3VU9B

Crystal structure of psy3-csm2 complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
211
structure length
191
Chain Sequence
YEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQTEPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNRIKNGDSLAEYIWKYYADSLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platinum sensitivity protein 3
publication title A new protein complex promoting the assembly of Rad51 filaments
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 71
structure length 191
sequence length 211
ec nomenclature
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16834 CSM2 Shu complex component Csm2, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vu9B00
2IYTA 2O8DB 3ZDQA 5KU1A 2BVNA 2RAPA 2A9KA 2FGJA 1GFIA 3A1SA 1ZU4A 1E0JA 4TN1A 2B7CA 2F43A 1UBGA 2ZROA 5FBQB 3DM5A 5JS8A 1DAKA 2O8FA 4ITRC 2P67A 4POAA 2ZIAA 3SHFA 2CDNA 3IHWA 1JAHA 3T34A 3AP3A 4DUGD 3RWOA 4NCIA 2YWEA 3VX3A 4IDQA 1Z0IA 1P6XA 1XMIA 2FPLA 3LQQA 2BMDA 2UVQA 3T15A 1U81A 4TYYA 5FUWA 2FG5A 1OXTA 3B13B 2BEKA 4FIDA 4IEIA 1SHZA 2J0VA 3LBNA 4IFBA 3UG6A 4QRHA 3EZ6A 2IL1A 4AI6A 3HYTA 2YVUA 4MRVA 1U94A 3KZ1E 2D06A 3EZ2A 1EESA 4C3ZA 2Q9CA 2ZREA 4PC7A 1CKEA 2GTPA 4HB0A 5JEDA 4GZMA 4LHZA 4KYUA 5J4KA 2A5DA 5JSZA 1GUAA 4AKHA 3RS3A 2GCOB 3UPUA 5TB5A 1QHGA 2WJYA 2TMKA 1XZPA 1KDTA 4O3MA 2O0HA 1XTRA 1X6VA 2OBLA 3AVUA 2QP9X 4XOIA 1U9IA 1KY3A 1FX0A 4IOMA 4OI0A 4HB3A 2WWWA 4II7A 4OHXA 2ZJ8A 2G0NA 1NBMD 1OHHD 1W36C 4CT4B 1W49A 1EFTA 1SVIA 3PV0A 1YZNA 1GNPA 2YOFA 4DT1A 3CF6R 1JNYA 3P26A 3B9PA 1V43A 3ZZ0A 1QHSA 1G16A 1XMJA 1IJFA 5JRZA 1X1SA 3MGCA 3C16C 4B3DA 3CZQA 1NVWQ 4EFMA 1VYVA 4KVAA 4BRUA 2ZITA 2JLZA 2GEUA 4OQXA 1E9EA 1IHUA 4CEJA 1P3JA 1KTVA 4Q9LA 3BXZA 2DR3A 2ZYUX 1XMVA 3U7EB 2HYDA 2HLDD 3M0EA 3O47A 1C4OA 2FV8A 2MSCB 1SVSA 3ADDA 3OE7A 2ERYA 2BWJA 2GRJA 4HLUA 3VU9A 5GJBA 1TUIA 4Q4HA 1G19A 1RZ3A 2G3YA 3LLMA 4X8LA 4XVRA 5A5GA 4LYAA 1OSNA 2XNDD 4YXWA 4XWOA 1Z6XA 1T4GA 3KTAB 5A0FA 1OHHA 1Z06A 4PHHA 2GESA 2KBFA 3BERA 4TLBA 2H17A 3VMFA 2WTUA 4B44A 5AJWA 3SE0A 4P4TA 1UKYA 3CW2A 2P0EA 2W2XA 4GPTA 1KIMA 5CIWA 1M1YE 2YJTD 3OESA 4O2LA 1B0UA 4Z54A 1QVRA 1KO1A 4LV8B 3W6PA 1Z29A 1CJTC 4DCSA 3ZQJA 3MG9A 4LHVA 1ZNYA 2D2FA 1E9DA 3EIHA 3TMKA 4V0NA 2H5EA 1XRJA 3A1UA 1PLJA 3QXXA 3I32A 3ONWA 2V1UA 3KFVA 2KWIA 2F7SA 2CCGA 4N3NA 2JLUA 3U7HB 2HF8A 4GP7A 2EWWA 4BECA 3K9GA 1AKEA 2Q3MA 2YYZA 5IDVA 2VPPA 2H16A 3RRMA 1P2VA 4C0BA 3U3OA 1E1RD 3OAAA 2LWIA 4D0NA 1DG1G 1N2CE 2WSMA 1W4CA 1GRRA 2XTMA 3J81k 3HJNA 3GLFA 5DISB 1M8PA 1NF3A 2AX4A 3HYRA 5CK4A 4A82A 1JECA 1MRNA 4QHYA 4EDHA 2DYKA 4A4DA 4BFTA 4HZIA 2A2ZA 1ZC4A 4B2PA 5UKDA 3UATA 1G8GA 5J47A 4KSCA 3C4JA 4ARZB 2QU8A 4PFSA 2CHGA 1BYIA 4F92B 2H7VA 1E2QA 3RWMB 4OQNA 1N5IA 3IQXA 4GI7A 1QF9A 2ONJA 4JKIA 1EX6A 2NPFA 4HAZA 1CBUA 2H18A 4OQFA 4V0ME 4R71A 4C7OA 1S96A 2JJ8A 1FNMA 4C30A 3IGFA 4OHVA 1E2EA 5HCIA 1T0HB 4TZ0A 1MRSA 1YZUA 1KKLA 4RFSB 1RW4A 1HQYE 2RGNC 1II8B 4R2HA 1NY6A 3W6OA 4L9SA 1T3LA 4HAWA 1PLLA 1A5TA 2C8VA 4P4SB 3GPLA 3F5FA 2RHMA 3DHWC 3IIJA 4WBSA 4QNMA 2VP6A 1CS4C 4BFWA 5JI2E 1U90A 2XXAA 1OLOA 4PANA 2BM1A 4FI3C 4D4JA 4ARZA 2CCJA 3LW8A 1E9FA 1M7GA 1TU3A 1IY0A 1VCMA 1IJEA 4JLNA 2IYWA 3AQ4A 3W6NA 1GM5A 1ZD9A 2PEYA 2ZUDA 2QE7D 5G3YA 4TQUS 2GXSA 3CRW1 2R6DA 2IEYA 3B8HA 3VR5A 2GEDA 1UKEA 2YINC 421PA 3TH5A 1NVXQ 1W2HA 1A1VA 4IOKA 3QSYA 1Z0KA 3UK6A 5J4VA 4XTCS 2RGNA 3SBEA 1T6NA 4AYTA 1XP8A 1P7CA 4IDOA 5FI0B 3AKCA 3PVSA 4JMPA 3SFVA 5KUTA 3R7WB 4Q1DA 1XTIA 2QMOA 5FBWB 2WPDD 4C0LA 1HV8A 2HCJB 3GEHA 4JT4A 4QJ4A 3CH5A 5FFMA 4QOSA 3VKWA 1VYUA 3T1QA 1T3SA 4MDEA 2GDJA 1YJ5A 5JJKA 2J41A 4EJSC 5BQ5A 4YMSA 4KAXA 4C2UA 2YWFA 4NYMQ 1KI6A 1XFAA 1KI1A 1KJWA 4IXMA 5GJWC 3L2OB 3BE4A 4PHFA 2EU8A 1Q1QA 3TW4A 4Q19A 4M22A 4PTLA 1YU9A 4O0MA 4BRWA 2ZRFA 1IONA 2GXAA 1G64A 3X1YA 1UAAA 1RRPA 2F1IA 4PSVA 1R4AA 3U3MA 5L8VA 3FHTA 1E2DA 5JHGB 3RS5A 2ZR0A 4MGKR 2IHBA 1XDBA 3DM9B 1NKSA 3EC2A 4JYCA 1GL7A 2K5UA 1H8HA 1QVAA 2BM0A 4EPVA 1QDEA 2ZQ5A 5LPNA 3NEYA 1A82A 1JXOA 3V4RA 3U3JA 2RB4A 4ACAA 3PITA 4Q66C 3SDZA 3T5DA 1R0ZA 2NZJA 1I4TD 1JJ7A 3K09A 3H86A 3WP1B 3NKVA 1ZM7A 5JWRA 3GLGB 1N5KA 4KYIB 4BLPA 2LCFA 1YKSA 1FX0B 4M1WA 5J40A 1R2QA 4WXRA 2N46A 3QXHA 3MJHA 5IK2A 1U2RA 4JJKA 3DVLA 1IXSB 2JJ1A 4W9MC 2AK3A 3RRNA 3A8TA 3ZZUA 4M1OA 4AWXA 5E7MA 3PG5A 4AG6A 2PZGA 3ETLA 4KV9A 3C14C 3CBQA 2PJRA 4G0NA 2XB4A 4DB4A 5HZHA 5CJ2A 2ZRKA 2F3TA 1WRBA 4OHWA 4BFZA 1PV4A 4Q03A 1E79A 3SC3A 3TLXA 3IPXA 1G7TA 3TVTA 2ZTSA 2JLRA 1JAIA 4CZ2A 2F43B 2V6IA 1SULA 5LDDC 1AQUA 4M9ZA 3SYLA 1HH4A 4B3FX 1B23P 2VLIA 1QRAA 4FW9A 3N2EA 4KLZA 2IS1A 2R6AA 1KNXA 2CNWD 5GJVC 2OV2A 4WW0A 4P31A 1J70A 2LKCA 2GK6A 3C7KA 3VKHA 4ACBA 1Z6TA 2J45A 4UNNA 1ZM2A 2NQ2C 1E9AA 3EWAA 5JHHB 4HDQB 1Z6GA 1AGRA 2WJGA 3NH6A 5FUYA 3KQLA 3EPJA 4M53A 4LK2A 4GMDA 2C9OA 2VHUA 2IUUA 2OSBA 3RAPR 2DWQA 1G7RA 5CLQA 3JVUA 1ODFA 3MUFA 4FWIB 4QG7A 1OT3A 4QFMA 4YMVA 4LOAA 3OEHA 1XZQA 3HR8A 2CHVA 2BC9A 2WWGA 4PZLA 5H8WA 3KL4A 4ZDJA 1G7CA 3CNNA 4V0OA 1XD8A 3ZVRA 3FMIA 4HUQA 4QBIA 5L3QB 3HWSA 2OM2A 2ZRLA 4BEBA 3SEAA 4JL8A 1E2KA 2QSYA 2WJIA 4OK3A 4AY2A 1FP6A 3NXSA 1F2TA 2NG1A 2XZOA 1KJYA 4JBWA 3N70A 4EJSB 2F1RA 4B33A 3B78A 5JS7A 1N6KA 3DO6A 1D2NA 4B47A 5L3SA 1Q21A 4P3YA 1NY5A 3GJ7A 5JZVA 2Q3FA 2EYUA 4XVUA 3VNVA 4A6XA 1NMZA 3I5YA 2R44A 2QAGA 1JB1A 2FFQA 3SNHA 4V0KA 2IUSA 2BEJA 3TUZC 5DGXA 5HTKA 1UDWA 4M2LA 1S8FA 3B1YA 4FXPA 2REXB 1Q0UA 2PL3A 3MFYA 2GCNA 2N1BA 2ZSEA 1EWQA 2VO1A 2ZU0C 4N1AA 1O87A 2V8OA 1JR3A 3IQWA 3VX4A 1OB2A 5M04A 1NG1A 1RJ9B 3T1VA 2IWRA 4Q48A 4FMCB 1UEIA 3AVVA 4FWTA 1NBMA 2RMKA 4IXNA 4RVCA 1G8HA 2QZ4A 4M9SA 2J5XA 4HAXA 4IDNA 5GVSA 4PPFA 4I81A 3AVWA 4WAUA 1E9SA 3R8CA 1W0KD 1AZSC 4DC9A 1GZSA 3K9LA 4LHYA 2OG2A 1MABA 3K70C 5DLQC 3DPUA 3MAAC 4KU4A 3QE0A 4P4SA 3ADKA 1E0KA 2VQSA 4BFSA 2VRWA 4JZKA 1KO4A 4A92A 2GJKA 1Z28A 2AXPA 2IBMA 4R9UC 2F6RA 4JLVA 1JEDA 5FOXA 4BE7B 5BYJA 1M7BA 2PLFA 2J7PA 4KXFB 5LB4A 3W34A 3AVTA 2R6FA 2GZAA 2ZYTX 3MMPA 2NIPA 2D4HA 4I1OA 1MOZA 2GXQA 3PFIA 1AQYA 1FL9A 3MWLA 2CK3A 3C5HA 3QOFA 2VSFA 1WE2A 3DZ8A 4FCVA 2WIBA 2J59A 3L43A 1UM8A 1SXJD 2ORVA 4FMCF 2EVWX 2PH1A 1XTJA 1US8A 3K0CC 1MV5A 3R7WA 2G88A 4AK9A 4DRZA 2HYIC 2P65A 3TR5A 2YC4C 3M1IA 1MO6A 4YMTA 2QN6A 3SN6A 1AS2A 3LXXA 2VSXA 2BKUA 1KNQA 1T3HA 4GOKA 3TNFA 5C46F 1XWIA 1S9HA 2B6HA 1JXMA 2Y8EA 5EE1A 1UADA 4HB2A 1S0UA 1ZIOA 2VIIA 1R0WA 3L0SA 3QIAA 4A9AA 3GLHA 4D26A 5L3SB 1RRGA 3V4FA 3FMFA 4DIEA 5FTNA 3FMOB 1OH7A 1JALA 2OAQ1 2WWXA 4NL4H 4NYJR 3R20A 3RS7A 1XJCA 5DO9A 1ESNA 4DBLC 3K0CA 4U00A 2ZETA 2CL6X 3T1TA 5DNYB 3TKLA 5BN5A 1R10A 2IYYA 5JRJA 4DLXA 1F2UB 3MLEA 1P60A 1ZC3A 4HSEA 4A0GA 2Q3HA 2GXUA 3DL0A 3T5GA 1DG3A 4HLDA 1XPUA 1L4UA 5CITA 3Q85A 3CX7A 2ZE8A 5AUNB 4ESVA 2W2TA 4CEHA 2X8AA 5JI3E 1Q20A 5AK0A 3TUJC 5FI1B 3L8YA 2QQEA 2E87A 4FD2A 1P72A 3L0IB 4NHOA 4PC3A 3CX6A 2ZJAA 4YDHB 1TADA 4Q9KA 3WYAA 3RRYA 1G4AE 4QJ5A 1XTKA 3AB3A 2G1JA 4Q7KA 5BXQC 5EZ5A 5B58C 1S9DA 2VP5A 4LDJA 3QVUA 1S3SA 4HAUA 4DZZA 3EIEA 2OXCA 2FN4A 2C98A 4IRUB 4F4CA 1W4AA 3E2IA 3AP2A 5KSZA 2QG6A 5IT5A 3O8DA 3QI2A 4JLDA 2GF9A 2N42A 3VR2A 4TZ6A 3IDQA 3GJ8A 2GJSA 4W7SA 1OXUA 4MRRA 4ILEA 1FOEB 4QGHA 2OBNA 4M1YA 2OCPA 2JA1A 1E9CA 2ZUBA 4LJ8A 3OHMA 1S1CA 4WZAE 3SJZA 1SVWA 4OHYA 4DLVA 3I8XA 1KI4A 1AS3A 1II9A 4IJMA 1NP6A 1T9HA 2F1HA 3WBKA 4GZLA 3U7FB 1JJVA 1IOZA 1TQ2A 4RZ2A 2ZPTX 1CLUA 1VIYA 2IYZA 4Q00A 4TYPA 1SKQA 4FINA 3BS4A 4A0FA 1EWRA 2WOJA 2BIFA 1YR8A 1NSTA 4OJQA 2ZSAA 2HT6A 1FP7A 1WA5A 2ZRJA 1GRQA 5TARA 4TSFD 3HDTA 1HA3A 4NMMA 3P32A 1II0A 3UKDA 4TMTA 3IEVA 3IO5A 3RC3A 4OI4A 2WAYA 2ZSDA 1E4VA 4PR0A 5FBRB 2XITA 1D8TA 3B5JA 4C0QC 2JLVA 3K70D 2BCJQ 3EZ7A 3WHLA 5CDFE 3EG5A 4ESHA 1WQ1R 2Z83A 3QEOA 4D0LB 2VL7A 1F6BA 2OCBA 2ZI4A 5H1YA 2PEZA 1AZTA 4RD4A 1ZP6A 1HY3A 4O25A 8OHMA 3HU2A 2C99A 4EPRA 5KNBA 3HPQA 5FL7D 1KMQA 2ZUCA 4TMZA 3P1JA 4UJ5A 2RH5A 5K8IA 2X19A 4UQOA 4BFYA 3SBDA 721PA 3AH8A 1IN4A 2IUTA 2JLYA 4NU0A 4M8NE 4BWYA 2WOOA 3LV8A 1P4SA 1NL3A 3E1SA 4X8MA 3AGPA 3C41J 3X1WA 1DAIA 4TSFA 5IK2D 4QM6A 1R6BX 4GMXA 1W1WA 4F93B 4HAVA 4PHGA 5CYPA 1FUUA 2W0SA 2CVHA 5CJPA 5DYIA 2FU5C 1E99A 2WWHA 3E70C 1ZNZA 3B60A 2Q21A 3CNOA 4A2WA 2V1XA 4EQ6A 2GHIA 4WIAA 1SXJB 2YWHA 4HB4A 1NIPA 2A5FA 1L4YA 1Z3IX 1OYWA 4YMUA 1H8EA 1KI2A 2O52A 2J0QA 1W44A 1EGAA 4EPYA 4DCUA 1XNJA 2V7QD 1U0HC 1VHLA 1FTSA 4MKIA 1F3OA 2Q9BA 3HPRA 3ND8A 5DE3A 5GJCA 3RHFA 3MWKA 1KK1A 2F9LA 1F48A 5KPJA 4RZ3A 2P5SA 3VR4A 1H8HD 2C03A 3VR6A 4FCWA 2GA8A 2VF7A 2XGJA 1OKKD 2VA8A 4PO9A 4D4MA 3GCGA 4TQ9A 1ETUA 5SZIA 4LSGA 3T12A 1GWNA 1VPLA 1Z6AA 1DOAA 1JPNA 2QROA 2ZRCA 3Q9LA 2GJ8A 5JCPA 1NVVR 1SVOA 1ZINA 1XEXA 2R65A 2X1VA 5EP4A 3NBYC 1LF5A 1G21E 2JGNA 3EPHA 1COWD 1QBKC 1YZQA 2ZE6A 1R0XA 4DLWA 2BJVA 5FOTA 1N0VC 1Y63A 4M9QA 3TQFA 1XPRA 4PC1A 4TTPA 1Z0DA 2P6NA 4JLAA 3GLIE 3AP1A 2PX3A 3CLVA 4GP6A 4LHXA 4C0HA 1RFLA 1KDRA 1SGWA 3OEEA 4B3BA 1G3MA 4KO8A 4N0DA 1UKZA 3THXB 2DFKB 3U60B 1CXZA 2FEOA 3SS8A 3BD9A 2GKSA 4DIDA 2HLDA 1Z08A 4QL3A 5FL3A 2Q0HA 1MABB 4ZIRA 1OH8A 5A4JA 5K8UA 4B75A 1E32A 4BEJA 2IXGA 4NTZA 5EP1A 5FBVB 2VYFA 4JSTA 4UKDA 3TSOA 4ZIRB 1W46A 4L5BA 1FQJA 3RSOA 3Q7QA 3BH6A 2VHCA 4U02A 4MDFA 2OEPA 2IF2A 1NN0A 1BOFA 3KKQA 3B6EA 1MO4A 4UNRA 1G41A 2ZSFA 4TLDA 1C1YA 1NSFA 1KAGA 2ZJOA 3EXAA 4ZI3A 3K0EA 4JVMA 3ZVMA 3RNLA 3I4LA 4CGZA 2PBRA 3LNCA 1KK0A 3R8FA 1CRPA 4URWR 4DDVA 3AF1A 1A4RA 5ELXA 4TLEA 2FA9A 3IUYA 4ZDWA 1DVRA 3L82B 4PSAA 1IAQA 4GBMA 4IW3B 1VDZA 1NVUQ 3HU1A 3VTKA 2QRNA 3MRSA 4OJKA 3WHKA 1G5RA 2ZS7A 1OIXA 1NLZA 4NCNA 1M2OB 1LY1A 4TMXA 1G5PA 2G9NA 2YHSA 3A4NA 4DLUA 4LX0A 4TQAA 2A30A 3ZQ6A 2NO6A 4Q1BA 5KOYA 2VH5R 3LFUA 4ASUD 2ZI7A 2V4ZA 2NMVA 2BKEA 4NYIQ 5EP2A 1AKYA 4XD7D 1BS1A 3KDSE 3IO3A 2KJQA 1E94E 2AK2A 2GF0A 2AKYA 1ZM4A 2OAP1 3NBFA 4HZUB 1EFHA 5EXPA 1T8TA 2IYXA 5KPDA 1W36D 1GITA 1CR1A 4TYWA 2FF7A 5TY0A 3BFVA 2RHDA 2NO9A 1E2GA 2R6CA 5SZKB 3PXGA 1NJGA 4RSGA 4A36A 4DLTA 3I72A 3B1XA 3LX8A 1FW6A 1IM2A 3DMNA 4OK5A 2QPOA 4LZZA 4URYR 2PZEA 3MSXA 4AKIA 4NH0A 3A1TA 4OYHA 2FOLA 3D31A 4NP6A 1QHYA 1E69A 1OIVA 2JJ2A 5E95A 1SHKA 2IS4A 4DSOA 4CYMA 4BZXA 5DHAA 2DY1A 5JSZB 1R7RA 4CF7A 5JJLA 1EXMA 2QGNA 5FOSA 3GLHE 2OUKA 5EXSA 3EX7C 3QPWA 2JATA 5JWOA 4LPKA 1YVDA 1OJLA 2QL6A 2WMOB 1VG8A 5IF9A 3WNDA 1KI9A 3NDBB 1P73A 3KJGA 3EZFA 2NGRA 3THWA 4C0AC 4Q4HB 4MYUA 1WBBA 1LS1A 4LJ9A 4PAMA 4RD1A 3D8BA 4Q1CA 3KX2A 1E2MA 5EE5B 1SXJA 4MYTA 4G5OA 2NZ8A 3PUXA 4RCZA 3QG1A 4LRWA 3WXMA 1TPZA 3SOPA 2XNSA 5J5CA 2AR7A 2XZPA 5ANRB 2LKDA 3ICEA 1N0WA 1X1RA 4QKQA 1XCGB 3SJAA 2MMCA 2ATXA 3QJYA 2ERXA 2FX3A 2KSQA 1NBME 2JJ2D 2QA5A 4AC9A 4RZXA 1T0JB 3REGA 2ZVPX 1VIAA 2WBLC 2F1JA 2GNOA 4HUQB 3VQTA 4LC0A 2CNWA 2V6JA 2IX3A 3REFA 3B1VA 5IRCD 1YR9A 4OQMA 5CB6A 4EIWA 4AYWA 4TTQA 3WNBA 4MUAA 1SVLA 1D9XA 1KI8A 1W48A 2FPKA 1NIJA 2W83A 3GLIB 4M1MA 2REBA 3EA5A 2DFTA 1KMHB 1ZU5A 2ORWA 3AF2A 3KQNA 3OFND 2W2VA 2OILA 3BB4A 5DIFA 5G40A 1N6OA 2R62A 2MSEB 4A8JC 1NN3A 2O8EB 1G8FA 2PCLA 4I4LA 2ZJ2A 5GADl 2A78A 3L8ZA 4FCTA 2JLSA 5H68A 4ZCLA 1E4YA 2PCJA 621PA 2XOKD 2J0SA 2GAOA 3EIQA 1VHTA 4OL0A 2FZ4A 2DBYA 2ZI3A 2H92A 1DE0A 4PZZA 2UKDA 4LJ4A 4X8OA 1N3BA 1M34E 2EFDB 4HLQB 1P2UA 3PUWA 4MRPA 3IBYA 3PEYA 2O8EA 3RVBA 2ZE7A 2J7PD 2B7BA 2IYVA 1XD2A 1S4QA 1HE1C 2WZQA 5DHFA 5LBIA 2GJAA 3I73A 1KOFA 2Z0MA 2J9RA 1A7JA 3AKDA 4UNQA 3LXRA 1N6RA 4IKEA 3RS0A 3A37A 3R9WA 2D3WA 1JR6A 2QI9C 5KSPA 3KKOA 5F9FA 1KK2A 2FDCA 3QXJA 4L4UA 5AUPB 4R7ZA 2VSOA 2PX0A 4WZBE 3EASA 2JLWA 3U44B 1AIPA 1NI3A 4TL7A 5D3MB 3AUYA 2MMGA 3CRVA 3OIUA 2BHRA 1IY1A 1J7KA 1CIPA 2KBEA 2FFHA 2KI5A 1G3RA 1UF9A 3BFXA 5EXTA 4DEYA 1N25A 1G6HA 4BLRA 5B2ZA 4Q02A 2ZRIA 3VAAA 4AG5A 4W5JA 2ZAOA 3GJ3A 5FOUA 1BYUA 2CL7X 3ZD7A 2WIAA 3IHLA 1P9RA 5JWHA 2ZJYA 3FKSD 1T5IA 2GBLA 4ON9A 3BB1A 3U4QA 1NLFA 2PZFA 4PHTA 3AF4A 3ZGXA 1MT0A 1CRQA 2O8CA 3SQXA 4RCYA 4M1SA 1D2MA 1OXVA 4LC1A 1GDDA 1TF7A 3V9PA 2Q9AA 3SR0A 4DJTA 5LD2B 5JCZA 1WDTA 4LYFA 1XXHE 4URVR 4RFSA 4N0EA 3BORA 4DSNA 2QE7A 3AVPA 2E1RA 3NH9A 4W5HA 1KYIA 5FTJA 5BW8A 1GTVA 4DLYA 1M6NA 3GFTA 3P4YA 2EQBA 4W5WA 2JJ1D 2OFOA 1K6MA 3AKEA 2VHTA 2VP0A 3KKNA 2WHXA 4XWAA 3K0FA 4WA7A 1DTSA 3CRRA 3WMEA 3BB3A 2WAXA 1ZUNB 4S35A 1LB1B 1DAHA 1U0LA 4D82A 5CYOA 1ELOA 2HJVA 2ZEJA 3QY0A 5FPSA 3R9IA 3GLGA 4FMDB 4QC2A 1P9NA 2XJ9A 4BLQA 2XTZA 1CTQA 3NHBA 3QF7A 4E07A 1G9XA 1LTQA 5CDFA 4BGDA 2ZM5A 4Z1MA 2VP4A 3CF2A 2VBCA 2ZRBA 3CB4A 3H0KA 2EFEB 3KB1A 1Z6YA 2ZRPA 2L0XA 2IEZA 2WVJA 1DAGA 4PC6A 1XX6A 3LBHA 1ZCBA 5FBLB 2ECKA 2BMEA 3CO5A 3KKMA 3FFBA 4URUR 1XU4A 2J3EA 1G20E 1KO8A 1AS0A 1CJKC 2J87A 4Q4AB 1O3YA 5TV2A 1VG9B 5CLLA 1E2JA 2ORIA 2ZRNA 4QGFA 3O8BA 3SFZA 1W36B 4JBXA 3RANA 5FTMA 2HCBA 3NVAA 1FQKA 3W8RA 4B2LA 2O8BA 3CRQA 1PUIA 2J1LA 4HLCA 1CEEA 3QKSB 3UXMA 5SZJA 1Y3AA 3G5UA 4BFUA 4M1KA 1I2DA 3S1AB 4D4KA 3FPAA 3BGWA 3N5CA 3NTUA 3FWYA 2VF8A 2Z4RA 5CM8B 2WM9B 1W7AA 2A5JA 2G0TA 1Z2CA 3QENA 4PQRA 1G291 1LVGA 4TT3D 4M1TA 521PA 3FYHA 3LH5A 3D3QA 5FPYA 3T06B 2YWGA 2UZ3A 2AXNA 1RIFA 3K0AB 3WMGA 1ZMXA 2HEIA 4LJAA 3KUDA 3NBZC 2WWYA 4BLSA 3ZLJA 1ZRHA 2PLRA 2RCNA 2VTKA 2VP9A 5D3QA 4B74A 1VMAA 4LYHA 5E3HA 1Q3TA 1HEIA 3RLFA 3I62A 4D0GA 2GILA 3SZRA 4K81B 4GDFA 3K0AA 3MCAA 2CLSA 1VKJA 4BPBA 2GWHA 2OLJA 4U7DA 4JLKA 1QHNA 1TX4B 4RY2A 4HATA 4DHEA 2ZRDA 1WB9A 2CMKA 3GJXC 2G1KA 3OEHD 1XEWY 3HU3A 3W8NA 2REOA 1DELA 2AFHE 4Y0AA 2GEVA 4DKXA 4G01B 3NG1A 1Z63A 5AJVB 1TU4A 4M9XA 5FUVA 4EFNA 2GBLC 1R5OA 4MKFA 4UXHA 5EZ6B 2XSZD 1JEEA 3I8SA 4Y0VA 2AN9A 4UNPA 3THYA 2HUPA 2IYUA 1FPMA 4LV6A 1Z8FA 3MWYW 1J8MF 4ZKEA 4JYBA 3T61A 3TUIC 3FOZA 1XD2B 2IK8A 3BIFA 1GOTA 1YE8A 2ZS9A 3FTQA 3THOA 4JS0A 3KFXA 3OZXA 2ZYWX 4WZ6A 2CLCX 4JVNA 4BZPA 4PAOA 5C1BA 3Q8XB 1MH1A 4D25A 5EUQB 1OH5A 2GZHA 1ZBDA 4K8OA 1YR7A 4GOJA 3AV0B 4Q1EA 3KQUA 5KSYA 1G6OA 3LAWA 2NTYC 2QQ0A 3AUXA 3LVRE 3PR1A 2B8TA 3KUCA 4HZUA 4NYMR 5SZHB 4BUJA 5C2JB 1W5TA 3C8UA 4QGAA 3P4XA 2QMEA 3JVVA 1VCNA 4TTRA 3CPHA 1W47A 2ZRMA 4JLOA 1E9BA 4WVFA 2WWIA 2IXFA 3RC8A 1AM4D 3D7MA 2FFBA 4JLJA 2ANBA 1Z47A 1QHHA 4ZDIA 1TQDA 5B57C 1NN5A 4YC7A 2XEXA 2WKQA 1E1RA 3OAAD 5L3VA 1QZXA 4ZCIA 1ESMA 5EJEA 5C4MA 2AWOA 4IVQA 4LV5B 1NRJB 1IQPA 2IWHA 2V9PA 3LO5A 1QG4A 4PXAA 1OB5A 1ZAKA 1G8PA 1OW3B 3KB2A 4URZR 3EWSA 4A2QA 3BK7A 2MSDB 1V5WA 1ZD1A 2QTFA 4O2RA 3UMRA 3CPEA 1YQTA 4DEXA 3VKGA 2A3RA 3SQWA 2QP4A 3KXKA 1ZUHA 1DO0A 1XCMA 1JQJC 5EXXA 1G4UR 1YRBA 4B32A 3TSWA 5BN3A 1OYYA 4A1FA 4P0TA 1DAEA 2ZRGA 2HXYA 3W9YA 4RJLA 3AF0A 4KITB 1GAJA 1I4DD 4MKHA 4LBZA 1S2MA 3GD7A 4Q9IA 3ZIAD 1JI0A 4Q47A 4HDOB 2RGEA 4XH9B 3SHWA 2ODEA 4ZV4A 4A8JB 4G5SA 2SHKA 1IN6A 2CE2X 3PEVA 1N6HA 2B8WA 3OIWA 1E1QA 3QBVA 4XSGA 3UG7A 2V3CC 4PAQA 1WP9A 4B3CA 4YXWD 4DLSA 1HQCA 2RGGA 3BBPA 4Q18A 4TMKA 4M4SA 4CDGA 3QXSA 2ZSBA 4LJ6A 1T8UA 5FL7A 1EFRA 3UIEA 1NVVQ 3QKRA 4DLZA 2QBYB 1KI6B 4Q21A 3BJIC 1UBFA 1PJRA 1ANKA 1RRFA 1MO5A 1SXJC 2YNMA 4YMWA 4DCTA 2CEAA 3VHLB 2WKPA 2VHQA 4BASA 3SYNA 1D2EA 2FNAA 2O8DA 1Q3HA 3BWDD 3LLUA 4TYQA 4DDTA 4D4LA 1QHHB 1ZD8A 2C5LA 4DVGA 4I1VA 3IEUA 4IVRA 4ZO4A 2QORA 2BJWA 5FR2A 3BOSA 2C77A 3C15C 4LUCA 4M0LA 1TNDA 3SYKA 4JT2A 4B6FA 4NBSA 4KFSA 3LDAA 3U3RA 5JECA 5HR5A 4AD8A 3GLHB 3QNUA 4EFLA 3CWZA 2G77B 1SXJE 3LY5A 2JIZA 1P61B 3KQKA 2A7QA 4DWJA 5GVRA 2QAGC 2XOKA 1U8ZA 1YRAA 4JBYA 1W0KA 1U99A 1JR3E 3NIBA 4EPTA 2I4IA 1E2HA 1P75A 2ASEA 2ZYVX 3HP1A 1G8YA 1NN1A 1YZGA 1TUEA 4NCJA 1G3UA 2GJ9A 2J0UB 3CRMA 5BWMA 2FH5B 2OLKA 2QGZA 4JIMA 4U5XA 4B43A 3GLGE 3H1TA 3VR3A 4B3GA 2A5GA 3DZDA 1ZM3A 2I1QA 2P6UA 3PIRA 5E7JA 4B48A 5J4YA 1KO5A 4US0R 4KODA 4XJXA 4FMDF 2IHYA 3S1AA 3VU9B 4RKEA 3FDIA 2Z6VA 1J8YF 1MKYA 1RRCA 2WSSD 2XAUA 2ZVQX 5BN4A 3GFPA 5J4HA 1L7VC 4CEIA 2QMHA 4GT1A 1EFCA 2AWNA 1CULC 3EPLA 5KNCA 3CIOA 1AGPA 2CL0X 4H9GA 4MYCA 5HKKA 1XMSA 1Z2AA 3NBXX 4KBGA 4R98A 4E5UA 4EQ6B 3MWJA 3TR0A 1G18A 2RKOA 5FTKA 3K9NA 3U3KA 2QP3A 4UJ3A 1HTWA 4OHZA 1KI3A 1W2GA 1OF1A 3OIYA 2ZI5A 3CF0A 1NMYA 1I2MA 1UDXA 3I3SR 3EPKA 1LF0A 2DWPA 5JLJA 4DT1B 1TL7C 3VR1A 2D2EA 4A2PA 2ZANA 4Q4JA 1IN5A 1IN8A 4B2IA 5G53C 1W4BA 2BDTA 2IYRA 3FKQA 4G3XA 4DLRA 4LBWA 5F98A 3B1WA 4KSBA 1KK3A 2OBMA 3OFNA 1KSJA 3OEED 4PX9A 4RKFA 1XXHB 2HDNB 1TF5A 5AJZA 4L8GA 2IYLD 3QUSA 3MD0A 1GKUB 3L0PA 4YDSA 4F38A 3PUZA 4CW7A 3WRYC 1WBDA 1VCIA 5AWFC 1YR6A 1E96A 1E98A 2GVZC 2BOVA 4FMBB 1XEXB 2D62A 4HLUC 4MGIR 4DCVA 4Q7LA 5KYKA 3B2EA 1Q12A 3CM0A 1N6NA 4QHSA 2AD5A 1KMHA 5JMTA 2XSZA 4P4UA 1UBEA 3FHCB 4KBFA 3TGPA 1HUQA 3KTAA 2YC2C 1P2SA 5BYKA 1H65A 1R5BA 1YZLA 1DEKA 3TIFA 1XEFA 2C9CA 3RRZA 2CK3D 2R2AA 2IXEA 3CH4B 4H1VA 3NC1C 1F5NA 4LYJA 3ZD6A 1OFIA 4MITA 3UMFA 3FFAA 2WICA 3LBIA 4XVQA 2V54A 3K0SA 4C2TA 1E2PA 4E09A 3W5IA 4GFDA 2DCUA 2FSFA 2ODBA 4V0MA 1PLKA 1RPZA 2VHJA 2CVFA 3KKPA 4P33A 2QPTA 2HV8A 1OPXA 2XX3A 2ZR9A 4RD6A 3U61B 3H4MA 1NG9A 2IC5A 3M4YA 4HEJA 4M21A 1GKYA 3TE6A 2GETA 2GVDC 2X2EA 1K5GA 2ZR7A 1CJVC 4L9WA 1MR3F 1MO3A 4US2R 1L8QA 1CR4A 5L3QA 5K8TA 2IYSA 2WJJA 4TT3A 2ZJBA 1TQ6A 2ONKA 3QKTA 3U7GA 1SZPA 2BCGY 4BLTA 1OIWA 1J99A 5J4LA 5LD2C 1J90A 2V7QA 3MJRA 4KFTA 4PQYA 3T35A 4EAQA 1K8RA 3B82A 3C5CA 1N6PA 3Q5DA 3AVQA 4XD7A 1ZYUA 4NCHA 3UMSA 4JL5A 3QPVA 1RKBA 3WBJA 2CHQA 3ASZA 4BQSA 821PA 5JEEA 3UWKA 1EX7A 2W6JD 3GQBA 4XWKA 3CR8A 2CJWB 4DUGA 4MGYR 5B64A 3KXIA 1UBCA 2QRZA 3LD9A 4DB2A 1ZIPA 1EG7A 4OI1A 1VTKA 3CKLA 2P5TB 2ZE5A 5F2EA 3AVYA 3W5JA 3IPYA 3RSLA 1VG1A 4ASUA 4DXAA 1N5JA 4TMVA 3K09C 4IFEA 4Q9JA 1XBTA 1GL9B 2JASA 1C9KA 4B6EA 1G3IA 4ZKDA 1ZJ6A 1BO6A 4Q1FA 4D80A 1X8LA 3NDPA 3TW8B 2OHFA 1LS6A 1QG2A 4TL6A 5JBQA 1X3SA 1Z07A 1KHTA 3RDPA 1TMKA 4JKYA 4TYNA 2YOHA 2AL7A 2W6ID 1E9RA 3NEJA 4KFUA 2ODWA 1RC8A 3AVXA 1BH2A 3THWB 1AA9A 2R9VA 5EQTA 4RFVA 5AJYA 4US1R 5EE9A 2WWFA 4QGGA 3A58B 2WSSA 1E0SA 1XF9A 3UWOA 4YQFA 4PZYA 2OZEA 2GCOA 4K46A 4NDZA 3GLFE 1OE0A 1KKMA 1FUKA 3RABA 1TEVA 1AJEA 4IEEA 5KSOA 1GP2A 4C9BA 5HKKD 2NO7A 3DOFA 3QKRB 3RYTC 2H8KA 4ZDKA 1E79D 1YHNA 4IOJA 3AKYA 3I92A 2PMDA 1IXZA 2QAJA 4Q01A 3U2QA 2FWRA 2GK7A 1SVKA 2W6JA 1NLYA 3DDCA 5TXGA 3W3AA 1Z0AA 1K5DA 4ABYA 1KI7A 4F91B 2XXAB 4OKSA 1N0UA 3TAHA 3JZAA 5KDLA 2ANCA 1XPOA 1TTTA 2IA5A 1I4LD 3TVDA 4AKEA 4CIDA 3PENA 3D6TB 3I1FA 3LVQE 2FSHA 1H8ED 1GILA 2OFXA 1P5ZB 1TEXA 4Q7JB 4S2EA 2ZXUA 2D7DA 4JL6A 3F0TA 3BC1A 4JLMA 1GNQA 1W0JD 2C96A 4TMWA 4F7WA 2WJHA 3HR7A 3B9QA 1D9ZA 1Q1ZA 1RVDA 2IS2A 2YV5A 1IXRC 1Z5ZA 3ND9A 3AVOA 4PPNA 2E9SA 1DS6A 1FFHA 3Q3JB 1QHIA 4ERNA 3VHXA 1GG2A 4KJZA 2GAAA 2WMNB 3IIKA 4BFVA 1M7HA 2ZI9A 2YOGA 2A5YB 3W90A 1E2LA 3CX8A 2CBZA 2ATVA 4QBFA 4DDUA 5KDDA 2P6RA 2ZS8A 4LBYA 4AYXA 1OKKA 4XSHA 221PA 1T91A 4GL2A 1EFUA 2JAQA 4HYYA 4MKGA 5HPYB 3AM1A 2FGKA 2EWVA 1DBSA 2XNDA 2RGDA 3ZVLA 4AIIA 3ZH9B 3NWJA 3VNUA 3K8YA 4I1SA 1Z0JA 1XTQA 4ZPXA 2YZ2A 2ZRAA 5CIQA 1WXQA 1EK0A 4B34A 2NOAA 2D7CA 3F8TA 4I1UA 4L15A 4PO1A 3FKSA 5DI9A 3T1OA 5EUMA 3GJ4A 2XZLA 4V02A 5H70A 4GSYA 2DFLA 4HDCA 3U5ZB 3LW7A 3WNCA 1UJ2A 2Q6TA 2PT7A 2QPAA 2QAGB 5FPKA 1XJQA 3OE7D 4Q4JB 1X86B 4E03A 4PC2A 3GLFB 3LX5A 1TQ4A 4MRSA 1RE0A 2QM7A 2JCSA 1N6IA 1VG0B 2QY9A 3LA6A 4NONA 4UXIA 4EJSA 1LV7A 1KDPA 1Q1BA 3A4LA 3TRFA 2PMKA 3A6PC 2BBWA 5HZKA 1W5SA 1CR2A 1Z0FA 4QNRA 1XD9A 4KCGA 4Q5IA 1S3GA 1U0JA 2BBOA 2WV9A 4LGMA 1NKTA 3NC0C 1ZCAA 3OIVA 1BMFD 4CEIB 5EE3A 4KVGA 2O8CB 2CLDX 1XXHA 5AJXA 2FE4A 1U8YA 4MGZR 1OH6A 2B92A 4TL9A 2YKGA 4B3XA 2KB0A 1NJFA 1JR3D 1E2IA 3TJZA 3TBKA 2RGAA 2JLQA 1UPTA 4BFXA 1KGDA 4L16A 2C78A 3W3ZB 3LQRA 3U4QB 2EFCB 1VCOA 3Q5EA 4LBVA 4NYIR 3X1DA 4UXJA 1HE8B 3DKVA 4B73A 1DADA 1Q57A 1X8KA 2BMJA 2IW3A 4Q4LA 3LRPA 1AN0A 1KAOA 4MYHA 2ZAMA 1ZNWA 4LJ7A 1F2TB 2DHRA 1E2NA 3IBGA 1Q22A 4V03A 3WY9A 4HUTA 4Q7MB 5F9HA 1R0YA 4RD0A 3ZYCA 5DN6A 1RYHA 3BFKA 1E2FA 2G6BA 1FTNA 3KQHA 5HE8A 1G17A 2QM8A 2CE7A 2GCPA 2QBYA 1ZNXA 4ZI2A 4JSYA 2I3BA 3Q7PA 4IHQA 4KHZA 4TL8A 5DI3B 2F9MA 4JVLA 5HE9A 4DSUA 2RGXA 4WOPA 5KDOA 1ZVQA 2BV3A 4TLCA 2X77A 3THXA 4B76A 2XB2A 2I1VB 6Q21A 4RZUA 1OXSC 2GZDA 2XTNA 3QBTA 3BH0A 1P62B 2W00A 2DWOA 2OT3B 3WYFA 2AFIE 4A8JA 1JBKA 3KJEA 1FZQA 2F3RA 5FPTA 1D6JA 1IBRA 1HT1E 2QUZA 4MQBA 1BMFA 2O5VA 2P2LA 1KDOA 4TWZA 5CM9C 3GEIA 1DARA 1AK2A 5AR1A 3WP0A 5K8LA 5FUXA 3ADBA 5B30A 1N5LA 2WKRA 2NO1A 4A15A 1KZ7B 2W6IA 1E1QD 2BMFA 1CJUC 2CXXA 2EFHB 1G3QA 1UEJA 2W0MA 3QVVA 3O8CA 3KJHA 5P21A 3GMTA 2HJGA 5DI3A 2F55A 2HT1A 3FE2A 1OFUX 4UNSA 5D3MA 121PA 2ZI6A 4LY6A 1ZW6A 2ZU6A 4PO8A 4PPGA 4MA4A 5C18A 3ZIAA 1E3MA 3ZS9A 1G1MA 2FZLA 1JQLB 1EFRD 4QM7A 3IILA 2JEOA 1JPJA 1XB2A 3FVQA 4GNKA 3A36A 3X1ZA 5F3WB 1FMLA 1GL6A 2C2HA 3PEUA 2QENA 2JLXA 5HCNA 3ZS8A 4Z8XA 1Z83A 4CEJB 4G5QA 1Z22A 1GRNA 1Q1EA 1U9IC 4LI0A 4B71A 4ZCMA 4D2IA 3GJ5A 4KI0A 3K9HA 3PEWA 3P27A 5CK5A 5LB2A 3ZZTA 2FEMA 3AF3A 3K53A 4GOXA 2FSIA 4QXAA 1VECA 3FMPB 1SKYE 1COWA 3PUYA 4JLPA 4AURA 2R8RA 1ZM9A 4OK6A 3GJ0A 1KSHA 1XEWX 4EUNA 3AEZA 4IVPA 5C4GB 1E0AA 2OESA 2IT1A 2O8BB 3ADCA 2QNRA 3CPJB 1J2JA 4H1UA 4AKGA 4YLGA 1SVMA 5FH9A 5L3RA 5FPHA 3H84A 3B7GA 3FHOA 2XJ4A 1P2TA 2C95A 4EKDA 3CR7A 1CR0A 4X8HA 1A2KC 1F2UA 4MH0R 3KJIA 4P32A 1D5CA 2UZIR 4CEHB 2DPXA 3THYB 4Q1AA 1HT2E 5TMPA 5CB8A 3EZ9A 1GIAA 3K70B 3QKUA 3X2SA 1W0JA 2OE2A 5FR1A 4C0KA 4CRWB 3DEFA 4G5RA 4R2IA 2G83A 4NYJQ 3H2YA 3GP8A 3EW9A 5JJIA 4Q4AA 3A4MA 5AUOB 2JDID 4E22A 3QG5A 3BRWD 2O8FB 2JIZD 1OFHA 1X8JA 4URXR 1GNRA 3L0OA 4D6PA 4RD3A 4XIGS 2WPDA 2RGCA 2Z4SA 3QQ5A 1TF2A 3GJ6A 2AD1A 1CU1A 5AUQA 3QKSA 3PQCA 4Q9HA 4B35A 2BBTA 4G5GA 3B85A 3CWQA 1G7SA 1WMSA 2D74A 4NCKA 4A6PA 3GEEA 3RS4A 4JLBA 1E6CA 3AGQA 1PVOA 4NPHA 3FB4A 1DO2A 4C0SA 5TDHA 2OO7A 1NMXA 4CVNA 1ZUIA 4MUBA 2AKAB 1ONBA 3BH7A 2ZJ5A 2QSZA 2HF9A 4QJ3A 4CT5A 1FMJA 2CCKA 1LFDB 2R6GA 1VYTA 3OF5A 1II8A 2HXSA 1IN7A 2EYQA 5G41A 3CNLA 4Z8YA 3PJRA 1BIFA 1F60A 3NHAA 3CZPA 4C4PA 4DCNA 3VFDA 4LHWA 3G82C 1WCV1 4PPQA 4J0QA 1KZGB 4OI2A 2O0JA 3N2IA 4C7OB 1R8QA 2IF0A 1GSIA 4IDHA 4V0LA 1PZNA 5FOWA 1L2TA 1OXXK 4A0RA 1SKYB 3CUEF 1FNNA 1S1MA 5KO2A 2V55B 1SQ5A 4G1UC 3TK1A 4KLNA 2IYQA 2NPIA 1HYQA 4IDPA 2JDIA 3ECCA 3Q72A 2H1LA 4QBHA 1CF4A 2FPMA 2B21A 2J46A 1XTSA 2NO0A 1KJZA 3QPUA 3A1VA 4YONB 3QF4B 4TLAA 2H57A 1R8SA 2C04A 2Z5FA 3RS2A 2FFAA 4QHTA 5DYGA 3X1XA 3R9XA 2QMUA 2ZJZA 1KY2A 3DMDA 2KE5A 2VP2A 3B1ZA 3GLIA 3ICQB 2ODNA 3PCRB 4KFRA 4WXPA 3M6AA 1DAFA 4LPSA 2O0KA 3QF4A 4FN5A 2PT5A 5FTLA 3I5XA 3ASYA 3TAUA 1DPFA 3EARA 3SI7A 4EPWA 3U6KA 4A0HA 5DN6D 3A1WA 1UKVY 1TAGA 3LWNA 5FOVA 3K0FB 1IY2A 4JVSB 3I61A 1PUJA 2OCAA 1XJ0A 2EW1A 2ZRHA 3WYGA 2EFGA 3U6BA 1CP2A 1NNEA 3EAQA 4PSKA 4DDWA 4MRNA 4LCBA 3TQCA 4Z51A 3ZVNA 3WRXC 4QBGB 1LNZA 1M74A 2J7KA 4OBEA 3FGNA 5G3ZA 2QTHA 2W58A 4I99A 4LJ5A 2C9YA 4BLOA 1RYFA 2QT1A 1KO7A 4GRAA 5DH9A 1US8B 1W4RA 2FSGA 3V00A 1R5NA 5KTYA 3ZJYA 3IIMA 3WMFA 2BBSA 4BZQA 3F3YA 2CJWA 2QT0A 4C0JA 1BKDR 1CJMA 1U8AA 4HAYA 5EP3A 2AHOA 5JFGA 1YZTA 2FJUA 1OFTA 5IHPA 1GKIA 3JZMA 1N6LA 3E5HA 3QEJA 2QEQA 1YZKA 1T5LA 3EC1A 4IOLA 3CONA 2FMXA 2Z43A 4RD2A 3DKPA 2P3SA 2DFNA 3O8RA 4Z1MD 4HI0E 1QHXA 5EE0A 1RJ9A 4NE2A 5E4FA 1OV4A 1Q44A 1UFQA 2DB3A 1WF3A 4XTRA 5DSZA 3SJBA 3EA0A 4LWZA 2J0UA 1KSFX 3IKJA 1HURA 4OQLA 4LJYA 4F4JA 3GFOA 3SJCA 4DSTA 2IS6A 3U44A 3DOEA 3QXCA 1KSGA 2RGBA 2OFWA 2PJZA 1P9WA 4NZYA 5TVKA 3SU8A 5KHOC 4EPXA 5KNDA 1U98A 2OCYC 3UANA 2VEDA 1LW7A 3BAFA 2X2FA 2OXRA 5E7IA 1XCPA 4PQFA 2QTVB 4F4IA 1G5TA 2WJVA 4JJZA 3TSZA 1A2BA 4D81A 1GVNB 3KXLA 1DAMA 3G0HA 3K1JA 4NKRA 3P20A 3PUVA
chains in the Genus database with same CATH superfamily
1U4NA 1U8EA 2IYTA 3LLCA 2RAPA 2CXQA 4J16A 5KU1A 1GFIA 4KXQA 1ZD5A 4M37A 2IXTA 1I2AA 1E0JA 4NBWA 2DQZA 5CA1F 1WO8A 1UBGA 2ZBPA 2Y99A 2CHUA 4GR9A 3K9WA 3DM5A 4BBPA 2OGUA 2V7BA 2O8FA 1UMCA 3F9CA 4ITRC 4UU7A 1L8AA 3VNAA 1R0LA 3QHAA 2ZIAA 1CUDA 2FPUA 2N9UA 3T34A 1NURA 1I24A 5IWAB 1TJPB 1CUBA 1JLKA 2FK7A 2ENUA 1LQUA 3EDCA 1C4XA 1KEZA 3IALA 3T15A 3U5TA 4TYYA 1U81A 2YZNA 1RQGA 2O2GA 3PX3A 5FUWA 2F1OA 3G0IA 1CZNA 1GUDA 2J3MA 5JE8A 3VI3B 1HDYA 5KWEA 4QPZA 4WHMA 4PGGA 2JI4A 2HTFA 2VNKA 4QRHA 3UG6A 4BQIA 3MAGA 4JELA 1U94A 3DE1X 4J7UA 5CVEA 2I66A 1B26A 4E2ZA 1F14A 4INPA 4IX9A 1AZLA 5NLLA 3E9MA 3VZQA 5AM3A 4MR9B 4C3ZA 4PC7A 4OHPA 1VHJA 4RM2A 3ORFA 4KDCA 3HL4A 2FQQA 1TCUA 5AVWA 5J4KA 3SHQA 5JSZA 1O6GA 4NLLA 1PQYA 1J07A 3EGVA 3UPUA 3PC3A 4KWIA 4IGEA 1E2BA 3EPPA 2X8JA 1FMTA 1XZPA 1EG2A 1KDTA 1BN6A 2GJ4A 4O3MA 3RYFA 3WGZA 2C0PA 3F1KA 1X6VA 3W2IA 1LVUA 1XDSA 3U40A 2QP9X 2IZ7A 3OPYA 4HDNB 3P0JA 1AK9A 1PL8A 1USKA 3LCRA 4II7A 3NJ8A 4PZAA 3EGCA 4KB5A 2G0NA 1NBMD 2IEGA 1JXQA 1ZEMA 1TTPB 1Y6ZA 2PUGA 2YOFA 1GNPA 4DT1A 4DG8A 1SCJA 3ONDA 3AKZA 1T2CA 3CEPB 3Q7TA 4Z86A 3E35A 3N8IA 2OHOA 5SV2A 3PNLA 3PPWA 1CY7A 2PMEA 5JRZA 4I5DA 2FN7A 3MGCA 4GZ5A 3AR2A 2A6PA 1E2UA 3C16C 3CUTA 4MX8A 3V55A 4KVAA 1B8VA 5IDXA 1J42A 5KS2A 5JDIA 3EVNA 2C83A 3H3JA 1L1QA 3IE0A 2PLAA 2VDMB 3ICOA 3QVWA 3BXZA 2DR3A 1YIDA 3CW8X 3GHYA 3QVXA 1XXLA 3MJDA 5KU7A 2HLDD 4S04A 2ZJFA 3EVGA 3GAAA 2A0WA 3FZQA 4JXXA 3T7KA 2XDWA 3ADDA 1R50A 3V9AA 2JGAA 5GV7A 5GJBA 4ZT3A 1RZ3A 2ZW9A 4X8LA 4OGWA 1OBVA 4FS3A 1EUDB 7ADHA 4B7AA 1FMFA 1CK4A 3W5DA 4XWOA 4WFKA 1T4GA 2N0SA 2H00A 2GESA 3VMFA 3WDKA 3GPCA 2H17A 2XT0A 1CRZA 4PLZA 1SXIA 1P6UA 2GN4A 1H1LA 2OG1A 3R6TA 4R3UC 2WP8J 3LMKA 4XA8A 2WK1A 1UXIA 4FDMA 4FUQA 5AP9A 4Z54A 3INNA 2H54A 2ZIWB 5HS4A 1QVRA 1KO1A 3EVEA 1HOXA 1U3WA 3KBOA 3MNFA 4LV8B 3MG9A 5FX2A 2XMCA 2D2FA 3KG2A 3FSJX 3OZDA 1YA4A 3OF3A 4V0NA 1JRLA 1LPSA 1ODSA 1QQ7A 1V39A 1V25A 2H5EA 3BCSA 3Q9SA 3HEMA 3I32A 5IVPA 1TM7E 2KW5A 4K6OA 1A9XA 1NW6A 1SU7A 1IHYA 1JUDA 5DXAA 1J5PA 2VJYA 3LKDA 2HF8A 3OLQA 3MEQA 3OQMA 4IXTA 3GLTA 4AQYB 2Z98A 4KX3A 1TYDE 3K9GA 2Q3MA 3N86A 4NBNA 4GGPA 2VPPA 3LY9A 3THRA 3KQPA 4FKMA 3U3OA 1K92A 1MB0A 3OAAA 4NJMA 5DM0A 2WSMA 1JILA 3W4IA 1W4CA 1RE1A 2WZDA 2DFPA 3HJNA 1VE1A 4QRDA 4A82A 4UPDA 1H5UA 4D6YA 2HRZA 2WWVD 3VSAA 4DTCA 2A67A 1UZLA 1MVLA 3L18A 4BFTA 3TM5A 5D5PA 5C8XA 2I3DA 1ZC4A 1AGYA 2XT6A 3H3XA 3HH8A 3GGDA 3R0IA 5SYNA 1F8XA 1P29A 4RIFA 1IQRA 3QLVA 4HQRA 1ML4A 5JSQA 1BYIA 2BI8A 2DECA 3JQ7B 2QX4A 4EUSA 5FFFA 4OQNA 3SM9A 2ONJA 1IB0A 2FWJA 1JMKC 2WKWA 5FJJA 1T6YA 1Q1GA 2HHLA 3AUJB 1V1MA 1CBUA 1T8WA 3ANNA 1QQ5A 2QDKA 3M6VA 1S96A 3I58A 4M1EA 4OQFA 1JLHA 2R97A 5IS2A 5ETJA 1E2EA 2B1GA 2HZBA 4J0KA 3W2EA 2E4WA 2FX5A 2H1FA 4WEQA 3ZWCA 1YZUA 2XWPA 3CKMA 1ACLA 4FHEA 4I08A 4RCVA 4HH4A 5H9WA 4DV7B 1BGWA 1U2GC 2C3MA 3ZWVA 4L9SA 1Z8HA 4HAWA 1A95A 3D02A 3F9RA 1JBEA 3CLRD 3QUAA 1L3IA 3IIJA 4WBSA 3A6ZA 2VJCA 1NVMB 2B6NA 1R8JA 2WWTA 1E5XA 1U90A 3LKVA 4K7JA 4KO1S 4QNMA 1DRWA 2BJHA 4J0CA 1RYNA 3F97A 1FYXA 2FY8A 1P8AA 2EV9A 5ELLA 4L8LA 4MUHA 4BO4A 2O6HA 1H5NA 2PRKA 3FNRA 1SCBA 3V4PB 4ARZA 2DJIA 3QYPA 1JMYA 3CN9A 3GARA 1MAHA 1P1JA 1QTIA 3KPWA 2WF9A 1J1UA 2IYWA 3W6NA 4F6CA 1JJAA 4U6NA 2OR3A 2ZUDA 3JWPA 2QE7D 4P08A 5GPBA 4BNDB 2GXSA 4RQAA 2OV4A 2J4FA 2SKEA 2G80A 2QUHA 1GPAA 1MHPA 2COEA 1U7HA 1ZH6A 3B8HA 3CGGA 3IMCA 4L57A 4TSRA 2GEDA 5A03A 3G1WA 5JQGA 2PBLA 3QFCA 1NOJA 4RH0A 1HE5A 2I76A 3HVRA 1CERA 2C9BA 5J5AA 1UBLS 2Z5LA 2L19A 1G21B 4UAUA 3R5XA 4E0BA 1V47A 4XX1A 5AVXA 3NAGA 4XTCS 2JGJA 3SBEA 2PANA 3TWOA 1P7CA 2BHSA 3I2GA 1GQFA 2O7NA 3AKCA 2AFIB 3CLKA 5KUTA 1GPH1 1N2BA 4J4HA 3ZE7A 2QMOA 4RWZA 2WPDD 3C4QA 4UD2A 4C0LA 3CLTC 4QJ4A 3CH5A 3HN2A 4QOSA 4Z0HO 1VYUA 3DUWA 3FNHA 3UC5A 5CDSA 1SKAA 4MDEA 2GDJA 5HTOA 3A6EA 3HLYA 4CLEA 4R8KA 2B0JA 4BRZA 1ORDA 3BXHA 4N3BA 6YASA 1VPDA 4J29A 4NYMQ 3FETA 1KJWA 2W37A 3ZV7A 4EG0A 1HL3A 3L2OB 3BE4A 1RCTE 5ICMA 2EU8A 1U2PA 4BMOB 1U3CA 2IHZA 5K45A 1M2VA 4PRYA 1YU9A 3OIGA 4ALLA 1EVIA 1Q7BA 1EFDN 4B17A 4ZI7B 4M60A 2GXAA 2BFCB 1GG5A 3X1YA 3IOEA 4YJ2B 5LP6A 1IG0A 1TK9A 3EXEB 3U3MA 4UULA 5L8VA 2W43A 2EIXA 2PKCA 3S81A 4XQ0A 3OEWA 1PL0A 3R2JA 1BROA 2E5FA 3L6RA 3DFFA 1X7WB 4IEFB 3L04A 1PEDA 4H1WA 2K5UA 5JXGA 1GYPA 4IRMA 5F4ZA 3DQQA 2ZQ5A 4CF3A 1O6BA 1A82A 5LPNA 1NXXA 5ALUA 3S2UA 4ZQBA 2QB5A 1YACA 1T5OA 1R37A 2RB4A 2VJMA 3PITA 4GAEA 4KLCA 4Q66C 1R0ZA 4S3MA 3K09A 5DT9A 1JJ7A 3DL7A 4ZCRA 5BSKA 1E0DA 3HFJA 3RBXA 4KYIB 1BCSA 3O6VA 4YAJA 5CPBA 4F92B 1FX0B 1XZ8A 3A9SA 4OFZA 4CCAA 1MJGA 1R2QA 1XTPA 3D64A 4WXRA 4G4IA 1U2RA 3B6KA 4ND7A 3DEZA 2IS1A 4QG3A 1Y89A 1Y42X 2AK3A 4IZOA 3VJKA 1YZHA 1RMTA 1S7GA 3A8TA 4I1IA 3HVHA 1RMYA 1HG1A 2XPCA 4P38A 4KV9A 5CHYA 4AG6A 4NZ9A 4YP0A 3FCYA 3M4JA 3GFBA 2XB4A 4G5YA 1Y3DE 3W7BA 5HZHA 4O63O 2ZRKA 4YDRA 4QO8A 4BFZA 1PV4A 1W6UA 1YS9A 1WB4A 5K6TA 3L7AA 3TVTA 3G7NA 4ZZ0A 4AWXA 3BMQB 3S3TA 2JLRA 4DR6B 3I2HA 2F43B 3IJPA 1SULA 1WLYA 5JAMA 1SHTX 1B74A 2DUNA 2JGFA 5ALRA 2WINI 3BE5A 1LUAA 2IPNA 2OV2A 4CLRA 4WW0A 2ZSHA 3D7NA 4KIWA 4MUXA 4QECA 1N77A 4K9KA 4DJDC 3ZY2A 4RZQA 2BEUB 3A32A 4RYDA 3I30X 4FTWA 4O29A 1ZM2A 1ST2A 1QFYA 5FUYA 1AGRA 3KQLA 5EUCA 3V80A 4LK2A 2FRXA 2YIJA 4OLFA 5TGDA 2OSBA 2IUUA 1J8VA 1R15A 1YK0A 2XVZA 2DWQA 3ROZA 1G7RA 4WCFC 4CQLB 3IAEA 1KOLA 1JHDA 4FHDA 4A0QA 4C6TB 5GZ3A 2FW9A 5AI4A 3EF1A 3RE1A 5JTUA 4QFMA 2K2WA 2VJNA 1QF6A 3OEHA 3PQ3A 4Q0MA 4MWSA 2WWGA 1YMVA 3HGMA 2F59A 4QOEA 4E7OA 3EUEA 3JVEA 3LECA 4QTUB 5AJHA 2ZB8A 4OCZA 3IB6A 4LZWA 3CNNA 4N5IX 1YC2A 1RRKA 3F6RA 4HQKA 4JQYA 2F8LA 3ZVRA 3FMIA 3RC9A 2D5IA 4MCAA 4LOIA 1ZI9A 8ADHA 2GBIA 3VZCA 4BEBA 1L5HB 2F00A 2ZRLA 3CZRA 1Z39A 1VJGA 3EZYA 3L4EA 4NI5A 5KNBD 5IJXA 4RHFA 5GQSA 1QONA 3QYFA 4WI1A 2WJIA 2Z2YA 1UT6A 1XEAA 3DLAA 4OK3A 5EYPB 1FP6A 1TMGE 4Q12A 2XZOA 1MA0A 4JBWA 2F1RA 5GIOE 1U5AA 3EDOA 3FN4A 3K9BA 3UCFA 2X3UA 4IXDA 1LQTA 4P3YA 1ENOA 1KVSA 1U9ZA 3P19A 1J24A 3UW1A 2G06A 2EYUA 1SBZA 3N87A 1GU1A 1NMZA 2ZJ6A 3DA8A 2QAGA 5BN5A 1MW8X 2FETA 2IUSA 4J91A 4RL4A 5ES3A 3DE5X 4LNUA 4BO7A 3SVTA 3ODGA 1JDSA 2REXB 1Q0UA 3IBFA 4JROA 2LGJA 3L7NA 4NATA 3VX4A 1TA9A 2V8OA 4NESA 1P1IA 1U11A 1KFKB 4Q48A 4MP3A 1NQ5A 2Q50A 4EFDA 4LS3A 3ZW8A 2UDPA 1CY2A 3FDZB 1ISHA 3P52A 4FE3A 4OUDB 5GVSA 4FGWA 3OM1A 3LYLA 2W71A 4RVUA 4TVKA 3AVWA 3K9CA 4H6WA 1GCUA 1DB3A 1E9SA 2XNKA 1WDMA 3TG2A 5JCJD 1W0KD 1YCFA 2GKOA 4OU4A 4DC9A 3ZBPA 4LHYA 1OWLA 5H3CA 3HY4A 1C5KA 1XLUA 3Q3CA 5F1KA 5A7HA 3WBFA 1PQ4A 2HMUA 4NK4A 1Z8DA 4A92A 2AXPA 2VT3A 3IEPA 4JUDX 3OZRA 3WJ1A 1RLIA 4IJVA 1HLPA 1NE2A 1K0FA 2BFWA 4KGDA 1R1DA 5DM2A 4BQRA 4BE7B 2J7PA 3W34A 4ZVTA 2QW8A 1SJ9A 4ND2A 2R6FA 4OP1A 5L6MB 2J3KA 2CDRA 4KKVA 4R1UA 3AM4A 3C7DB 4I1OA 5FBZA 2ODQA 2X0NA 4NHEA 3DF9A 3W06A 3T7JA 2VSFA 4UHBA 4U4AA 1GZ5A 3UHOA 2BGNA 2PKRA 1CUVA 1UM8A 3KAPA 1SXJD 3TMAA 1SOUA 1QB8A 2Q8QA 3MTQA 2ORVA 2C7OA 2EVWX 1OXBB 4HYQA 2NUAA 2I7VA 2C4MA 4HWGA 2WU3A 5DP1A 3H7AA 1SCIA 4OAOA 3M1IA 4YMTA 4X1IB 4Y1RB 3JCZA 3SN6A 4LOKA 5JD6A 4JKOA 4BTEA 4HS4A 2BKUA 3NS7A 1B6TA 1T3HA 3DOJA 3TNFA 2PSHA 4IZ6A 1XWIA 2CSXA 2QM3A 2D1YA 4LXXA 1Q83A 3HWX1 5JBIA 3ZXXA 4U2CA 1UADA 3KV1A 5EE1A 2VIIA 2R751 3DMGA 4MWDA 2CXSA 3GLHA 4CU2A 2D00A 2WQ6A 3BHNA 4FOOA 5C1DA 4ZC1A 4KQWA 5TIIA 3V2UA 3T4XA 1XTZA 4X20A 4QJBA 3DE4X 1QS0B 3ZQUA 1Y3FE 4GQIA 3R20A 1LRJA 4GOMD 5I5EA 4BX8A 2GSWA 5DO9A 4HGPA 2C29D 3DE7X 1HZZC 2QYOA 3MPUA 3NWPA 5JNVA 2PLNA 1DEXA 5F9MA 4DF3A 3HUUA 1BW9B 3D0RA 4P4GA 2H65A 1H2FA 1W88B 4HSEA 5ERYA 1DMSA 1PZMA 2FR0A 3DC7A 1R74A 4KMOA 2Q3HA 2ZG6A 4L9AA 4PGHA 2HJHA 2TMDA 3T5GA 3U13A 1DG3A 4HLDA 1XPUA 2OCDA 5CA0A 2W2TA 4RXUA 5IM5A 4AX4A 4HEA1 4CV3A 1VBNA 4CTKA 1YOVA 3WLQA 1PWXA 3R4VA 3L8YA 4ND4A 2E87A 4C4XA 4FONA 4PC3A 3FPLA 4GYWA 4TKMA 4DUYB 4QD3A 3WYAA 1KPGA 1QIMA 2WT9A 4WGGA 5COAA 3UW3A 5BQXA 1XTKA 3IVGA 1UC9A 2G1JA 3O4HA 4F7DA 5BXQC 3R6GA 2QRHA 5AW7A 1Z4QA 2CYAA 2PRSA 4WH0A 5AK3A 2I4LA 3U7JA 1TEHA 1KKUA 2H8GA 3FCCA 1S9DA 3WJAA 4I55B 5B58C 1S3SA 3WLRA 4ENTA 2OXCA 2FN4A 1Z88A 5I45A 1GPWB 2Z4TA 4WKBA 1EJ2A 2NU9B 3RR2A 4F5DA 5AM5A 4A6DA 2VK8A 3AEKB 5ENDA 3KSAC 1SY7A 4CQJA 3QI2A 1ZK2A 1L4EA 1ZVVA 3R3UA 5K4HA 2PVSA 4MWZA 5CVCA 1VGVA 5L9AA 3CVJA 2GJSA 4U6SA 4W7SA 4YAFA 1KFJB 4M9RA 5U9CA 2XUKA 2ZTMA 4WADA 2QX8A 2FKNA 3ORYA 4N65A 2JA1A 5JS2A 1E9CA 3EZNA 4KUEA 3KKLA 1J7JA 1D2AA 4LJ8A 3OHMA 5LP6B 4YJ2A 4FPXA 1KI4A 4TMYA 1DUIA 4UEOA 2DKNA 2X42A 1NP6A 1AF7A 2F1HA 5IW8A 3F96A 1IOZA 1M6WA 1TQ2A 2UYQA 3CF4G 4HWKA 4IDCA 4QWMA 4QXQA 4XIJA 3I64A 3EXHC 1PT7A 2W7TA 1N75A 3B52X 3CNBA 4NBKA 4E5VA 4HX9A 1NXOA 2WYHA 4G0WA 1NSTA 3VOAA 2HT6A 1GUFA 4OM7A 1M76A 3I2JA 5TARA 1XT6A 4TSFD 3JQFA 3CX4A 3P32A 2PX5A 3F3MA 4X61A 1L4NA 3OU7A 4NEGA 3RC3A 2WAYA 1QO9A 2P4HX 2XITA 3MWFA 2RSLA 5J9FA 1PUXA 4C0QC 3GP5A 3S44A 2CSUA 5DTRA 1W4ZA 5FKJA 4AS2A 2Z83A 3M81A 1ISJA 1FYDA 2CVZA 2VL7A 1F6BA 2PA0A 4WZZA 2PEZA 2VCHA 1BE6A 1KYYA 1M6VA 2WJZB 3CUYA 2QRLA 3K31A 1TZCA 4PS0A 1NBIA 1AGXA 4R1QA 1HY3A 4JWKA 4O25A 3HU2A 2C99A 1HBJA 1KH1A 3GGJA 1IXYA 1DCFA 4KUGA 3BTOA 3ZCUA 5FL7D 4N9QA 1AY0A 1WS6A 2CVQA 1OFGA 3H1AA 4FQ5A 1YDFA 4F2HA 3I4CA 3UYKA 4MCJA 721PA 4O5AA 4ZU1X 5C80A 2G25A 1P2BA 1W19A 2IUTA 2GAFA 3GVIA 4M8NE 1N2GA 1N5OX 4HL6A 1MIOA 2CF5A 1P4SA 2PFKA 2IUFA 2XCIA 3A26A 4X8MA 3X1WA 1GARA 2G4CA 2IZ1A 2YYYA 4QEKA 4EY8A 5IK2D 5JT1A 4QM6A 1L9KA 3D2CA 3H9GA 1W1WA 3HKDB 1XRNA 3JAWB 3HB5X 4GD3Q 4NCXA 4PHGA 4Y9TA 4E5PA 3M5WA 3TZBA 5GZ1A 3EEQA 1FUUA 3JQBC 2CVHA 3U7IA 3J81A 1E5VA 3OURA 4LZJA 4M49A 5CJPA 2N75A 4LOJA 2Q5EA 3K15A 2UU9B 2Y3IA 2PUVA 3DZCA 3NHKA 3UUGA 4UHFA 1VKNA 1USWA 1U3VA 2D4AA 3KSMA 3GRCA 1GCGA 3L5OA 1RRMA 1T9AA 2AFHB 2QTAA 2BGJA 1NIPA 2OV1A 3F6PA 3HB1A 4LN1A 4BV8A 4JN6B 4YMUA 2B78A 1NQUA 2O52A 4YECA 5EJ4A 1EGAA 2AT1A 4DCUA 4EKYA 1XNJA 1HDIA 5CHEA 1DRKA 2PX8A 4EEKA 3A1CA 5I01A 1P8JA 2X0JA 1MXFA 1N2ZA 1N34B 1G21A 4Y1FA 3DAHA 4EEZA 5GJCA 1ESDA 1ORHA 3DFZA 4FGSA 1KK1A 1RVV1 1T8PA 1X38A 1FF9A 1QH8B 1Y7IA 3NHJA 3BE6A 3T3PB 2BSXA 5JYEA 3GY0A 3TFQA 4QUJA 3E9NA 5ENZA 1J0BA 4LOHA 4G0YA 1XVVA 2BTQA 5EIBD 4ENQA 2C03A 3L0YA 3NQ41 2QTTA 4FCWA 3UT6A 3VR6A 4EY6A 4CM3A 3EDRA 5HUJA 2XGJA 1X7XA 1X80A 5BSGA 2XY4A 1O6FA 2ORED 4BUZA 4D4MA 1DXQA 2GN0A 3ABIA 4MO9A 3WC4A 1K6JA 2Y1GA 1KWGA 1L3BA 1YZYA 3HA2A 2OC9A 1DOAA 4UHHA 1JPNA 2QROA 2WZBA 1TM5E 1Q74A 2ZRCA 3Q9LA 2ECPA 2ZWOA 4OEHA 3SSNA 1SVOA 3JW8A 2R65A 5EP4A 1BGXT 4D9KA 2FZ5A 1ZG3A 1LF5A 4HDSB 4YT8A 1QFSA 1A2QA 3EPHA 1COWD 1QBKC 2C7GA 4JY7A 2ZE6A 1BQ4A 2HA6A 4KMSA 3LP8A 4RTQA 3GYGA 2A1TR 4MQUA 2BJVA 2GWRA 4HUJA 3KZVA 5FO1A 5G1OA 4DJAA 5I7SA 1Y63A 5ITZB 1O08A 5B7PA 4TTPA 2P6NA 4H6PA 3VH4A 1IZ8A 2NX2A 3G02A 4LHXA 1IWOA 3NFRA 4J07A 1RFLA 1SGWA 2HK8A 4P7GA 4HFJA 3JQ7A 4CKEA 4N0DA 3THXB 1KMNA 5HIMA 3L6EA 3U60B 3N8DA 5CDHA 2EG5A 3BD9A 3I28A 3KQWA 4QYMA 4AP9A 3EGWA 1TK2A 2QIOA 1FUIA 2WG1A 3UKOA 1FSSA 3QIVA 2EARA 3EVZA 1DX9A 3DDOA 5K8UA 1E7MA 4LWQA 1HWYA 3AUSA 4G36A 3HKCB 5J59A 3T54A 1E32A 1SO8A 3FGZA 3WWYA 4TWRA 4ESEA 1NJ2A 3L46A 5F5XA 4DAOA 2AOWA 2PM8A 4KZKA 1DX6A 4J94A 3SF0A 4JSTA 3SKVA 1YSCA 4IBOA 2NZ2A 4XQCA 4MVJM 5JZMA 4ZIRB 1W46A 1NU6A 3P4UA 4MHTA 2Z09A 3V1UA 3Q7QA 3ZY6A 3AZOA 2VHCA 1QS0A 2AI3A 4U02A 4R54A 4MDFA 1ICEA 1TMOA 4OX9Y 1BOFA 1ULTA 2JCXA 5EWLB 1R0RE 4UNRA 1KERA 5IYZB 5L7TA 1G41A 3MXTA 3WDSA 1KQ3A 2RHHA 2PZAA 3MMSA 1NSFA 4DWVA 1CUEA 1E18A 1X0XA 5ICCA 1RXYA 1G6Q1 4RMGA 4NDAA 4EHJA 4YRZA 1DMRA 3UY4A 3RIHA 5I9NA 4N49A 4CGZA 2BR3A 1B0PA 4PZ9A 1NFRA 5ELXA 5C32A 4TLEA 1FDOA 1GY8A 3IUYA 4FD3A 4P22A 4QWWA 4ZDWA 2JFVA 2QI9F 4GBMA 1Z8NA 3U7QA 4YV0A 1A50B 1NVUQ 3KHTA 5HJ7A 1QHFA 1M2KA 3L01A 4YJ2F 5EGSA 2QRNA 3MRSA 3N8KA 1O94C 3R3ZA 3WHKA 1OIXA 4NCNA 1M2OB 1W8DA 4R01A 4XRGA 1XTUA 2XH8A 4FDAA 3RF6A 2YHSA 1SA0A 4DLUA 1KAMA 1ZOPA 2PUTA 2V98A 4TQAA 3ZQKA 1G2QA 3ZQ6A 4Q1BA 5TEWA 3OTQA 4ASUD 2HB6A 2ZI7A 3A31A 4KV7A 5FDFA 2NMVA 4AAYA 5EP2A 3M3DA 4XVHA 1AKYA 2UVDA 4GXTA 4PFJA 5CT8A 4DLPA 4P4NA 4L75A 3VAZA 1EUCB 2CFRA 3I01A 1SCUA 2AKYA 4KACA 1K6EA 3SSOA 3ZE2B 3S2SA 1UBTS 4GICA 1EFHA 1GCAA 4DARA 3UPTA 1ORRA 3DL2A 4RESA 1T8TA 5KPDA 3UH0A 1CR1A 2I6XA 5KYWB 2Q9UA 1CZRA 1Z33A 2QG4A 3HV0A 4KN8A 4FDLA 3EE6A 2BEWB 1JHXA 3CH7A 2P8JA 3PXGA 1ECJA 4YP7A 1HTBA 3B1XA 1EEHA 2A1IA 1R6DA 3AETA 3FWKA 3LX8A 3RTDA 1O94A 2QPOA 2HHJA 1J20A 4O8ZA 4RGBA 3MSXA 4JC5A 3BHMA 1YE5A 4Y30A 2CFIA 1NJ6A 5JPDA 1HC7A 4UHKA 2G5PA 4GOLD 1T24A 1QHYA 4WFQA 1E69A 1UL1X 3IP5A 2E6KA 1OIVA 2JJ2A 4KWHA 5AVSA 5KYUB 2DY1A 3TR6A 4FFNA 1EXMA 1OUMA 2FDXA 4EL0A 4N7RA 4W5RA 3DW1X 1I1HA 3GVCA 2QGNA 2BLNA 3OH8A 1NX9A 2OUKA 1ADYA 3NWBA 4IIJF 3EX7C 5CNKA 4YACA 2JATA 5KPJA 2TMGA 2WD8A 1W0CA 4R69A 1P1RA 1BX1A 2CWWA 2GRUA 3DZJA 4IKPA 1KEPA 2BFMA 2WWRA 4MQLA 3WNDA 2PK3A 4NX2A 5TPWA 2XQFA 2NGRA 1RYBA 3WL4A 3THWA 3R44A 3HO1A 3NT4A 2NTJA 4PAMA 3LOPA 3D8BA 3MMZA 4Q1CA 1RKUA 1QE0A 1ZVMA 4WINA 1YBVA 3E9DA 3UV6A 5FYQA 1SXJA 4RH3A 3LQ4A 2NZ8A 4G5OA 5AKZA 3QG1A 4G4GA 3QVKA 4ME6A 4IIBA 4RK1A 4G0UA 1N1GA 2LIVA 4QUAA 3TIIA 1TPZA 5J5CA 4ZAVA 1Z73A 3ICEA 3QU2A 4PX5A 1JVBA 1KMIY 1X1RA 1ZK4A 3SJAA 4QKQA 3VPAA 2QQFA 5SY4A 5A5DA 2KSQA 4YP1A 1QO0D 2TECE 2JJ2D 3BULA 3H75A 3KT0A 3L6CA 3M4NA 1A8QA 1YJQA 2X1LA 4C6TA 4OG2A 2Q5OA 1ECFA 2F1JA 2WBLC 4D44A 4LC0A 4O1MA 4CQMA 3REFA 2R7NA 1NPTO 3P0EA 1P0PA 3B1VA 2W2PA 1P4GA 3COVA 4OQMA 4Y6RA 3JWHA 4ZK2A 3ZLBA 3LRXA 3C4VA 3S4YA 3O95A 4KP7A 1T36B 4IIEA 7GPBA 5C37A 1UJ4A 2GEFA 3BJEA 4UBIA 2REBA 2M6SA 3G5LA 1U0BB 1MAUA 2YS7A 3D6VA 4CR8A 1PW7A 4JNCA 3BB4A 4CLRB 3VYRB 1NN3A 1SPXA 4HT3B 1DC7A 2EDCA 4CM8B 3QUCA 4JZYA 5CVJA 1QH1A 2PCLA 4KO3S 3AXSA 2YTZA 5U4QA 4KOEC 1C7ZA 1QUEA 1RAFA 2VDWB 2BCEA 2PPLA 3IAS6 4L51A 4RAOA 1JFFB 2APJA 3STXA 4ZCLA 3Q4GA 2PCJA 4WA8A 1U0GA 4D9NA 4RVHA 3IS3A 2WU0A 2XOKD 5TJ9A 4F21A 5I7RA 3LKBA 1VRVA 2GAOA 3RGGA 1MB4A 5BSVA 1QYIA 2DBYA 2ZI3A 2H92A 4FKBA 4TXLA 1U2TA 2EFDB 1P2UA 2C8LA 4V38A 3IBYA 4WDQA 1OD6A 1E3JA 2ZE7A 2J7PD 2Q0QA 1MNQA 1TAHA 5A9SA 4OXXA 2XCLA 1BMTA 4UZFA 1F4VA 1U2EA 1S4QA 4X20B 1PW5A 2LD4A 3OWOA 5LKRA 3DD1A 2VXCA 2EJCA 3VZRA 4RQTA 3AKDA 4UNQA 4XX0B 3PU6A 3A37A 1QH1B 2D3WA 2I1WA 3MOIA 2H3EA 2V0NA 1JR6A 2BR5A 5KSPA 3W04A 4HPXB 3C0KA 4IR7A 4R7ZA 4L5IA 2P9ZA 4AZSA 1NI3A 4MPRA 4TL7A 3PWKA 5BYAA 1GRVA 2MMGA 5D86A 4G0XA 3ZN2A 3QUQA 1YB5A 3OIUA 4XARA 3VKFA 1LNQA 3DFKA 1ECBA 2AG6A 4H77A 3W77A 2YWDA 4I19A 3Q3IA 2NYVA 5MHTA 2BE9A 1ZCFA 5EXTA 1Y7HA 1N25A 1M10A 3L93A 4HLNA 5HS6A 3P9NA 3H5RA 4V0RA 3T0IA 5B2ZA 3HA3A 2VDPB 4K88A 5HCUA 1I5EA 1BW9A 3VAAA 1DCKA 5LZ2A 5KJEA 3UJ6A 3F73A 3ZQ4A 1JIQA 1QVWA 2WIAA 2YBDA 3V2IA 1P9RA 2AMYA 5JWHA 1D3AA 4PFKA 3FF4A 3TOXA 3U3DA 5BWOA 1T5IA 1W1UA 1TFUA 2GBLA 4RANA 4LRQA 2I99A 4FYHA 5HF8A 1IE3A 2AJCA 1NBHA 3RVQA 3U4QA 1OCEA 3AF4A 2X0DA 4N18A 3E6AA 3ZWPA 2VK4A 1X77A 4YCSA 3ED5A 1Z56C 4RCYA 3DBOB 1OXVA 3PC7A 2ZJ4A 5K09A 3SR0A 1CNMA 1SA0B 1MG5A 4MQ6A 5LD2B 1WDTA 1PWEA 3H1EA 3PJEA 3KEGA 1CEYA 1SC6A 4N0EA 1DWQA 5FTJA 4W5HA 2MTBA 3NH9A 3IR5A 5BR4A 5BW8A 2E4ZA 4LFBB 1SM4A 4DNXA 4XFDA 4DLYA 5AVYA 3ZWQA 2GB4A 1EE2A 1I2BA 1E1MA 2C20A 3FZNA 3WVNA 4W5QA 4KK3A 3C5VA 1K6MA 4EBFA 1QGDA 1DO8A 1PQUA 5FCDA 5FNZA 5DNCA 3K1AB 3U17A 2RONA 4D5EA 3CRRA 3X1MA 3ZBQA 1LZLA 1S8NA 1IHPA 2ROQA 2NPOA 3D1VA 1ZUNB 3D8HA 4S35A 4KIFA 5ARCA 3OT1B 1EVKA 3A0UA 3JRXA 4MS4B 4GKKB 1PHPA 1T1GA 1ELOA 1T0BA 2ZEJA 3T7DA 5FXMA 3R9IA 1FVHA 3GLGA 2C4VA 4JXZA 4BNFA 1Y7PA 3CURA 5F52A 4BPRA 4BLQA 3NHBA 3QF7A 1BE0A 4REQB 1REQB 4LNHA 3AFMA 2I7TA 2VP4A 2BE7A 1P4AA 4GEKA 2VBCA 1JYEA 1ZA1A 1HRKA 1QKJA 3CB4A 5H02A 1HYGA 2W6CX 3KB1A 2ZQYA 2IEZA 1DAGA 4IILA 3C43A 2OCIA 1FS4A 4KGVA 2BMEA 1ZK1A 3AHCA 1WCIB 1M6HA 3DHYA 1RAAA 1G20E 1QHEA 3S29A 1NZDA 4QXMA 4MYDA 1VG9B 5LL6P 3KYCA 2ZRNA 4TYMA 3O4VA 4DDHA 1VSQA 4RVGA 3ZXIA 5A0TA 2HSDA 4A0GA 5KOIA 5ALSA 1FQKA 4TTAA 3W8RA 7REQB 1MB9A 1QE5A 3K6JA 4IO0A 1QRRA 3I39X 5JDIC 1DUSA 1TOAA 2GN9A 4G0ZA 5C5DA 4PZCA 2CNOA 4IGKA 3ZIDA 3HRIA 1I2DA 5C8YB 1TT7A 1XHLA 1RAHA 1Z75A 4Z3OA 4BYGA 5A3JA 5CM8B 2CLKB 1Z2CA 3BTUA 3QENA 1J8DA 3STUA 3WNBA 1VHQA 4LEIA 4M1TA 1V1JA 4FBGA 3GFVA 2YFKA 1V26A 4NZNA 1L5GB 2OD7A 4XQGA 2E82A 3K0AB 2AXNA 4U7WA 5ESRA 4AXXA 3ZWMA 3OC6A 3RGWS 2GM9A 1N1MA 2R00C 3KUDA 3W8FA 1U2SA 3O2JA 4OMUA 5HQ3A 3ZLJA 16PKA 2OAEA 2WB4A 5DULA 1XPJA 2E48A 2EATA 5FV7A 2VP9A 4YAEA 1VMAA 4W5TA 2VZ0A 5E3HA 3ETCA 2Q5IA 1T15A 4UEJA 5AM4A 2XVYA 3ISTA 5EUBA 3TL3A 4D0GA 2R4UA 2QRMA 3VDNB 1WWKA 3K0AA 5KTKA 3O8LA 2QUIA 3KV3O 4TVOA 5K3CA 4JLKA 4U7DA 1QHNA 2I4TA 4RY2A 1EI9A 2X0RA 4BNGA 4H27A 4AJ9A 4I50B 4MJXA 4C7KA 2CMKA 3ANXA 5M2QA 2QJWA 3GJXC 4MW2A 1PQPA 2G1KA 1TW2A 3OEHD 4LMBA 1ID8A 1L7PA 1MJ5A 2AW5A 1JFRA 1H1LB 2CC2A 2V65A 4Y0AA 1A27A 3JR7A 2QRGA 4R1MA 1JHOA 1ZO8A 2HWUA 1Z63A 1T1EA 1A9XB 4M9XA 5FUVA 4EFNA 4GC9A 4EW2A 1R5OA 4MKFA 2QYSA 5JDCA 2XSZD 2RHJA 1JEEA 2W2LA 3NHSA 2AN9A 4UNPA 4E2YA 1VBKA 3NC4A 1FIUA 2YIMA 3DFMA 5TMBA 1S2LA 3KTDA 1I1OA 3F7OA 3SWWA 3TUIC 5IAJA 4OREX 3EGIA 1V2HE 2P6OA 3ESXA 1XWFA 1GOTA 4P54A 1K7SN 4HH3C 4IJUA 5ITZA 3ORSA 4RLQA 3MVEA 3IURA 4D25A 4JVNA 3S7TA 1HFJA 1N7HA 1Q19A 1V45E 2OENG 2QR2A 1ZBDA 4K8OA 2PA3A 4GOJA 3AV0B 1X7ZA 3E61A 1YCHA 2GBGA 1F4LA 3KUCA 5LNK1 2C88A 5GZ6A 1W5TA 4QGAA 4BE9A 3WQQA 5CLJA 3PKZA 2B4RO 2D1QA 5TQ0B 2QMEA 3JVVA 3QEKA 1T2VA 4JLOA 3QWIA 1EA5A 1VC2A 1I5RA 1RI2A 2DR0A 2WWIA 3TTUA 1GR0A 1M72A 5L3QB 4RGYA 2UXDB 2G72A 1XU7A 1Y8QA 2DE0X 1BMQA 2ANBA 2PSFA 2DBRA 2GN2A 4N8EA 2JFNA 3UWMA 1DKPA 2GBCA 5FA6A 5AW5A 4MWOA 1NPYA 2H1VA 1QXSA 1T3GA 4LKOA 4L22A 1E1RA 5ALJA 3G68A 1HQDA 4JDUA 3WIOA 5EJEA 1QMGA 3HADA 3TINA 5H7XA 1QG4A 3JYHA 4RJ2A 3OKPA 3ZWKA 5F77A 1LDBA 4HQNA 4EEXA 3SIRA 3PX2A 2GPAA 1XRQA 1T1SA 4UFNA 3BK7A 3WSTA 4TRRA 1FB5A 2XYVA 3QFHA 2QMQA 1DCTA 2X7XA 3TXAA 2V7VA 1PJ2A 2NVBA 4MW7A 3ROGA 4TXMA 1M0EA 1XCMA 4C4TA 1RQNA 1P0CA 4C06A 2EXXA 5BN3A 4KR6A 1OYYA 1I6WA 2RG1A 1Z38A 4MQEB 1DAEA 1SCDA 2VYND 4P0TA 4WESB 2PUBA 3E2PA 4RK6A 4K1LA 1DHTA 3W9YA 3FNIA 3R7FA 4RL6A 1JDJA 2CW5A 1PVVA 3RSZA 3W3AH 2YHAA 3PNPA 4OM8A 5BT8A 4WASA