A 1RXSA 3U4IA 3RFUA 1KIFA 2V4ZA 2RAPA 1Z0AA 4QO8A 5IW8A 3WMFA 1UBLS 2P7HA 2I2BA 4P2BA 4AAYA 4B6PA 2IEBA 3PGMA 1VL0A 1GZUA 4Q7KA 4F56A 4PNEA 3RC8A 1M1YB 4L1KA 1CEQA 1KYQA 2GQ0A 2J0VA 4LOLA 5HS4A 3HKBA 3VA1A 1EK0A 2GVDC 2OP1A 1O0CA 3H7AA 1Z62A 3TFWA 3TI9A 1T4CB 3HCBA 4L16A 4YRQA 4URZR 1ULZA 4YWJA 1BROA 2VAXA 1R3UA 1NMXA 4KK3A 4UHHA 4AKIA 3EQ2A 4FS3A 4N8EA 4U7HA 4WLNA 4ARZA 4DR3B 1PCXA 5LP1A 1Q92A 1HQYE 1K3FA 3UFXB 3W2TA 5JBQA 3GUVA 3LTEA 3FMIA 2JLXA 1GTJ1 7ABPA 2TRSB 5HF6A 1GFZA 1PQWA 3QMMA 3WTBA 3OM9A 1YK0A 1TU4A 3CVUA 2VPZA 2QTNA 1ZK4A 3MTQA 4J0GA 3TINA 2E4AA 4LJ4A 2FHSA 1NNUA 3E3AA 4P98A 2W22A 3BSYA 1E2UA 1Y4ZA 2OZKA 5EG5A 4B35A 5CBKA 1UEXC 2HA0A 5U4XA 4DCSA 2IXTA 2Z8YM 1A0OA 1BQ4A 1I30A 3EUFA 4A2CA 1G8PA 2J9GA 5EJ7A 1O89A 2OQ2A 5FWDA 3RHFA 2QTRA 3CV3A 4ZICA 2LP4Y 5KAPA 3PLRA 4MI3A 2OHOA 1GQYA 1UWVA 4AP5A 3OWOA 3SKVA 4G81A 2H92A 2J6IA 3UWMA 1WHTB 4GI5A 3MRTA 3M6UA 2XUPA 3A77A 4N49A 1SC4A 3F7NA 3SNHA 2DXIA 1KTIA 1UHTA 3JVIA 3R9WA 1ND6A 3GJ3A 2H0RA 3PRJA 4KP7A 1SBQA 4RETA 4JZYA 3TAXA 1D5WA 3UB3A 3W06A 4DJFC 4MW4A 2R25B 1C5KA 5BRAA 2W6QA 4P4SB 2DPXA 5IRCD 3JS5A 3CMMA 1PRYA 2EKDA 4JH0A 5KNDA 2PM8A 3UK2A 3ZCTA 2Q7XA 2UZ1A 1SVIA 4AN4A 4DZZA 1J8VA 3PQ2A 3EGDB 1O4WA 2HU2A 3RYTC 1PR6A 3HSSA 2W71A 1AGYA 1TA4A 3OJFA 1L3BA 3PVZA 3TOCA 2VYFA 3SWWA 4PQYA 4DV7B 5JALA 3OEWA 1AF7A 2G9NA 1XEFA 4TXJA 1A04A 1E98A 3H4IA 3LCUA 1D7OA 4RVSA 1D6JA 3NOVA 1WMSA 4Q3AA 3ZU2A 3EXEB 2JAXA 3UT5A 5JH7F 5DCLA 4H2DA 5DTRA 3LYAA 3IQFA 3L7DA 1MQ9A 3N0TA 1FXWA 2PL1A 4HQOA 2NP7A 2IYXA 3KOZA 4XD2A 2DTXA 4CF3A 1IN8A 1I0ZA 5KQLA 3DDSA 1H6DA 3A4MA 4Q12A 4EIWA 1WSBA 1O9BA 3CNLA 3QI2A 1M8GA 3GYGA 4XCQA 1RAHA 2B1IA 2UUOA 3ESZA 2Z04A 1C41A 3WSTA 1RZRD 2D1TA 4YFVA 3D64A 3UNMA 3M7IA 4J76A 4BVBA 4RLSA 3FFTA 1CYEA 2EJVA 3QI7A 5F5NA 5CAEB 3VBCA 3BEOA 1X7GA 1X7WA 4GEKA 4KW7A 1OZAA 4EGSA 5JANA 5KYWB 1RS0A 1M8JA 4YR7A 4JXZA 4AY3A 1HDXA 1ZW6A 4KAAA 1Z6QA 2AW5A 2ZYIA 4AYTA 1PG2A 1TIKA 4LGVA 4B81A 3MQFA 3ZY5A 1ISRA 1BZYA 2ZSIA 1SXJA 4ZMRA 4M2LA 3UMFA 3Q2OA 3WWDA 1IE3A 5B64A 1OPXA 4ZTBA 3JQGA 1MABB 4PLVA 3LLVA 3D7LA 3DOCA 3HFJA 3BRCA 2H8GA 1D07A 2CXRA 4ZMSA 2VBGA 4OI2A 4GBJA 4XH9B 3PUKA 4N3GA 3ZCVA 1YR2A 3IKTA 4F2PA 3ROTA 1FPMA 1FNMA 1X7YA 2LR0A 4N0MA 3BCSA 3ITDA 4KXNA 5J1SB 3WYEA 1FDTA 1LBSA 3WS7A 4GI1A 2GBLA 1PD0A 2P27A 3L40A 3LK7A 3UUWA 3ZK7A 1J6UA 2L0XA 3TK1A 2AS0A 1C7IA 3CNQS 3QHAA 4KKVA 2AUMA 1WB6A 2FR1A 3RIXA 4YN3A 4DJAA 1MX5A 5AW4A 3LYUA 4BQEA 3VNSA 2V6JA 4HWPA 2I8LA 3L4SO 4TKVA 4I1OA 3KQUA 4E4RA 3ZHSA 3C15C 3LVRE 1JNXX 4BCBA 5KYYA 2Q41A 2H00A 2QE7D 3QX3A 3O84A 1GQSA 3TOXA 3AEYA 1S89A 2Y93A 1IBRA 4R8MA 4I50B 1JHOA 4NCKA 1E3EA 1KC3A 2J67A 3RBZA 1BE6A 3TQCA 2QYHA 3I83A 1ELOA 1NM5A 1X1CA 2VDKB 4Q3LA 2WC1A 2VTDA 4RJ2A 1W6RA 4UBKA 2XECA 5CA0B 2G9ZA 4K2HA 1N6HA 4M46A 1PV2A 4MARA 4HRAA 4BMPB 2R1UA 1W87A 1OIVA 3BGOS 3DXZA 2A0XA 4YRZA 2HMTA 3ZKAA 2F64A 1E1YA 2Z9DA 1A1SA 1JB9A 3COJA 3ZHBA 2UXBB 1HR0B 1JALA 3NV9A 3MTBA 1DADA 2V7BA 1ONNA 1H05A 2ENUA 3EGWA 3OZWA 1DKQA 5JFGA 1X8KA 1A2OA 4BVHA 4UDOA 1AN9A 3CEHA 4Q01A 5B2ZA 1QYCA 2YOGA 1FRZA 4BTEA 4TZTA 4B7XA 2WIJA 4RD2A 4B6FA 2PQ2A 4UBIA 1M1YE 3QELA 1HDGO 3KKOA 5F7XA 1TMGE 1EM6A 1WKCA 3DZKA 3QNMA 4DEVA 3AHDA 3I30X 4ZALA 2X77A 1LPAB 1Z5OA 3VO9A 4CIYA 1XR3A 3JQFC 4HATA 2HPZA 1U7TA 1UMDA 2CLIB 2OO7A 5I8WA 4DIBA 2R96A 1N2EA 4CLRA 3OQIA 5ALSA 3RVLA 3SSNA 1MO2A 4G0UA 1G20B 4J3FA 2ZBEA 1UOQA 4MS4B 4J0CA 5HIKA 5JZ9A 2ZJ0A 1HT2E 4ZVUA 4YS6A 4AYWA 4BXOB 3Q5DA 1RPNA 3WQSB 2GK4A 2SHKA 3TLEA 4BS9A 2Y92A 1B7GO 3F4KA 4MDFA 1FLNA 4L73A 1GZVA 4KMOA 2BP7B 5EZYA 2VF2A 4I14A 1G63A 2A9FA 1OI4A 3CRRA 3HWX1 4C14A 1RJ9B 1DINA 2VDWA 1TAQA 4UQOA 4FC7A 2XY4A 3QA9A 4C06A 4PRLA 2XCLA 1NKTA 3PYXA 5HCUA 5F9FA 3BG5A 3T0IA 1TF2A 1VSUA 4DUGA 4YRPA 2VDJA 2CDCA 3B1JA 2GFHA 2JAHA 1R9JA 2ZKLA 4C4SA 2W4IA 1L5RA 1XQ6A 1A69A 1Z4NA 1T8SA 3IS3A 3B8EA 2REBA 1T35A 1TUEA 4DUZB 5I5GA 2ZSEA 3E7WA 2FG5A 3PUVA 1CB7A 2RI1A 3BRSA 4ZO7A 1NVVQ 1ZJ5A 5HOQA 2DPHA 1PL0A 1L2TA 3WK6A 1ZJWA 4D8WA 2AKAB 3DLBA 2PY6A 4PLWA 1NPDA 5SYMA 1Z8FA 3VH1A 3ZEIA 5EXTA 1HTTA 2OECA 5JDCA 3RSGA 5AVRA 3RTAA 4BFXA 5AH0A 3TOVA 2YH2A 4MLDA 5BSHA 4LZOA 3GW8A 3KEFA 3I4LA 3CVVA 4AJLA 4AZ3B 3AK4A 4JI1B 4YMUA 1NI5A 1ISIA 1MB3A 2PKEA 2G1JA 3DEJA 4DG9A 3B5JA 4EP1A 5K6AC 5JEOA 1II8A 4NJEA 4ZCPA 3T5DA 5L7TA 2O8CB 1E18A 5EMMA 3U0BA 5JWHA 3CIOA 4PZAA 1U4NA 4KPEC 2FSIA 1YHYA 4I4NA 5BN3B 1G21A 1Q21A 1QTRA 4ALMA 3ZGOA 4CQLA 4U9HS 1NW9B 1RPJA 3KXPA 2O2IA 1QO0D 5JSHA 1F8XA 1V39A 1YVEI 2ATIA 1R6TA 2QSJA 4EGFA 5BMVB 1EIZA 1X9GA 4UU7A 1ZBDA 4H7PA 4LWPA 1PYGA 2KPOA 4OP2A 4B82A 4GSLA 1WV1A 2O2GA 3T34A 4LIPD 4WN3A 3JQAA 4BJ6A 5CH3A 1N9ZA 5I47A 1MHPA 1F5SA 5F1KA 5JE8A 1HE3A 2B21A 3ESDA 1SUFA 3F9RA 3HKCB 4DCOA 4E13A 3LMKA 3TSAA 4WBSA 3H42B 1KEPA 3NC0C 5CNKA 4D56A 2ZK7A 3L8CA 3CLRC 4H7EA 3OX3A 4MITA 2BUAA 5F23A 5LQAA 2D13A 2Q3HA 3K0BA 2BFDA 1LNSA 3BMCA 3I2KA 3CJRA 4AJ2A 2MWMA 3H1AA 3P71T 1XELA 3KJNA 4ZYYA 5GJVC 2DG2A 1Z2PX 2ACWA 2DBZA 2ZSUA 1ZDMA 2CSWA 3BDIA 3C3KA 1QCCA 5NLLA 4Q9AA 4YRAA 3C74A 4C0HA 2AI1A 2JDIA 4GRIA 3OFJA 4LRUA 8ADHA 4I1SA 5HRAA 1ZL2A 2AK3A 2EFYA 2I55A 3U4QB 1A9XA 5ITWA 2VF7A 4ITVA 1UPBA 5F76A 4PLHA 5LIRA 4FR0A 3DYBA 1DG1G 4D4KA 1CUUA 1JEDA 2KX7A 1MC5A 4UOEA 4QARA 3TN7A 3PE3A 2HCRA 1U9CA 4QU9A 3JD0A 2Q4RA 2Z8ZA 4XJSA 2HD4A 5FOSA 4CU2A 4NJOA 2PX3A 4LVUA 4FWIB 5CA1F 4G0MA 3PNBA 4G2SA 3VXKA 1O4VA 3DHEA 4JLBA 4OIFA 4R0VA 4WECA 2FXVA 1C8BA 3ETLA 5KYUA 1YMUA 1SVLA 1NUPA 3D5QA 3OCYA 1GRCA 2P2CA 2P2SA 4WLUA 3MJRA 2C04A 3W9BA 1FFEA 2Q28A 3HVJA 4J16A 2B4YA 1IQUA 1J5PA 1WF6A 3FB4A 4CG0A 4CRWB 1JQDA 2D5BA 4Y9SA 4BNDA 2W6CX 1YRQA 2NIPA 4BLPA 1L3CA 3OM8A 5DCYA 2Y1CA 1K8YB 2J1LA 5GJWC 4C89A 4DPLA 1YFZA 1KJJA 3O8QA 2YJ5A 3V1YA 1QHNA 3O8RA 4LSWA 2NPFA 1LRKA 3D3NA 1KI1A 3E84A 1GZ5A 5EP1A 2QL9A 4HQNA 5JR3A 2XMSA 4Q9KA 5AJVB 2WD7B 2HQBA 2VP9A 4DMCA 3WVNA 1RM3A 4EFMA 3AINA 4WKNA 2ZIEA 2XCRB 1IRIA 1UKAA 3IPYA 5E6RA 5EP2A 3ZVKA 3N2EA 3WX0A 3KSZO 4NZPA 4ALJA 1EA5A 2V96A 3IAAA 3VTKA 3C3XA 3OX4A 1I8TA 2JGAA 5A06A 1KZ6A 1JH8A 1GL3A 2GPJA 3DZDA 4WLEA 1RIIA 2IHZA 1RWMA 1ZYUA 4D45A 4YRTA 2UXDB 3KCNA 4RVFA 4DIMA 3KZXA 1ZWKA 4J8PA 3VPSA 1K75A 2NU9A 4GU5A 5LCXA 3SHTA 1D09A 3UPDA 3VR5A 3Q8LA 1ZKMA 2AC7A 4GO1A 4QEKA 5JSUA 3ZW9A 2EJCA 1Z0FA 3DFUA 4XAQA 1K3UB 1I2ZA 2B6NA 3T1QA 4JSYA 1YGYA 2B5OA 4Q3CA 2EX1A 2XIJA 5A3JA 2W2VA 4OV6B 2B69A 3TAHA 4WOJA 4Y1RB 2Z57A 2ACVA 5ALYA 4RTNA 2CYBA 1KKUA 3HXTA 1B1CA 3PU6A 4F8EA 2VDVE 1PLLA 2VAPA 2VAWA 4HMPA 2JQLA 2X3UA 1GTVA 4KLCA 4R7TA 1C3OA 2IKQA 1Z4OA 1OU0A 4ND5A 3EUAA 1QGED 2H11A 4PINA 5DHAA 5DT2A 3ACDA 1KIMA 5FPSA 3O0TA 5EQJB 1HG0A 4BKMA 2NADA 3QU5A 2NSHA 4LDQA 1VA4A 2REQB 4QUIA 3WNBA 1JBKA 3BIOA 3FW1A 4WZAB 4GE3A 1HLPA 2RHWA 4OYYA 3WGZA 5H3CA 1HBJA 5LZ4A 1N6RA 2OKCA 4LNUA 1UBHS 4IFBA 1KI6B 2M9MA 1AN0A 1FSGA 2VA9A 2I2AA 3PGXA 4PLGA 3W3AH 2Y2UA 4ARZB 2VPPA 4IILA 4W5JA 2V4MA 1FMCA 3V7NA 1N75A 1NN1A 1WDMA 4IJKA 4IIYA 1R4MA 4X7PA 5AHOA 1NZDA 3K09C 4XKJA 2WSMA 3R5FA 5TC4A 4D7AA 3P0HA 1R0KA 4F2DA 3PENA 4RV5A 3QMWA 1H8EA 2BKAA 4ZT6A 1LGQA 5BMOA 2YWBA 3OZAA 3AM3A 3IAHA 3QRWA 2OENG 1NSFA 1AT1A 3DZJA 1LRJA 4JBIA 3UCXA 5CFOA 1W0KA 1TO2E 4MQBA 4NEGA 1T5BA 3QVSA 4C1NA 4AS2A 1CUDA 1Y8RB 3CN9A 2Y9MB 4RVCA 1GILA 1K0FA 1QYRA 1F8UA 4FCCA 4GVXA 2OYCA 2F1HA 4XR9A 1L6RA 1NP3A 5ADWA 3AR3A 4MW5A 4OP1A 1DRKA 3TLYA 2E9SA 4C0QC 5C1BA 1FP6A 4QLOA 3C1AA 5FUMA 1D2EA 3UAYA 1DWPA 2DFTA 1A7KA 1AUOA 3QMPA 4ND2A 2O6HA 1G42A 5F9HA 4J7UA 4ND4A 2O19A 3M5WA 4L22A 2FAXA 3H5WA 4JHXA 1SFRA 1CY1A 1E1RD 1KPHA 4H59A 1JG6A 1T9GR 3C8HA 1NMZA 1U5AA 2EEZA 4ZQGA 2DQSA 3KG2A 3RS5A 1NXTA 5KX5B 2QTLA 2CXQA 2IYVA 3N6VA 2QUKA 2FW7A 4LVOA 2J41A 2WKPA 3TKAA 1GFSA 1XALA 3WY9A 4FMBB 3JQPA 3BD8A 3GWGA 3QUBA 4FEYA 2LKDA 4IX9A 5HE9A 4BFLA 2EZ9A 3ROGA 5FB3A 3AHEA 4RF2A 3ZLTA 2DUMA 3GPLA 3UK0A 4ZVLA 1CPYA 2BDTA 3Q41A 1OLXB 2FVXA 2VQ3A 2VPXA 3RRFA 2YWXA 1YMQA 4OGWA 4EL0A 1GAQA 3RYCB 3L18A 2PSFA 5C8ZA 3REOA 3HMQA 4XVUA 3ZU5A 3CZPA 3PK0A 1QP8A 4RLHA 2FW8A 1YR7A 3DUFA 5BQFA 3QA3E 2DP4E 4MVJA 4INJA 4EABA 3IV9A 4JMLA 4U4AA 1VE7A 2DWPA 6REQB 2ORYA 2VPQA 2XODA 5E0OA 4LGYA 2ILVA 3TIGA 2PJRA 1QWSA 3L4KA 4A8JC 2L69A 5HRCA 3DCIA 3MNFA 2OORA 2GPTA 3LBIA 5LU9A 4IM7A 5BSRA 2BFEA 2IPAB 4E32A 1JAIA 4OY3A 2ZT8A 3OF2A 3GNTA 5C81A 3M5CA 2HNAA 3KEGA 1E79A 1USGA 2OGUA 1Z15A 2EJBA 5HKOA 3T1YB 2BUBA 4KE7A 1J4LA 4JEMA 3GPIA 4PHCA 2J4DA 2I8AA 4I4TF 3V6LA 3K0CC 2GBCA 4RBNA 2XB6A 3LUJA 3QVMA 3D6MA 2KBEA 4OHYA 3HSYA 1ACLA 2IGTA 1B3RA 3FHTA 1Y8QB 2NM0A 2SCUA 3LUPA 5AI0A 3U3RA 5LKAA 2D0DA 4DA4A 1PVOA 1F51E 4MS1A 1N78A 2FMIA 1SBTA 1BOFA 3PFCA 2PO7A 3CUVA 4ZVQA 2GYUA 1P9LA 2Q46A 2RHTA 2XI4A 3Q87B 4MV9A 3TTXA 2JNWA 4U2EA 2W43A 4BNLA 4YQEA 3C6QA 1OYWA 4R51A 1RZVA 3L4BC 3COVA 3S1LA 4JYPA 2IZ6A 3P7MA 4EY3A 2PUTA 5CLFA 4KPUA 1M2HA 3EUEA 3ZLBA 3PKIA 4RZXA 4DBLE 1ZOLA 2BKEA 1MVLA 5AM1A 5HM8A 3S29A 4X63A 2MSKA 2VCHA 2G7ZA 4JSTA 1RVV1 1CJBA 3B1VA 2WJYA 2HJHA 3EFEA 4WK2B 3KE8A 4QSHA 4LJRA 1MU0A 2DHEA 2G67A 1R5BA 3D2CA 3LDUA 1P7WA 4HH1A 2WIGA 4REOA 1J09A 3PHBE 1N5DA 1Y63A 3JVEA 4R9NA 2LCQA 4BX0A 1CR4A 3DE5X 4JJZA 2GZDA 2IIBA 3SMQA 2C03A 2CK3D 4Z1MD 1LZLA 2J6HA 4NBNA 3FCXA 4LOKA 4LJ5A 4MS3B 4F12A 4XVCA 4IQ8A 2WJZB 3PITA 1DG9A 2E4WA 1DJLA 4YCNA 2YV1A 1M6EX 1W4ZA 2G0TA 3AHCA 2KBFA 1EUDB 3OA0A 1QTNA 2LZ0A 4JL6A 2A92A 4MUHA 1FRVA 3D54D 1WVIA 4OHUA 4CPDA 4TWZA 3KHTA 3QEKA 1HX7A 2HRRA 2SICE 3KR1A 4HYTA 4FN4A 3CXUA 1VLLA 4O8ZA 4XW2A 3RAPR 1P39A 2OWEA 4PC3A 1COZA 1YZGA 2C5AA 1ZVJA 1G4UR 3BFXA 1VB5A 3ESBA 1RCFA 2Y1KA 5ER9A 3A3YA 5JCOA 3LWNA 4XWGA 4QRIA 4ZHSA 1GAEO 2GKSA 3OJEA 3C3WA 4IR7A 3DMRA 4ZOLF 1XIVA 5KYKA 1IFXA 5AVSA 4D9FA 4EKEA 3SQWA 3AYZB 1YRYE 3M1AA 1VIVA 2YCBA 3X1JA 1V8FA 5B6JA 2B34A 3OTWA 1WOYA 3O8OA 4W9MC 1RJ9A 1Y5MA 2VDWB 2DUJA 4GNRA 5LR6A 1HETA 2ZSDA 4HDRA 1XNRB 4I8IA 3ONNA 4LHYA 1NVDA 4R2IA 3NDBB 1GZ7A 3ELBA 2ZJAA 4TSFA 1LA2A 3DS8A 1CJMA 2FSGA 1XV5A 2WR8A 1AE1A 2ZW9A 2AW3A 1QQ6A 2W6ZA 1UOPA 4G85A 2ANCA 4GI7A 1L5NA 3PWZA 3RRXA 1R50A 1YHNA 4BXOA 5JERA 4WZBB 5AJWA 2CFIA 3SX2A 3GJRA 4TVBA 4OA5A 2XIQA 4QDXA 5AICA 4Z53A 3HWSA 4X93A 4CIDA 3M4JA 2F1JA 1PJLA 3B3GA 2CK3A 1J8QA 3P0JA 1SAYA 4UCFA 1V6SA 4Z1MA 3BGDA 3L79A 4BDTA 3DWEX 2RI0A 3U6BA 4TM7A 3HXMA 4JC0A 4UUMA 1U7PA 3L0ZA 5J63A 2G3YA 2IXBA 2UDPA 3DT8A 3FROA 3I61A 3M83A 1JEOA 2GXUA 3PXBA 3A6KA 3D4LA 3VPDA 2D54A 1MJGA 2B4TO 2WPDA 1HDRA 3QW2A 1LSSA 4AP6A 3K73O 4C0JA 4MUNA 4F6CA 3I9JA 4WA8A 4ZK6A 3ZDBA 2ZPAA 3K9GA 5BQ5A 1MA0A 4OBEA 2ZBDA 1LXCA 5DRYA 4ENUA 1JFFB 1KZ4A 1G17A 2YV3A 3D4NA 5B58T 2HMVA 4YAUA 3DEZA 2H1WA 1GUBA 3QWAA 5FEUA 2W6PA 3MLAA 3BICA 3P32A 1YZNA 3PO8A 1NGSA 4AU1A 5M5BA 4DPKA 4L8YA 5JZMA 3PCTA 3M3DA 1XPOA 3DMTA 2PS3A 4QELA 2G1AA 4PG8A 3GLRA 1HOTA 5BQOA 3BX1A 3DVSX 4JJ6A 4RULA 2D0OB 1E2DA 1SCBA 4YJKA 4O4LB 4MWEA 1YS2X 3WK9A 3K05A 2WG2A 3ZD8A 2NSLA 1BE8A 4YDRA 1A7UA 1Y1KE 1ZNXA 4J1SA 2NO0A 5GMOA 5C5CA 3U7RA 3H6KA 3OOJA 5DNCA 5JH7A 4M1QA 5A4DA 3NJ8A 5THKA 3F73A 3F2IA 1QZ3A 2XVMA 4Q9NA 1MIOB 4ZAFA 2C88A 2QTMA 3K6SB 1ZK2A 3PTZA 4EB6B 1OASA 3VKVA 4AMUA 5JC8A 2C7GA 1BW9A 1GQRA 3MK31 4QT0A 1U9JA 1XX6A 4IUYA 5BN4A 4KO3S 1TLTA 3NX4A 4UTVA 3TIIA 5IKXA 4YRDA 4CMAA 2J3JA 3V4VB 4DIDA 1CP3A 4V24A 2BBWA 3ED5A 4GOXA 3RUFA 1BWQA 1DX6A 3O7WA 4JLPA 1DEXA 3GRVA 4YRFA 1R4NA 4IIDA 5HZGA 3W2EA 4AQYB 3DG9A 3TLKA 1D9XA 1M6HA 1DJNA 1O96A 4BO8A 4J0DA 1DDGA 1J9EA 1I33A 1QTIA 4QT4A 1E20A 4IIXA 4LECA 2A0YA 2PQ6A 4GZMA 3EAGA 4U2FA 5DBGA 3UPUA 3VH2A 3I92A 1WXXA 1T3TA 1J22A 1UPAA 2R6CA 2ZAGA 3BMOB 1V3QE 1EXDA 1QWOA 4TVKA 1XCOA 3DZHA 2J3EA 1NLFA 1E0KA 1XNHA 3ZU3A 2X2EA 1N3BA 3CVWA 2W8BB 1RTTA 2E2WA 4N54A 4NRDA 2DCUA 4A26A 1OLOA 1IBCA 1K5HA 5E7MA 4KQHA 5CLJA 3QHPA 1SRQA 4KIFA 4XLTA 5D3MB 4FGJA 3SHFA 5KVSA 2VQFB 2IUTA 1ABFA 1XTJA 2ALJA 2R6FA 2X5JO 3L49A 1FQOA 2GSWA 1RLIA 3G89A 1RWPA 1B8OA 1JEEA 1O94A 2IXEA 5HF9A 3OOWA 1XKTA 3F3SA 4P08A 3HI6A 5JD4A 3G2NA 1ECCA 3R3YA 1YIDA 4ISCA 2ZYTX 4JJEA 3ROZA 4LCJA 5KINB 3IKJA 3FCUB 4KC0A 1ZA1A 2PMFA 1ADJA 2PWBA 1DL5A 3JRXA 4MAAA 4LZJA 1XTKA 2QAGB 3PUWA 3UOGA 4PFKA 1HE2A 2B8TA 2SNIE 3ANMA 2O7RA 4F92B 1QCDA 2Y8EA 4L57A 4TVOA 1EX7A 5ICGA 1V1RB 5KYTA 4K03A 4M9ZA 3RYHB 4GLJA 4UZSA 1NXSA 4IIVA 3FSGA 1D4ZA 5HDQA 1SHLA 2ZWMA 1ORWA 5G53C 4E6EA 1RE0A 2WNSA 3EY4A 4MWBA 3MAAC 4AJ9A 5AUNB 2ZRNA 1XWFA 2FPLA 2I6UA 3SYLA 2BSQA 1U04A 3DMYA 4CQLB 3QPBA 4Y6LA 3V4SA 3Q0IA 4RXUA 1FRQA 3FA2A 5E7JA 1UBJS 2XGOA 2GPNA 3ESXA 2BBSA 4CL3A 3SJBA 1EXNA 4LN1A 3P2EA 3FYUC 4FHGA 4OQYA 3GLSA 2IKSA 1XKLA 2GRAA 5BVIA 2VCEA 3TPZA 5JW6A 2KJQA 3JTEA 4RKYA 3AGQA 5JAUA 1FYDA 3WGTA 1O0SA 4CEJA 3I4CA 3U26A 3CLHA 4AJ4A 2HRQA 3GLQA 3VZQA 4E6PA 3RSHA 2DSTA 1QK4A 1XMQB 3WIUA 3PIIA 2X8JA 2P2LA 1F6WA 3DYIA 3H86A 1GQ2A 1P9WA 4PVCA 4JP3A 1XJCA 2ZBUA 4IS2A 4JOQA 3WYFA 3G2KA 1U98A 2QN1A 3FMOB 2DWOA 4LGCA 3I6BA 4FCWA 4LQDA 3JSAA 4ZQCB 2K4MA 3TDKA 3AF5A 2N0SA 2XDYA 1B8NA 3UK6A 1KVRA 1JXQA 1PT8A 1QLHA 2QJTA 1K4MA 3UK1A 3Q7RA 3KWJA 1DIRA 1SWWA 2Q3LA 3NI2A 2HF2A 1NR7A 1WA5A 3DO5A 3LHKA 1QKIA 4DYDA 4REQB 3O1JC 4FZ3A 4GPTA 4ZO6A 1TJ5A 3OZUA 4BMDA 3WSVA 2R9VA 2NU7B 1IEWA 3HUEA 2V6MA 1WQ3A 2QE7A 5CEEA 3T3MB 1G8GA 4DF3A 1XPRA 3LIPA 2XZPA 4NU0A 4HWGA 1W85A 1PDWA 1MVOA 5G1OA 4KVAA 2FFJA 4YAKA 2ZSBA 2X7JA 2VWGA 3OECA 5C34B 1EJ2A 1AK1A 2H63A 1JQEA 2X0EA 2F8MA 1EDZA 1JHZA 3OPYA 2ZTHA 3B53X 4KLNA 4KPGA 4GGMX 4B5LA 3B70A 4PAOA 4MI6A 1ZJYA 4DCGA 2BEUB 1BYIA 1J8YF 1GPBA 2ZBPA 2VZ9A 4V1CB 1ZRHA 5D5QA 4KGXA 3RC2A 1U6JA 4QYWA 1VG8A 1CQJB 4OSPA 2E1PA 4PLZA 2QLTA 4D4GA 3OTHA 2P3QA 1BCSB 5E1OA 2V1XA 4OQZA 3N5KA 3KKPA 3ZTWA 2PX5A 3R77A 2HU5A 4R01A 4WL0A 1ZJ4A 3U3ZA 3IXMA 4N6GA 3UC5A 1KR5A 2BHTA 1NNSA 1I51A 4MYRA 4W8GA 1FJXA 2A8YA 2EHJA 4OIMA 1H5NA 1DI0A 5BRJA 1TZCA 3FFWA 4RACA 1CVLA 3OOHA 4N7MA 4KXXA 4Q05A 4IV0A 3FNBA 3IHTA 3VHXA 2ZG6A 2G1KA 1M74A 3EZYA 1ARZA 3CZQA 4JXJA 1E59A 5DPMA 3VU1A 4C7KA 4XM0A 3IDFA 3G17A 3MYRA 3MTDA 5JNTA 2C7OA 4WOKA 1E69A 4HAWA 2JH8A 2X6TA 2WFZA 4DILA 5JJBA 1HDCA 2G17A 3BF8A 5AUPB 1CZOA 1QDLB 1AQNA 1Y3HA 2CVOA 3L46A 4TTQA 2CD9A 2HL6A 3H1GA 2I6TA 1LVHA 1JEYA 5A71A 1DAOA 4ALLA 1EIWA 1E5TA 1EHCA 4B2LA 3BHIA 2Q3DA 2XYHA 4EPTA 4Z3KA 3SDBA 5K8IA 3GGJA 3LI2A 3D6HA 3SZLA 1MDFA 2F00A 2OE2A 2VJDA 1RM4A 4FINA 2MSLA 4UUNA 1LKZA 5DTJA 5FA8A 1AGRA 1TIBA 2E4YA 2IOFK 4QHSA 2D2XA 2YZNA 1N2HA 1DTSA 2IF2A 1L9XA 2B9VA 2G4CA 4PY2A 5FBZA 3TZKA 2O7QA 1OAAA 2WYHA 2W2LD 4G1EB 2P77A 5FAXA 3ZCRA 3EGOA 3LKVA 1WKBA 4ND7A 1G16A 3A4IA 3QPUA 4MPDA 1HUQA 4QDJA 3V32A 4J0HA 1RT9A 3G0CA 5FBVB 2B4KA 4MULA 4JONA 1VLHA 3NM6B 2Q5HA 2R85A 1P9OA 1DUSA 1QYXA 3SLGA 2F4VB 2FLWA 4FFRA 4UZFA 1YDWA 4UC0A 3F6PA 4H18A 2WHRA 3FH0A 5HQJA 1JWAB 3CVYA 1QIGA 2CVHA 3V9AA 3V8NA 3EH2A 3FPEA 4CHTA 3HJCA 3K0AB 1PK7A 3MXTA 4ZU1X 4ENVA 3FY4A 3NEJA 3M6AA 4E4TA 1CY0A 3HDYA 4H77A 2EWVA 1DOAA 2XHEA 1CJKC 1CZKA 3HO6A 4L5BA 1TU0A 1DO8A 2Q0QA 3GG9A 1QONA 5DYTA 1LBIA 2GNPA 5GONF 3SYRA 1TPYA 2PA3A 1DDOA 2J30A 3K94A 1OIXA 3N7UA 5I7EA 1S2MA 5LWHA 4P7FA 5IVIA 2PYZA 4BX9A 2XX3A 1PUXA 1QVZA 4F6LA 5AJYA 3SOPA 5HJEA 5EZYF 3M4NA 3IT2A 2HQ1A 3BRWA 2ZUDA 4DG5A 7REQB 3AG5A 3CF0A 1MJHA 4MV1A 5LMNB 2YFYA 1QQBA 3KJGA 1BTOA 1XTSA 1G66A 3UQYS 4WCFC 1G9XA 3T7AA 5HKBA 3U44B 2ZU6A 3MJFA 4G56A 2Q1XA 4MH0R 1CC1S 1JXMA 5U9CA 2VP5A 4X1OA 3O3OB 2WIFA 3AY3A 5MFPA 2VT6A 1TYBE 2I6FA 5CT5A 1F8FA 4YGXB 4KQ9A 2FWBA 1B42A 4GR4A 5CMLA 3LX6A 2P0EA 1X8JA 2B7BA 4J0IA 3SXJA 5IT0A 2C1XA 1V4VA 1XTTA 4JHLA 1ZR4A 3H1BA 4FSXA 1J2UA 3AJEA 1DIHA 3E3LA 1UBGA 3DEHA 1E1LA 4CM1A 2DVMA 3HDJA 2XYQA 2PBFA 4L15A 4KMRA 1W44A 1ENOA 4X7MA 1YWGO 5B2FA 2UUAB 3ZI4A 5H3LA 3I53A 1RABA 4AJHA 1NE7A 4MHOA 4TTAA 1KAEA 1XTBA 1TFUA 2OHIA 3EWNA 1L1EA 5A9TA 1FTQA 1Y9AA 5GZ6A 1E9VA 2LIVA 2Z6AA 1M3SA 5F2OA 3OQHA 3FKQA 3CX6A 1Z4KA 4RSMA 5FI0B 3R9XB 4NFYA 4QBKA 5BVHB 1X9IA 1MTZA 4AF7A 4L7VA 1RMTA 3HLTA 3KB1A 5BXQC 4O1HA 2AN9A 4LA4A 3PTLA 1GL7A 4M0PA 4MKXA 2FUNB 2OORC 4L85A 1HDZA 1ENZA 3PEUA 4YJHB 4CDMA 1GPLA 1YAHA 1OFHA 3Q8WA 1S9HA 4ZCSA 2TS1A 2FEOA 4KQWA 5FHRA 1U7FA 5IJAA 4JUAA 4BL5A 4HZUA 3LQ2A 4GM4A 3LRXA 3MWKA 4R3WA 1TLFA 2GH1A 1XMXA 3W8FA 2NZVG 2XE7A 2PJDA 1TPZA 2DTEA 2VQSA 4OX9B 5IM5A 4Z4GA 1I2DA 4ADSG 5JJKA 2AFHA 2AX3A 4LJ7A 3UHOA 1G3UA 4DR7B 4TMVA 1CEEA 2XKJE 2OY0A 4BEWA 3KALA 1OD6A 1RE1A 4MJ7A 2A0WA 2WE8A 5EZ6B 3MOIA 4KBFA 1BWRA 4ND8A 2HGZA 2DSNA 2OHVA 2QR3A 2ZB3A 4MMXB 4D46A 4DT1B 5B30A 3OURA 4Q1CA 5B36A 5AVQA 2FF7A 3C3YA 4MVJF 1IH8A 1BA3A 4GF5A 4BQPA 1G5PA 1DU4A 2QT0A 1IOLA 3RD5A 3N2LA 1FXSA 1D5CA 1LV8A 1RWOA 1JZTA 2PS1A 4N5MA 3UF0A 4B3IA 3GA0A 1GPAA 1Z2OX 5EIBD 4URVR 5JPDA 1M1UA 4FYWA 1FDWA 4NDNE 4RQBA 4D74A 3AB8A 4RDXA 4JUIA 1B6RA 1GL6A 4PC7A 4P33A 1ZMXA 3BWBA 1TGVA 5GPBA 4M1YA 4BO6A 2A7QA 4BZPA 4MB0A 3BFVA 5JEJA 4C76A 5LP6B 3W3AA 1HH4A 4YRMA 2K7ZA 5BQ3A 2D3TA 2DWCA 2KMLA 1A5AB 5F7OA 1NLMA 1HV8A 2WTAA 3ES9A 3ZN2A 3BXOA 1XJWA 2OCGA 1SELA 2PZEA 1C4KA 5FL3A 1WU8A 3H11A 3KWFA 4AJ1A 5C46F 4O5OA 1QTQA 1YQDA 1KMNA 2APJA 5HIMA 4ZDIA 2Q49A 4OTZA 3WAKA 3IUPA 1JPUA 2J5QA 5IX8A 2E55A 5LD2B 2EHDA 2HLHA 1PWZA 3E53A 4BV9A 4X66B 1MK2A 2O8EA 2FCAA 3C2QA 1W5BA 3HJNA 4PXYA 3TCKA 1B00A 1NW8A 1XA0A 4GH5A 3TLGB 4DZTA 1MC8A 3FWHA 4Q4LA 2JPEA 2WNIA 4QPNA 5HYVA 1SHUX 1VKZA 1UH5A 3L01A 4JAVC 2P35A 2P9JA 3CR8A 1OXKB 3QUCA 2CD7A 3UBMA 4D1YA 3GD7A 3DKVA 1ZXLA 3F67A 3FPBA 1ECPA 1F8GA 3BGWA 1K5PA 5AHRA 3EGDA 4IKEA 1F0KA 1IM5A 2PAAA 2X42A 4TMZA 5H82A 2YICA 5CYOA 3HU1A 3T5GA 1RNLA 2PNFA 2AG8A 4DLWA 1V6CA 3S3TA 4O4LA 3PQEA 4OOEA 4KOEC 4EHIA 4N5IX 3ZKWA 1AZSC 1LCIA 3S99A 1UKEA 4F2WA 5LQRA 3VSCA 2WLTA 4YMVA 3B5IA 3EDYA 2RAUA 3NJRA 5HUHA 5KYWA 1RLUA 2CL5A 5FV4A 1EXVA 1J1UA 1WHSA 1P33A 4KBGA 3W5IA 1KDTA 4YRJA 1SUCA 4RCYA 5AIAA 1P29A 2L42A 3DTNA 4DNOA 4M22A 4GVLA 1G8SA 4ER6A 4GOND 4Z6KA 2GZ1A 3KKKA 4Q7JB 5FA5A 2D6FA 4X97A 1YKFA 1N2GA 2XBUA 4F3KA 5IKEA 2GPWA 3AFHA 1JKXA 3ET5A 3MMPA 2JHPA 4JT9A 1PJBA 4LY0A 3HABA 4M7RA 4KNWA 3NR2A 1ECFA 3OE4A 2DFDA 1N34B 3LZDA 3A4YA 3GBSA 1B6TA 2NXEA 3RUPA 1Z5UA 4BNHA 4RW0A 3JD2A 1NJ2A 5DTEA 1KPIA 1TQ6A 4XARA 3TIVA 3W2HA 5BW4A 1T9AA 1Q2UA 2BZ1A 1PDOA 5DM0A 5GONA 3ELSA 2XMCA 5COQA 3J7AC 1Z06A 3T3PB 2YUIA 4N6OA 4OHZA 3TEFA 1HZZA 9ATCA 3TTVA 5CCBA 4NU5A 4WXMA 4BB5A 2BM0A 1WDTA 2G5GX 3ZWQA 4DMUB 2EW8A 4KIWA 3HSKA 5TMDA 3MCTA 3AW9A 4FILA 4NONA 3K2EA 3HXQA 1BHJA 1J56A 1LVUA 3GGGA 5E7QA 4N18A 3K96A 1E2MA 4CZ2A 1Y5RA 3WGUA 4WZ6A 1EUQA 1Z4PX 1T4BA 3BKWA 3LHDA 4IHJA 4O2BF 3WZ2A 4C4RA 4AG5A 1U5BB 2BGIA 4AO6A 3GUCA 3Q5EA 2NN3C 4NK4A 1U9ZA 3BULA 4BRUA 2PL9A 4LOHA 4GKJB 4HG2A 4N47A 3MELA 3DMTC 1YBVA 1VHQA 2Z1NA 4G0VA 5DNEA 1H9BA 1GDDA 3BD6A 5D5PA 1P8AA 3V6MA 4H1TA 2PDAA 2QTGA 4B47A 4QJ3A 4LCEA 1J4QA 1WBBA 2UXCB 3T3NA 1KIAA 2AIRA 3UKOA 3K35A 1I01A 1Z2DA 1W47A 2YVUA 3OOSA 2UVPB 3D3WA 4ZGWA 1O5TA 4KSBA 2ORED 3V8MA 3EFOB 2EJTA 4LOJA 1LBQA 3GVXA 4Z3OA 1GDTA 4P4UA 1IY1A 1J90A 4QQ8A 1YI1A 5TT1A 2OG1A 4L3VA 4M49A 5CVEA 3SR3A 1QIFA 4NQRA 1BDJA 3OQ1A 2AFIE 1M2FA 3SQDA 5LMCA 3DM5A 1VDZA 4O2BB 3RQSA 4GYYA 3HY3A 4K9OA 3JYLA 2C1ZA 3BXHA 2QN2A 4TYYA 4YMHA 4ENQA 1V5IA 4HGRA 2IYNA 4LYAA 3RYFA 1FP2A 1BRMA 1M54A 3AL3A 1Q0RA 3RCBA 1HKHA 1XB2A 1NIPA 2FXIA 1Z75A 3E7XA 1HDEA 3T3GA 3CPEA 3MWFA 1AH2A 1RHMA 5JVDA 5M04A 3KSBC 1SCQA 3M49A 3BMQA 2PCJA 2OLJA 4TMFA 5F3DA 4CYMA 1EAYA 2FQ1A 2F7SA 2FZ4A 5KNBD 1E6EA 2ZIVB 4QYIA 3OPYI 5LIPA 3Q85A 1NG9A 4OHWA 3ML1A 4ZV9A 1CUJA 4CV3A 4DQXA 1WEHA 5K3CA 3PX2A 5GOTA 1P6XA 3E35A 3KQOA 2Q1TA 4Y6OA 1VL2A 4N39A 2Q4BA 4FMDF 4QU8A 5LYJA 1F0PA 3Q9SA 2ZCVA 421PA 3I12A 2HK9A 1WXGA 1ZM7A 5JMWA 2G0NA 2JJ1D 1IWOA 2CBXA 3H6GA 4PWYA 2QTHA 1OILA 2E7ZA 4MSUA 4FYXA 3AFMA 4FU0A 2ZTMA 3N7AA 2Z9BA 1MOSA 4LXXA 4E46A 3AUAA 3DHNA 5HG0A 3EYAA 4G8JA 3IBYA 3KQYA 2P90A 4YJHA 1ZM2A 4GSYA 2GJ8A 1JSRA 1FUEA 4M7PA 4QRHA 2VZ0A 3DVLA 3ICVA 3R76A 3T38A 5KJCA 3L1JA 3IPCA 1EM8B 4B3FX 5HKKD 4RTRA 3MGBA 3CT4A 1L5VA 1M2KA 2W58A 1O7JA 3QYFA 5J2UB 3SPXA 4Q19A 3TTUA 1IHOA 2ZE8A 3UUEA 1OI7A 3NJ4A 4OUDA 5TMPA 1ZNYA 1WLSA 1A4RA 2Y3IA 1Z74A 2P30A 3V34A 3KE9A 3KDAA 3A6ZA 1SCUB 2HLDD 2XOKA 1I7DA 4BFTA 2Q7OE 3CURA 3KZVA 1I3KA 2IW3A 1V48A 4R83A 4AZ0B 2JIZD 1NVGA 2VDLB 3EWIA 4M6WA 4DA7A 4AY6A 2CZCA 3VNQA 2GD6A 2OMEA 1U90A 1M8KA 721PA 3GLIE 2H7CA 4FN5A 3GLHB 1X74A 5EJ4A 4ER3A 4IL5A 3EQ9A 5FWAA 2WWIA 1ZPDA 2F43B 2QN7A 2FP3A 4CMHA 3KS9A 2AEMA 1E3QA 2BONA 4ZYLA 1W0JA 2HJVA 3D7NA 3A25A 3QM1A 4GYWA 4HFMA 2WWFA 2P5SA 5JZSA 1ZNWA 3JZMA 3GMTA 3JQAB 1YC2A 3AZOA 2OCDA 1T2AA 4RFLA 3DKKA 4G0ZA 2JF0A 3VKFA 2PKQO 3TSOA 5AJXA 4F2GA 3IAS6 1KEWA 2QTAA 2ZYHA 3HYNA 4MYSA 4XYMA 2CNKA 4ALIA 2W6JA 1T25A 3Q3GE 2R6DA 3O90A 1B8UA 3FETA 3STXA 1J4KA 3VO1A 1W36B 2HHCA 1J9ZA 1QHYA 4YAOA 4ESEA 1WUHS 2DHCA 2BY4A 2ICAA 1SD5A 1ESEA 2VRNA 2HMAA 3NEYA 2IHTA 3NNSA 3PXUA 5EC8A 1Y8CA 3VAZA 3O83A 1A4XA 1PNOA 3LZ6A 1IEXA 4NNJA 3T5AA 5TQ2B 4KXWA 3SYKA 2EBUA 3RU7A 3C7TA 4KITB 2HHLA 1MT0A 3LAWA 4Q03A 2VHVA 3HCNA 1XZDA 1FS5A 1XOIA 1LPBB 5ALTA 5JSQA 1QU2A 2NTJA 5EY5B 3ST7A 2PGIA 3HKEB 3IEPA 3L8HA 1JJVA 4QYXA 4D0NA 4PQEA 2WZCA 2KHZA 2E5FA 1NYTA 4DCUA 1XWWA 3OT4A 2PT6A 3M6LA 1WULS 2C92A 1DKNA 2PLFA 5J2TF 6GPBA 5DGXA 3CX8A 5H80A 2BGGA 5LYJF 1C7QA 1L4GA 1G6Q1 5JO9A 4I4CA 3C4JA 4V0KA 4EMUA 2RONA 2ID4A 5AUOB 1WU7A 1KO4A 4EUKA 3DMHA 3LKBA 3O4VA 4IDPA 4V0MA 3VUEA 2QF7A 1VZ3A 4P81A 1LFAA 4Q7QA 2P2NA 3TNDA 1D1TA 1GTRA 2WHQA 4EFKA 3VR5H 2JJ2D 4OKNA 3OZRA 1OKKD 3G0BA 4HWKA 4YFYA 1YR9A 2GK6A 3ZJ4A 1DAFA 1FHRA 1JW9B 1N8NA 1OVGA 1ZINA 5JEMA 1M2EA 1QFZA 2ZETA 4IIJB 4R1TA 5FCDA 2UYHA 2KM1A 3USZA 2O7VA 3KOOA 5ELMA 4TYWA 3MIZA 5TX7A 3TIFA 3RIEA 2PWAA 3Q6IA 3LY5A 2EZTA 3IFSA 4XDHA 1Y4UA 3QJYA 4R7GA 3FDZB 4KODA 2WAOA 2QZ9A 1GAWA 1N6PA 1YJBA 1U0LA 2FSHA 4FOOA 4PZYA 4U5XA 3LM8A 4PYLA 4TOIA 4HL6A 4AKTA 2DPLA 3FFBA 4HB0A 4FOTA 4EJSC 2PZBA 4RVUA 1RHUA 1RIFA 2ONYA 2AMYA 1NW5A 5IDYA 3J81A 3HFRA 4NPHA 1QZUA 3WADA 2C2GA 1OU4A 1KO7A 1UWKA 3K0EA 3PC2A 3V3KA 1JIVA 1CZHA 2WJAA 3AT1A 3FLEA 1F2TB 1T8PA 3POAA 2QN9A 2I5PO 3SVZA 1OA1A 3PNQA 3EMBA 3LL7A 3OFVA 3VJKA 1AQJA 3RFVA 5L40A 4OGKA 3PYMA 2H0AA 3RRYA 1IUPA 3DAFA 5YASA 2WSBA 4C03A 3IQDB 4UOQA 2AN4A 5A0VA 1C7FA 2SKCA 2D4AA 3N2IA 3E58A 5EQFA 4EY4A 2Q6VA 4XYGA 4CGZA 4D0SA 1I4LD 3WL4A 3P9YA 3A37A 2XMGA 1BS1A 2G9RA 4KG7A 4OBBA 5H68A 4EJ0A 5ELXA 3FZNA 1CLUA 3NWEA 2G1PA 4BAZA 5BQPA 2ONCA 2NYAA 2R00A 2D5AA 4O4JA 1MV5A 2JBAB 3KQTA 1FP4A 3STUA 4CNQA 1YFLA 3RUAA 3NUZA 2XA9A 4D9HA 3DE6X 5AKXA 4B83A 4AJNA 1E5XA 2C2XA 1NBOA 3E2PA 1CW2B 4JBWA 4LC9A 1R1DA 4JFAA 1PSDA 3ROQA 1Z7BA 2AR9A 1NW4A 1MX9A 2CJFA 4JDUA 2VRWA 1LY1A 2NUTA 4NICA 3RK1A 1YS7A 4GWLA 1AU9A 5ALQA 3SXUB 1CUXA 2QRQA 4C4YA 4MA0A 3E8XA 5JAPA 2XWJI 3F6SA 4HUQA 1L4FA 3EXIA 4JEHA 4GXNA 4W5OA 1KK2A 3NDJA 4JB2A 3Q10A 4R68A 3RS9A 4PF1A 4R84A 1QYIA 2HIHA 1IUKA 1FFSA 3E9EA 1Y6ZA 2MMCA 2CVZA 1CWUA 4CMEC 4XZ3A 1YXMA 3MGAA 4TYMA 3ZXUB 1YDGA 2Z6QA 1BWSA 4BFSA 4N40A 3FMVA 3IVGA 1GAXA 2FUCA 2X9LA 2NO5A 2V5AA 1YTLA 4PAGA 1J33A 3UENA 3AHHA 1E7YA 3AUUA 1HLGA 1DKUA 2XTZA 1GZDA 3CEJA 1IWBB 4Z0TA 1JSZA 3FIJA 4FNMA 4I7EA 2HR1A 2O6LA 4QXMA 2FZKA 2DTDA 5K3DA 2JJMA 3IUMA 3MFQA 5ALUA 3O21A 4HXYA 1R6AA 1TA0A 3D5EA 1P0PA 3B89A 3P97A 3T52A 3DLTA 4EGQA 2AN1A 5A7HA 1BXGA 1EFKA 3U4QA 3OJ0A 2A67A 5FPQA 2HM7A 2WQ7A 4H6WA 3RUDA 3ZCUA 1QANA 3EZGA 4BNKA 3UATA 3GT4A 5B55A 3CUYA 3BXXA 3C5WP 4Q4JA 2C5FA 4KUGA 1G18A 4INZA 2I99A 1Y5NA 4GECA 4IHAA 4RSRA 4X7RA 1FCJA 5GV7A 1RYDA 1ZK1A 3SBEA 1NTRA 3TKYA 3ZXIA 2LV8A 1FC0A 4FUQA 3ZS9A 3CO0S 3BHMA 3GX1A 4XD7D 4MMZB 5H81A 3KT9A 1SUEA 2C5GA 4E5DA 2PYIA 3EBOA 3NFYA 3Q0TA 1QZXA 5C5EA 4JI6B 2OG2A 3U1TA 2WSYB 3F47A 3H2GA 4P1ZA 2QZZA 1X9HA 1XCPA 1R0RE 2WKQA 4X84A 3RS8A 3TJZA 3W0LB 4CN8A 4ZJZA 4RTLA 4JYAB 5DHTA 3V4ZA 3PEVA 1YMVA 4NBTA 3VDMA 3DAOA 1X87A 3L7CA 4DQUA 4FFLA 4CLEA 3H5TA 2NYRA 3TD9A 1G8AA 2WNHA 1SKAA 2D2EA 3NONA 5KTYA 3I8XA 5A1TA 2OA0A 3ZNQA 5FV7A 4RXMA 1TNDA 4PQGA 4UD2A 2Q9CA 3ND7A 5ALZA 1N5JA 2A6PA 3I04A 5CB4A 4DADA 5ERYA 4TQ9A 5KYGA 2CBZA 5KTKA 2W6IA 1ORHA 1IM2A 1TKAA 1V26A 3WR5A 2WA1A 3Q3VA 4E4YA 2CLSA 3KVRA 1HYHA 3JD3A 2QRVA 4WFJA 4ENRA 2CNDA 2NO6A 3KEMA 2H9IA 3KTAB 1P91A 1WMFA 3ENKA 3QIVA 4PHTA 4RTJA 4DR4B 2AOXA 1C3EA 3DNFA 4GL2A 2QXUA 3A11A 3MRXA 3SYTA 2JH9A 1QDEA 3ZY4A 4LOAA 1KEEB 1ESDA 2FPOA 1JTEA 2JGFA 2H1LA 2YWEA 2C4WA 3FGPA 2HRBA 4BNUA 1LJ8A 3QITA 1SKBA 1UEJA 4FGZA 3ICEA 1LSJA 3C85A 2FE4A 5DCUA 5BSTA 3THXA 2CXUA 4JCCA 4QFDA 2BH2A 3C7DB 1BKSB 1TD1A 4KSYA 3ELVA 3GJYA 4MKZA 3PC6A 4HN2A 1WXHA 4C3ZA 5J4YA 3I2GA 4ARBA 4OJYA 3DDWA 5L4LA 5FOWA 3TFQA 2ADFA 8OHMA 3WGGA 1Y6FA 3G2HA 2P5TB 4AN1A 4BECA 1GCGA 1AK2A 2ZJYA 3TDMA 5GIOE 3WDLA 1PI3A 2PMBA 3L7IA 1L4YA 3DGEC 1C14A 3ETCA 2MDTA 4TN5A 2DZDA 5I7SA 4AWBA 3PXGA 3DOJA 4V0ME 3AV0B 3HCEA 2Y6VA 1XL0A 4POOA 3GLIB 2BFMA 3NMUF 2VYCA 2EH0A 1CTQA 1VLVA 3HL0A 3MB5A 1B15A 4ILKA 4M98A 1QV9A 2VDOB 4Z9XA 3CFYA 3SQLA 1THTA 4D6PA 1SHZA 4S0ZA 4QFMA 4YT5A 3HADA 1GRQA 4BNNA 4ZC1A 4JUFA 1YI8A 4L9SA 2PWYA 2PX8A 1RBQA 2G08A 2G88A 5LNK6 1P2UA 1Y9EA 3M89A 4WW0A 1NI4B 1E1QD 1JIQA 1G8JA 4YHHB 2HU8A 4A6DA 3S8EA 1GLGA 4WOPA 4F1KA 2IVFA 3UJDA 4TLCA 4TT3D 5LQSA 4PAWA 1GGNA 3ZGNA 2A9QA 2YWJA 3E22B 3IALA 3WJ1A 4HNTA 4KHZA 3H6HA 3P96A 1IYZA 5BW8A 1P80A 4DC9A 1HEUA 4WD3A 2I1QA 1P81A 3GQSA 1JDJA 1NBIA 1VCOA 2HX1A 4CF7A 2H2WA 1HT1E 1EM8A 1V45E 5CFPA 3H4MA 4D57A 5CA0F 1V5GA 2BFNA 3L7KA 4JLVA 2F3RA 1NHWA 5I7VA 1Z0IA 4JVOA 1LWOA 1SD1A 3F96A 1Y6JA 3HS3A 3EJ6A 4PE5B 4BBPA 3K20A 4GPZA 5AD1A 1J49A 3I6YA 2A35A 1K9SA 2CLKB 3DZCA 1SQFA 3FUXA 4D0GA 1KEKA 1JVBA 4ZO4A 1R12A 4HQ6A 3MS2A 2YWCA 1MIHA 1IJEA 1QNFA 1U0JA 4QTTB 1H9AA 4NV3A 1Q1EA 1A9OA 2RGDA 3KXLA 3WB2A 1SBHA 1B43A 3HWWA 4BNXA 5JU6A 2NU6A 4CMIB 1NUSA 3IDAA 2IC5A 1DOZA 4C4PA 4YB8A 2QVCA 3IAM6 1RLJA 2V9ZA 2PX6A 1TI7A 4ZYWA 4DIUA 1VMKA 4FFSA 5DHSA 1K6MA 4DR2B 2BM9A 1GGEA 1A9QA 2GEDA 4I46A 4MP3A 4UMEA 3OJLA 1HYGA 3WJAA 4EM6A 4LXQA 2CSUA 1T1SA 4HLCA 1U02A 2QLBA 4JJIA 4MQ4A 4MWDA 4U7FA 5CR9A 1AXGA 3L0YA 4ATNA 1MW8X 1A96A 5IBQA 1H93A 3F2VA 2X5NA 4XX0B 2GX6A 2IZZA 3C6YA 3CJQA 2PUJA 4B6OA 1Q1GA 3LHSA 5FO0A 2JA2A 3D8BA 4NOJA 4IFTA 3G0HA 5EHQA 5GAJA 1K6JA